| Basic Information | |
|---|---|
| Family ID | F024746 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 204 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQENA |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.33 % |
| % of genes near scaffold ends (potentially truncated) | 27.45 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.765 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (78.431 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.353 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (98.529 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.76 % |
| All Organisms | root | All Organisms | 38.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005451|Ga0066681_10986225 | Not Available | 503 | Open in IMG/M |
| 3300005532|Ga0070739_10464971 | Not Available | 576 | Open in IMG/M |
| 3300005575|Ga0066702_10843226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → unclassified Candidatus Melainabacteria → Candidatus Melainabacteria bacterium HGW-Melainabacteria-1 | 546 | Open in IMG/M |
| 3300006046|Ga0066652_101943338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 526 | Open in IMG/M |
| 3300006800|Ga0066660_10665170 | Not Available | 862 | Open in IMG/M |
| 3300006804|Ga0079221_11054899 | Not Available | 616 | Open in IMG/M |
| 3300009090|Ga0099827_11982313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 506 | Open in IMG/M |
| 3300009137|Ga0066709_102605003 | Not Available | 677 | Open in IMG/M |
| 3300010061|Ga0127462_160704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 562 | Open in IMG/M |
| 3300010065|Ga0127435_115452 | Not Available | 610 | Open in IMG/M |
| 3300010065|Ga0127435_121300 | Not Available | 560 | Open in IMG/M |
| 3300010065|Ga0127435_128488 | Not Available | 592 | Open in IMG/M |
| 3300010065|Ga0127435_151134 | Not Available | 610 | Open in IMG/M |
| 3300010068|Ga0127442_113278 | Not Available | 816 | Open in IMG/M |
| 3300010070|Ga0127441_121188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 528 | Open in IMG/M |
| 3300010070|Ga0127441_122254 | Not Available | 834 | Open in IMG/M |
| 3300010071|Ga0127477_156731 | Not Available | 571 | Open in IMG/M |
| 3300010073|Ga0127429_138683 | Not Available | 602 | Open in IMG/M |
| 3300010074|Ga0127439_126007 | Not Available | 569 | Open in IMG/M |
| 3300010075|Ga0127434_159568 | Not Available | 611 | Open in IMG/M |
| 3300010075|Ga0127434_165208 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300010076|Ga0127430_100654 | Not Available | 622 | Open in IMG/M |
| 3300010076|Ga0127430_145720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 513 | Open in IMG/M |
| 3300010079|Ga0127436_108706 | Not Available | 789 | Open in IMG/M |
| 3300010079|Ga0127436_127991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 722 | Open in IMG/M |
| 3300010079|Ga0127436_169826 | Not Available | 552 | Open in IMG/M |
| 3300010083|Ga0127478_1092266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 560 | Open in IMG/M |
| 3300010084|Ga0127461_1051976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 855 | Open in IMG/M |
| 3300010085|Ga0127445_1085524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 637 | Open in IMG/M |
| 3300010086|Ga0127496_1050883 | Not Available | 550 | Open in IMG/M |
| 3300010088|Ga0127476_1009617 | Not Available | 789 | Open in IMG/M |
| 3300010088|Ga0127476_1036273 | Not Available | 639 | Open in IMG/M |
| 3300010088|Ga0127476_1064198 | Not Available | 584 | Open in IMG/M |
| 3300010090|Ga0127471_1064937 | Not Available | 610 | Open in IMG/M |
| 3300010090|Ga0127471_1071620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 954 | Open in IMG/M |
| 3300010093|Ga0127490_1106302 | Not Available | 635 | Open in IMG/M |
| 3300010094|Ga0127480_1041378 | Not Available | 581 | Open in IMG/M |
| 3300010094|Ga0127480_1063302 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300010094|Ga0127480_1098396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 619 | Open in IMG/M |
| 3300010095|Ga0127475_1039125 | Not Available | 609 | Open in IMG/M |
| 3300010095|Ga0127475_1076306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1119 | Open in IMG/M |
| 3300010095|Ga0127475_1119669 | Not Available | 506 | Open in IMG/M |
| 3300010095|Ga0127475_1120794 | Not Available | 573 | Open in IMG/M |
| 3300010096|Ga0127473_1008448 | Not Available | 830 | Open in IMG/M |
| 3300010097|Ga0127501_1056105 | Not Available | 584 | Open in IMG/M |
| 3300010098|Ga0127463_1003117 | Not Available | 601 | Open in IMG/M |
| 3300010099|Ga0127450_1020690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1005 | Open in IMG/M |
| 3300010099|Ga0127450_1033875 | Not Available | 794 | Open in IMG/M |
| 3300010100|Ga0127440_1010865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 729 | Open in IMG/M |
| 3300010100|Ga0127440_1014625 | Not Available | 533 | Open in IMG/M |
| 3300010100|Ga0127440_1130560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 525 | Open in IMG/M |
| 3300010101|Ga0127481_1097726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 507 | Open in IMG/M |
| 3300010101|Ga0127481_1114342 | Not Available | 583 | Open in IMG/M |
| 3300010101|Ga0127481_1136198 | Not Available | 635 | Open in IMG/M |
| 3300010102|Ga0127453_1011197 | Not Available | 576 | Open in IMG/M |
| 3300010102|Ga0127453_1024616 | Not Available | 705 | Open in IMG/M |
| 3300010102|Ga0127453_1088122 | Not Available | 766 | Open in IMG/M |
| 3300010103|Ga0127500_1003925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1016 | Open in IMG/M |
| 3300010103|Ga0127500_1011870 | Not Available | 553 | Open in IMG/M |
| 3300010103|Ga0127500_1015426 | Not Available | 534 | Open in IMG/M |
| 3300010103|Ga0127500_1032962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 525 | Open in IMG/M |
| 3300010105|Ga0127470_1002371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 920 | Open in IMG/M |
| 3300010105|Ga0127470_1019214 | Not Available | 554 | Open in IMG/M |
| 3300010106|Ga0127472_1059599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1112 | Open in IMG/M |
| 3300010106|Ga0127472_1059599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1112 | Open in IMG/M |
| 3300010106|Ga0127472_1125669 | Not Available | 530 | Open in IMG/M |
| 3300010108|Ga0127474_1097120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1039 | Open in IMG/M |
| 3300010109|Ga0127497_1099761 | Not Available | 684 | Open in IMG/M |
| 3300010109|Ga0127497_1103815 | Not Available | 515 | Open in IMG/M |
| 3300010109|Ga0127497_1133239 | Not Available | 599 | Open in IMG/M |
| 3300010111|Ga0127491_1028090 | Not Available | 594 | Open in IMG/M |
| 3300010112|Ga0127458_1016752 | Not Available | 764 | Open in IMG/M |
| 3300010112|Ga0127458_1051359 | Not Available | 744 | Open in IMG/M |
| 3300010112|Ga0127458_1127865 | Not Available | 599 | Open in IMG/M |
| 3300010113|Ga0127444_1004826 | Not Available | 513 | Open in IMG/M |
| 3300010113|Ga0127444_1094478 | Not Available | 884 | Open in IMG/M |
| 3300010114|Ga0127460_1015776 | Not Available | 744 | Open in IMG/M |
| 3300010115|Ga0127495_1025385 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300010116|Ga0127466_1046143 | Not Available | 648 | Open in IMG/M |
| 3300010116|Ga0127466_1055997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 990 | Open in IMG/M |
| 3300010116|Ga0127466_1127094 | Not Available | 664 | Open in IMG/M |
| 3300010118|Ga0127465_1025745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 533 | Open in IMG/M |
| 3300010118|Ga0127465_1038284 | Not Available | 637 | Open in IMG/M |
| 3300010118|Ga0127465_1066327 | Not Available | 509 | Open in IMG/M |
| 3300010119|Ga0127452_1036323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 854 | Open in IMG/M |
| 3300010120|Ga0127451_1165978 | Not Available | 970 | Open in IMG/M |
| 3300010121|Ga0127438_1071649 | Not Available | 613 | Open in IMG/M |
| 3300010121|Ga0127438_1127908 | Not Available | 717 | Open in IMG/M |
| 3300010123|Ga0127479_1052879 | Not Available | 743 | Open in IMG/M |
| 3300010123|Ga0127479_1070545 | Not Available | 678 | Open in IMG/M |
| 3300010123|Ga0127479_1113268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 670 | Open in IMG/M |
| 3300010125|Ga0127443_1148568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 559 | Open in IMG/M |
| 3300010127|Ga0127489_1107817 | Not Available | 654 | Open in IMG/M |
| 3300010128|Ga0127486_1125655 | Not Available | 555 | Open in IMG/M |
| 3300010132|Ga0127455_1017230 | Not Available | 527 | Open in IMG/M |
| 3300010132|Ga0127455_1048046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 641 | Open in IMG/M |
| 3300010133|Ga0127459_1021420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 595 | Open in IMG/M |
| 3300010136|Ga0127447_1152922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1317 | Open in IMG/M |
| 3300010139|Ga0127464_1024679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 620 | Open in IMG/M |
| 3300010140|Ga0127456_1051418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 770 | Open in IMG/M |
| 3300010141|Ga0127499_1224686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 867 | Open in IMG/M |
| 3300010142|Ga0127483_1099253 | Not Available | 535 | Open in IMG/M |
| 3300010142|Ga0127483_1250713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 576 | Open in IMG/M |
| 3300010143|Ga0126322_1252694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 707 | Open in IMG/M |
| 3300010152|Ga0126318_10005441 | Not Available | 950 | Open in IMG/M |
| 3300010152|Ga0126318_10006324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 611 | Open in IMG/M |
| 3300010152|Ga0126318_10057047 | Not Available | 658 | Open in IMG/M |
| 3300010152|Ga0126318_10148143 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
| 3300010152|Ga0126318_10233898 | Not Available | 599 | Open in IMG/M |
| 3300010152|Ga0126318_10278256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 825 | Open in IMG/M |
| 3300010152|Ga0126318_10294064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 940 | Open in IMG/M |
| 3300010152|Ga0126318_10313957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 798 | Open in IMG/M |
| 3300010152|Ga0126318_10356412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 702 | Open in IMG/M |
| 3300010152|Ga0126318_10369035 | Not Available | 501 | Open in IMG/M |
| 3300010152|Ga0126318_10416777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 688 | Open in IMG/M |
| 3300010152|Ga0126318_10474158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 776 | Open in IMG/M |
| 3300010152|Ga0126318_10499443 | Not Available | 770 | Open in IMG/M |
| 3300010152|Ga0126318_10512825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 516 | Open in IMG/M |
| 3300010152|Ga0126318_10536918 | Not Available | 515 | Open in IMG/M |
| 3300010152|Ga0126318_10540366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 567 | Open in IMG/M |
| 3300010152|Ga0126318_10581485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 702 | Open in IMG/M |
| 3300010152|Ga0126318_10586262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 593 | Open in IMG/M |
| 3300010152|Ga0126318_10586284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 661 | Open in IMG/M |
| 3300010152|Ga0126318_10615278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 515 | Open in IMG/M |
| 3300010152|Ga0126318_10695896 | Not Available | 539 | Open in IMG/M |
| 3300010152|Ga0126318_10716244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1043 | Open in IMG/M |
| 3300010152|Ga0126318_10722890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 874 | Open in IMG/M |
| 3300010152|Ga0126318_10767446 | Not Available | 1005 | Open in IMG/M |
| 3300010152|Ga0126318_10916296 | Not Available | 936 | Open in IMG/M |
| 3300010152|Ga0126318_10959610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 662 | Open in IMG/M |
| 3300010152|Ga0126318_11114924 | Not Available | 800 | Open in IMG/M |
| 3300010152|Ga0126318_11128447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 944 | Open in IMG/M |
| 3300010152|Ga0126318_11140141 | Not Available | 841 | Open in IMG/M |
| 3300010335|Ga0134063_10329536 | Not Available | 738 | Open in IMG/M |
| 3300010895|Ga0138113_140850 | Not Available | 621 | Open in IMG/M |
| 3300010896|Ga0138111_1152474 | Not Available | 598 | Open in IMG/M |
| 3300010905|Ga0138112_1038448 | Not Available | 682 | Open in IMG/M |
| 3300012224|Ga0134028_1096890 | Not Available | 613 | Open in IMG/M |
| 3300012224|Ga0134028_1300431 | Not Available | 652 | Open in IMG/M |
| 3300012354|Ga0137366_10321691 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300012371|Ga0134022_1088443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 988 | Open in IMG/M |
| 3300012371|Ga0134022_1113583 | Not Available | 700 | Open in IMG/M |
| 3300012372|Ga0134037_1132777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 530 | Open in IMG/M |
| 3300012372|Ga0134037_1170245 | Not Available | 636 | Open in IMG/M |
| 3300012372|Ga0134037_1180520 | Not Available | 1019 | Open in IMG/M |
| 3300012372|Ga0134037_1195109 | Not Available | 558 | Open in IMG/M |
| 3300012372|Ga0134037_1216449 | Not Available | 503 | Open in IMG/M |
| 3300012374|Ga0134039_1031604 | Not Available | 728 | Open in IMG/M |
| 3300012374|Ga0134039_1082565 | Not Available | 722 | Open in IMG/M |
| 3300012374|Ga0134039_1090847 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300012374|Ga0134039_1188726 | Not Available | 659 | Open in IMG/M |
| 3300012374|Ga0134039_1198470 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300012374|Ga0134039_1227117 | Not Available | 533 | Open in IMG/M |
| 3300012375|Ga0134034_1045288 | Not Available | 676 | Open in IMG/M |
| 3300012375|Ga0134034_1253704 | Not Available | 684 | Open in IMG/M |
| 3300012376|Ga0134032_1063265 | Not Available | 806 | Open in IMG/M |
| 3300012376|Ga0134032_1118512 | Not Available | 787 | Open in IMG/M |
| 3300012376|Ga0134032_1221920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 515 | Open in IMG/M |
| 3300012376|Ga0134032_1237346 | Not Available | 593 | Open in IMG/M |
| 3300012376|Ga0134032_1241860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 539 | Open in IMG/M |
| 3300012377|Ga0134029_1255220 | Not Available | 747 | Open in IMG/M |
| 3300012378|Ga0134025_1100702 | Not Available | 838 | Open in IMG/M |
| 3300012378|Ga0134025_1201784 | Not Available | 593 | Open in IMG/M |
| 3300012379|Ga0134058_1048148 | Not Available | 508 | Open in IMG/M |
| 3300012381|Ga0134026_1256269 | Not Available | 672 | Open in IMG/M |
| 3300012382|Ga0134038_1077708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 569 | Open in IMG/M |
| 3300012382|Ga0134038_1197265 | Not Available | 518 | Open in IMG/M |
| 3300012382|Ga0134038_1209944 | Not Available | 623 | Open in IMG/M |
| 3300012383|Ga0134033_1036245 | Not Available | 520 | Open in IMG/M |
| 3300012383|Ga0134033_1036472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1080 | Open in IMG/M |
| 3300012383|Ga0134033_1104719 | Not Available | 594 | Open in IMG/M |
| 3300012383|Ga0134033_1205452 | Not Available | 613 | Open in IMG/M |
| 3300012383|Ga0134033_1211516 | Not Available | 508 | Open in IMG/M |
| 3300012383|Ga0134033_1281910 | Not Available | 536 | Open in IMG/M |
| 3300012384|Ga0134036_1096044 | Not Available | 572 | Open in IMG/M |
| 3300012384|Ga0134036_1121255 | Not Available | 542 | Open in IMG/M |
| 3300012384|Ga0134036_1161337 | Not Available | 774 | Open in IMG/M |
| 3300012384|Ga0134036_1219520 | Not Available | 708 | Open in IMG/M |
| 3300012384|Ga0134036_1238185 | Not Available | 855 | Open in IMG/M |
| 3300012384|Ga0134036_1272200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 575 | Open in IMG/M |
| 3300012385|Ga0134023_1017592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 523 | Open in IMG/M |
| 3300012385|Ga0134023_1091153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 795 | Open in IMG/M |
| 3300012387|Ga0134030_1088247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 957 | Open in IMG/M |
| 3300012387|Ga0134030_1231325 | Not Available | 576 | Open in IMG/M |
| 3300012388|Ga0134031_1105596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 548 | Open in IMG/M |
| 3300012389|Ga0134040_1159633 | Not Available | 582 | Open in IMG/M |
| 3300012390|Ga0134054_1009337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 753 | Open in IMG/M |
| 3300012390|Ga0134054_1027753 | Not Available | 568 | Open in IMG/M |
| 3300012390|Ga0134054_1208297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 1035 | Open in IMG/M |
| 3300012391|Ga0134035_1136460 | Not Available | 860 | Open in IMG/M |
| 3300012401|Ga0134055_1016557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 529 | Open in IMG/M |
| 3300012401|Ga0134055_1327803 | Not Available | 525 | Open in IMG/M |
| 3300012401|Ga0134055_1368809 | Not Available | 627 | Open in IMG/M |
| 3300012405|Ga0134041_1088654 | Not Available | 509 | Open in IMG/M |
| 3300012406|Ga0134053_1323040 | Not Available | 571 | Open in IMG/M |
| 3300012406|Ga0134053_1356287 | Not Available | 530 | Open in IMG/M |
| 3300012406|Ga0134053_1373436 | Not Available | 642 | Open in IMG/M |
| 3300012407|Ga0134050_1117593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 916 | Open in IMG/M |
| 3300012409|Ga0134045_1010953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 584 | Open in IMG/M |
| 3300018431|Ga0066655_10731769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 670 | Open in IMG/M |
| 3300018468|Ga0066662_12074927 | Not Available | 596 | Open in IMG/M |
| 3300018482|Ga0066669_11294119 | Not Available | 659 | Open in IMG/M |
| 3300022724|Ga0242665_10213015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 642 | Open in IMG/M |
| 3300034661|Ga0314782_034233 | Not Available | 943 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 78.43% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 14.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010065 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010068 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010070 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010071 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010073 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010074 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010076 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010079 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010083 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010088 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010090 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010094 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010095 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010097 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010116 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010121 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010895 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010896 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066681_109862251 | 3300005451 | Soil | TLTSNRQAMPEIGGESMTTDQEIETLKQALRYLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0070739_104649712 | 3300005532 | Surface Soil | MPEIGGETMTNDHQIELLKQRLLDLVEEILVISNQLATLAESIL |
| Ga0066702_108432262 | 3300005575 | Soil | MTTDQEIEMLTQQQRLLDLAQEILDISHQLATLAESIMRSQ |
| Ga0066652_1019433382 | 3300006046 | Soil | MTTDQQIEMLTQQKRLLDLAQEILNISHQLATLAESIMRSQENA* |
| Ga0066660_106651701 | 3300006800 | Soil | MTTDQEIEVLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0079221_110548991 | 3300006804 | Agricultural Soil | QIELLKQRLLDLVEEILVISNQLATLAESILRSQEKP* |
| Ga0099827_119823132 | 3300009090 | Vadose Zone Soil | MPEIGGESMTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQENV* |
| Ga0066709_1026050031 | 3300009137 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127462_1607042 | 3300010061 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQEHP* |
| Ga0127435_1154522 | 3300010065 | Grasslands Soil | MPEIGGESMTTDQEIEMLKQTLVDLAAEIHIISCQLATLAESIMRSQEHD* |
| Ga0127435_1213001 | 3300010065 | Grasslands Soil | MTTDQKIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQENA* |
| Ga0127435_1284881 | 3300010065 | Grasslands Soil | NDQQIELLKQRLLDLVEEIVNISNQLATLAESILRSQEHD* |
| Ga0127435_1511341 | 3300010065 | Grasslands Soil | SGRKQVNRPEIGGESMTTDQQIEMLTQQKRLLDLAQEILNISHQLATLAESIMRSQENA* |
| Ga0127442_1132782 | 3300010068 | Grasslands Soil | MTKDQQIEMLKQTLLDLVEEIVDISHQLATLAESILRSQEHE* |
| Ga0127441_1211882 | 3300010070 | Grasslands Soil | MTNDQQIELLKQRLLDLVEEIVNISNQLATLAESILRSQEH |
| Ga0127441_1222542 | 3300010070 | Grasslands Soil | MTTDQEIETLKQRLLDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127477_1567311 | 3300010071 | Grasslands Soil | MPEIGGESMTTDQEIELLKQALRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127429_1386831 | 3300010073 | Grasslands Soil | QQATKPEIGGESMTTDQEIETLKQTLRDLAAEIHMISCQLATLAESIMRSQENA* |
| Ga0127439_1260071 | 3300010074 | Grasslands Soil | TTDQKIEMLTQQKRLLDLAKEILDISHQLATLAESIMRSQENA* |
| Ga0127434_1595681 | 3300010075 | Grasslands Soil | HTKPEIGGETMTNDQQIELLKQRLLDLVEEIVDISNQLATLAESIMRSQENA* |
| Ga0127434_1652083 | 3300010075 | Grasslands Soil | MTTDQEIELLKQTLHDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127430_1006542 | 3300010076 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIQTISSQLATLAESIMRSQEHA* |
| Ga0127430_1457202 | 3300010076 | Grasslands Soil | MTTDQEIETLKQTLRDMAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0127436_1087062 | 3300010079 | Grasslands Soil | MTTDQKIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQEHE* |
| Ga0127436_1279913 | 3300010079 | Grasslands Soil | MTNDQQIELLKQTLLDLAEEIVDISNQLATLAESIMRSQEHE* |
| Ga0127436_1698261 | 3300010079 | Grasslands Soil | MTTDQEIEMLKQMLRDLAAEIQKVSCQLATLAESIMRSQENT* |
| Ga0127478_10922661 | 3300010083 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQEHA* |
| Ga0127461_10519763 | 3300010084 | Grasslands Soil | MPEIGGESMTTDQEIETLKQMLLDVAEEIQDISCQLETLAESIMRSQENA* |
| Ga0127445_10855242 | 3300010085 | Grasslands Soil | MTTDQEIETLKQTLRDMAAEIHIISCQLATLAESIMRSQEHE* |
| Ga0127496_10508831 | 3300010086 | Grasslands Soil | MTTDQQIEMLMQQKRLLDLAQEILNISHQLATLAESIMRSQENA* |
| Ga0127476_10096172 | 3300010088 | Grasslands Soil | MTNDQQIELLKQRLLDLVEEIVNISNQLATLAESILRSQEHD* |
| Ga0127476_10362732 | 3300010088 | Grasslands Soil | MPEIGGESMTTDQEIETLKQMLLDMAEEIQDISCQLATLAESIMRSQEKP* |
| Ga0127476_10641982 | 3300010088 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQEHL* |
| Ga0127471_10649371 | 3300010090 | Grasslands Soil | MTNDQQIVLLKQRLLDLVEEIVDISHQLATLAESILRSQEHG* |
| Ga0127471_10716202 | 3300010090 | Grasslands Soil | MTTDQEIETLKQTLRDMAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127490_11063021 | 3300010093 | Grasslands Soil | MTTDQEIEMLKQMLRDLAAEIQKVSCKLATLAESIMRSQENA* |
| Ga0127480_10413781 | 3300010094 | Grasslands Soil | ESMTTDQEIETLKQTLRDMAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127480_10633022 | 3300010094 | Grasslands Soil | MTNDQQIEMLKQTLLDLVEEILVISNQLATLAESILRSQEHE* |
| Ga0127480_10983962 | 3300010094 | Grasslands Soil | MPEIGGESMTTDQEIELLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127475_10391251 | 3300010095 | Grasslands Soil | MTKDQQIVLLKKRLLDLVEEIVDISNQLATLAESILRSQEHD* |
| Ga0127475_10763062 | 3300010095 | Grasslands Soil | MTKDQEIEMLKQRLLDLAEEIQDISNQLATLAESIMRSQEHT* |
| Ga0127475_11196691 | 3300010095 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIQKVSCQLATLAESIMRSQEHT* |
| Ga0127475_11207941 | 3300010095 | Grasslands Soil | SMTTDQEIETLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127473_10084482 | 3300010096 | Grasslands Soil | MGGEAMTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127501_10561051 | 3300010097 | Grasslands Soil | IEMLKQRLLDLVEEIVNISNQLATLAESILRSQEHD* |
| Ga0127463_10031171 | 3300010098 | Grasslands Soil | MPEIGGESMTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQEHA* |
| Ga0127450_10206902 | 3300010099 | Grasslands Soil | MPEIGGESMTTDQQIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQEHA* |
| Ga0127450_10338753 | 3300010099 | Grasslands Soil | MPEIGGESMTTDQEIELLKQTLRDLAAEIHIISCQLATL |
| Ga0127440_10108652 | 3300010100 | Grasslands Soil | MPEIGGETMTNDQQIELLKQRLLDLAEEILVISHQLATLAESILRSQEHG* |
| Ga0127440_10146252 | 3300010100 | Grasslands Soil | MTTDQEIETLKQTLCDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127440_11305601 | 3300010100 | Grasslands Soil | MTTDQEIETLKQTLLAMVEEIEDISRQLATLAESILRSQE |
| Ga0127481_10977262 | 3300010101 | Grasslands Soil | MPEIGGESMTTDQEIETLKQTLRDLAAEIHIISCQLATLAESIMRSQEHA* |
| Ga0127481_11143422 | 3300010101 | Grasslands Soil | MTNDQQIVLLKKRLLDLVEEIQDISDQLATLAESIMRSQENT* |
| Ga0127481_11361981 | 3300010101 | Grasslands Soil | TDQEIEMLTQQKRLLDLAQEILDISNQLATLAESIMRSQENA* |
| Ga0127453_10111971 | 3300010102 | Grasslands Soil | RKQVNRPEIGGESMTTDQEIEVLKQSLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127453_10246162 | 3300010102 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIQKVSCQLATLAESIMRSQENT* |
| Ga0127453_10881222 | 3300010102 | Grasslands Soil | MPEIGGETMTNDQQIELLKQRLLALVEEIVKISNQLATLAESIMRSQEHG* |
| Ga0127500_10039252 | 3300010103 | Grasslands Soil | MPEIGGETMTNDQQIELLKKRLLDLAEEIQDISNQLATLAESIMRSQEHG* |
| Ga0127500_10118701 | 3300010103 | Grasslands Soil | GESMTTDHEIEMLTQQKRLLDLAQEILNISHQLATLAESIMRSQEHA* |
| Ga0127500_10154261 | 3300010103 | Grasslands Soil | MTTDQQIEMLKQQKRLLDLAQEILNISHQLATLAESIMRSQENA* |
| Ga0127500_10329622 | 3300010103 | Grasslands Soil | MTTDQEIEMLKQSLRDLAAEIHIISCQLATLAESIMRS |
| Ga0127470_10023711 | 3300010105 | Grasslands Soil | MPEIGGETMTNDQQIELLKQRLLDLAEEILVISHQLATLAESILRSQEHE* |
| Ga0127470_10192141 | 3300010105 | Grasslands Soil | GESMTTDQEIEMLKQTLRDLAAEIQKVSCQLATLAESIMRSQEHA* |
| Ga0127472_10595991 | 3300010106 | Grasslands Soil | MTNDQQIELLKKRLLDLAEEIVKISSQLATLAESILRSQEHE* |
| Ga0127472_10595993 | 3300010106 | Grasslands Soil | MTNDQQIELLKQRLLDLVEEIVNISNQLATLAESILRSQEHT* |
| Ga0127472_11256692 | 3300010106 | Grasslands Soil | MTKDQQIVLLKQTLLDLVEEIVDISHQLATLAESILRSQE |
| Ga0127474_10971202 | 3300010108 | Grasslands Soil | MTNDQQIELLKQRLLDLVEEILVISNQLATLAESILRSQEKP* |
| Ga0127497_10997611 | 3300010109 | Grasslands Soil | MTTDQEIETLKQMLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127497_11038151 | 3300010109 | Grasslands Soil | SMTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127497_11332391 | 3300010109 | Grasslands Soil | LTSNRHTMPEIGGESMTTDQEIETLKQMLLDMAEEIQDISCQLETLAESIMRSQEHA* |
| Ga0127491_10280902 | 3300010111 | Grasslands Soil | MTTDQEIELLKQTLRDLAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0127458_10167522 | 3300010112 | Grasslands Soil | MPEIGGESMTTDQEIEVLKQTLRDLAAEIHIISCQLATLAESIMRSQENT* |
| Ga0127458_10513592 | 3300010112 | Grasslands Soil | MTKDQEIELLKKRLLDLAEEIQDISGQLATLAESILRSQEHG* |
| Ga0127458_11278652 | 3300010112 | Grasslands Soil | MTTDQEIEMLTQQKRLLDLAAEIHIISCQLATLAESIMRSQENT* |
| Ga0127444_10048261 | 3300010113 | Grasslands Soil | MPEIGGETMTNDQQIELLKQRLLDLVEEILVISNQLATLAESIL |
| Ga0127444_10944781 | 3300010113 | Grasslands Soil | MTNDQEIELLKQRLLALVEEILVISSQLATLAESILRSQEHG* |
| Ga0127460_10157761 | 3300010114 | Grasslands Soil | MPEIGGESMTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127495_10253851 | 3300010115 | Grasslands Soil | MPEIGGESMTTDQQIEMLKQQQRLLDLAQEILDISHQLATLAESIMRSQENA* |
| Ga0127466_10461431 | 3300010116 | Grasslands Soil | MTTDQEIEMLKQSLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127466_10559972 | 3300010116 | Grasslands Soil | MPEIGGETMTNDQQIELLKQTLLDLAEEIVDISHQLATLAESILRSQEHD* |
| Ga0127466_11270942 | 3300010116 | Grasslands Soil | MTTDQEIETLKQALRDLAAEIHIISCQLATLAESIMRSQENV* |
| Ga0127465_10257452 | 3300010118 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIQKVSCQLATLAESIM |
| Ga0127465_10382841 | 3300010118 | Grasslands Soil | MGGESMTTDQEIEMLKQTLADLAAEIHIISCQLATLAESIMRSQENV* |
| Ga0127465_10663271 | 3300010118 | Grasslands Soil | VSFTHSPATGNAMPEIGGETMTNDQQIELLKQRLLDLAEEILVISHQLATLAESILRSQEHG* |
| Ga0127452_10363232 | 3300010119 | Grasslands Soil | MPMTKDQQIEMLKQTLLDLVEEILVISNQLATLAESILRSQEHE* |
| Ga0127451_11659782 | 3300010120 | Grasslands Soil | MPEIGGESMTTDQEIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQENT* |
| Ga0127438_10716491 | 3300010121 | Grasslands Soil | MTNDQQIVLLKKRLLDLVEEIVDISNQLATLAESILRSQEHD* |
| Ga0127438_11279082 | 3300010121 | Grasslands Soil | MPEIGGETMTNDQQIELLKQRLLDLVEEILVISNQLATLAESVLRSQEKP* |
| Ga0127479_10528792 | 3300010123 | Grasslands Soil | MTTDQEIAKLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127479_10705453 | 3300010123 | Grasslands Soil | MTTDQQIEMLMQQKRLLDLAKEILDISHQLATLAESIMRSQENA* |
| Ga0127479_11132683 | 3300010123 | Grasslands Soil | MPEIGGESMTTDQEIEMLKQRLLDLAAEIHIISCQLATLAESIMR |
| Ga0127443_11485682 | 3300010125 | Grasslands Soil | MTNDQQIELLKQRLLDLVEERVNISNQLATLAESILRSQEHD* |
| Ga0127489_11078171 | 3300010127 | Grasslands Soil | MPEIGGESMTTDQEIEMLKQMLRDLAAEIQKVSCQLATLAESIMRSQENT* |
| Ga0127486_11256552 | 3300010128 | Grasslands Soil | MTTDQEIEMLKQMLRDLAAEIQKVSCQLATLAESIMRSQEHP* |
| Ga0127455_10172301 | 3300010132 | Grasslands Soil | IEMLKQSLRDLAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0127455_10480462 | 3300010132 | Grasslands Soil | MPEIGGESMTTDQKIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQENA* |
| Ga0127459_10214202 | 3300010133 | Grasslands Soil | MTTDQEIETLKQALRDLAAEIHIISCQLATLAESIMRSQENT* |
| Ga0127447_11529223 | 3300010136 | Grasslands Soil | MPEMGGESMTTDQEIETLKQALRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127464_10246791 | 3300010139 | Grasslands Soil | MGGEAMTTDQEIETLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0127456_10514181 | 3300010140 | Grasslands Soil | MPEIGGESMTTDQQIEMLTQQKRLLDLAKEILDISHQLATLAESIMRSQENA* |
| Ga0127499_12246862 | 3300010141 | Grasslands Soil | MTNDQQIELLKKRLLDLAEEIQDISNQLATLAESILRSQEHD* |
| Ga0127483_10992531 | 3300010142 | Grasslands Soil | TTDQEIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQENT* |
| Ga0127483_12507131 | 3300010142 | Grasslands Soil | MPEIGGESMTTDQEIETLKQTLQDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0126322_12526942 | 3300010143 | Soil | MGGESMTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQENT* |
| Ga0126318_100054412 | 3300010152 | Soil | MTTDQEIEMLKQTLRDMAAEIHIISCQLATLAESIMRSQEHA* |
| Ga0126318_100063242 | 3300010152 | Soil | MPEMGGETMTNDQQIEVLKQRLLDLVEEILVISNQLATLAESILRSQEKS* |
| Ga0126318_100570471 | 3300010152 | Soil | MTTDQEIAMLKQTLRDLAAEIHIISCQLATLAESIMRSQEHE* |
| Ga0126318_101481432 | 3300010152 | Soil | MPEMGGETMTNEQQIEVLKQRLLALVEEILVISNQLATLAESILRSQEHR* |
| Ga0126318_102338982 | 3300010152 | Soil | PEIGGESMTTDQKIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQENA* |
| Ga0126318_102782562 | 3300010152 | Soil | MTNDQQIELLKQRLLDLVEEILVISNQLATLAESILRSQEQP* |
| Ga0126318_102940642 | 3300010152 | Soil | MTNDQQIELLKQRLLDLVEEILVISNQLATLAESILRSQEHE* |
| Ga0126318_103139573 | 3300010152 | Soil | MPEIGGESMTTDQEIELLKQTLRDLAAEIHIISCQLATLAESIMRSQ |
| Ga0126318_103564121 | 3300010152 | Soil | MPERGGETMTNEQQIELLKQTLLDLVEEIVKISHQLATLAESILRSQEHR* |
| Ga0126318_103690351 | 3300010152 | Soil | IEMLTQQKRLLDLAKEILDISNQLATLVESIMRSQENA* |
| Ga0126318_104167772 | 3300010152 | Soil | MTDQEIEVLKQTLRDLAAEIHIISCQLATLAESIMRSQEHE* |
| Ga0126318_104741582 | 3300010152 | Soil | MPEIGGETMTNDQQIELLKQTLLDLVEEIVDISHQLATLAESILRSQEHR* |
| Ga0126318_104994432 | 3300010152 | Soil | MPEMGGETMTNDQQIELLKQRLLALVEEILVISNQLATLAESILRSQEQR* |
| Ga0126318_105128251 | 3300010152 | Soil | MPEIGGESMTTDQQIEMLTQQKRLLDLAQEILDISHQLATLAESIM |
| Ga0126318_105369182 | 3300010152 | Soil | MPEIGGETMTNDQQIELLKQTLLDLVEEIVKISHQLATL |
| Ga0126318_105403661 | 3300010152 | Soil | MPEIGGETMTNEQQIELLKQTLLDLVEEILVISNQLATLAESILRSQEQR* |
| Ga0126318_105814852 | 3300010152 | Soil | MPEIGGETMTNDQQIELLKQRLLDLVEEILVISNQLATLAESILRSQEKP* |
| Ga0126318_105862622 | 3300010152 | Soil | MPEIGGETMTNDQQIELLKQRLLDLAEEIVKISHQLATLAESIMRSQEHE* |
| Ga0126318_105862842 | 3300010152 | Soil | MTTDQEIETLKQTLRDLAAEIHIISCQLATLAESILRSQETP* |
| Ga0126318_106152781 | 3300010152 | Soil | MGGESMTTDQEIETLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0126318_106958962 | 3300010152 | Soil | MTTDQEIEMLTQQKRLLDLAKEILDISHQLATLAESIMRSQENA* |
| Ga0126318_107162443 | 3300010152 | Soil | MGGESMTTDQQIEMLTQQKRLLDLAKEILDISHQLATLAESIMRSQENA* |
| Ga0126318_107228901 | 3300010152 | Soil | MTTDQQIEMLTQQKRLLDLAQEILDISHQLATLAESIMRSQENA* |
| Ga0126318_107674462 | 3300010152 | Soil | MPEIGGETMTKDQQIELLKQTLLDLVEEIVDISHQLATLAESILRSQEHR* |
| Ga0126318_109162962 | 3300010152 | Soil | MPEMGGETMTKDQQIELLKQTLLDLVEEIVDISNQLATLAESILRSQEHD* |
| Ga0126318_109596102 | 3300010152 | Soil | MTKDQQIEMLKKRLLDLAEEIQDISDQLATLAESILRSQEHE* |
| Ga0126318_111149242 | 3300010152 | Soil | MGGESMTTDHEIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQENA* |
| Ga0126318_111284472 | 3300010152 | Soil | MTNDQQIEMLKQTLLDLAEEIVDISNQLATLAESIMRSQEKP* |
| Ga0126318_111401411 | 3300010152 | Soil | MPERGGETMTNDQQIETLKQTLRDLAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0134063_103295362 | 3300010335 | Grasslands Soil | MPEMGGESMTTDQEIETLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0138113_1408501 | 3300010895 | Grasslands Soil | MTTDQEIEMLKQMLLDLAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0138111_11524741 | 3300010896 | Grasslands Soil | MPEIGGESMTTDHEIEMLTQQKRLLDLAQEILNISHQLATLAESIMRSQENA* |
| Ga0138112_10384482 | 3300010905 | Grasslands Soil | MTTDQEIEVLKQSLRDLAAEIHIISCQLATLAESIMRSQEHA* |
| Ga0134028_10968901 | 3300012224 | Grasslands Soil | GKLMSEIGGESMTTDHEIEMLTQQKRLLDLAQEILNISHQLATLSESIMRSQENA* |
| Ga0134028_13004312 | 3300012224 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0137366_103216912 | 3300012354 | Vadose Zone Soil | MTTDQEIEMLKQSLRDLAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0134022_10884432 | 3300012371 | Grasslands Soil | MTNDQEIELLKQRLLDLVEEIVDISNQLATLAESILRSQEHG* |
| Ga0134022_11135831 | 3300012371 | Grasslands Soil | MTTDQEIETLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134037_11327771 | 3300012372 | Grasslands Soil | MTNDQQIELLKQRLLDLVEEIVDISNQLATLAESILR |
| Ga0134037_11702451 | 3300012372 | Grasslands Soil | AMPERGGETMTNDQEIELLKQTLLELVEEIVDISNQLATLAESILRSQEHD* |
| Ga0134037_11805202 | 3300012372 | Grasslands Soil | MTNDQEIELLKQTLLELVEEIVKISSQLATLAESILRSQEQR* |
| Ga0134037_11951091 | 3300012372 | Grasslands Soil | IEMLMQQKRLLDLAQEILDISHQLATLAESIMQSQENA* |
| Ga0134037_12164491 | 3300012372 | Grasslands Soil | GITKDQEIETLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134039_10316041 | 3300012374 | Grasslands Soil | MTTDQKIEMLTQQKRLLDLAKEILDISHQLATLAESIMRSQENA* |
| Ga0134039_10825652 | 3300012374 | Grasslands Soil | MTTDQEIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQENA* |
| Ga0134039_10908473 | 3300012374 | Grasslands Soil | MPEIGGESMTTDQQIEMLTQQQRLLDLAQEILDISNQLATLAESIMRSQE* |
| Ga0134039_11887262 | 3300012374 | Grasslands Soil | MTTDQEIEVLKQSLRDLAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0134039_11984702 | 3300012374 | Grasslands Soil | MTNDQQIELLKQRLLDLVEEIVDISNQLATLAESILRSQEHD* |
| Ga0134039_12271172 | 3300012374 | Grasslands Soil | MTTDQEIEMLKKRLLDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134034_10452881 | 3300012375 | Grasslands Soil | MGGESMTTDQEIEMLKRALRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134034_12537042 | 3300012375 | Grasslands Soil | MTKDQQIVLLKKRLLDLVEEIVDISNQLATLAESIMRSQEHD* |
| Ga0134032_10632651 | 3300012376 | Grasslands Soil | MTTDQEIEMLKQRLLDLAAEIHIISCQLATLAESIMRSQENE* |
| Ga0134032_11185122 | 3300012376 | Grasslands Soil | MPERGGETMTNDQEIELLKQTLLELVEEIVDISNQLATLAESILRSQEHD* |
| Ga0134032_12219202 | 3300012376 | Grasslands Soil | MTKDQEIEMLKQRLLDLAEEIQDISNQLATLAESILRSQEHE* |
| Ga0134032_12373461 | 3300012376 | Grasslands Soil | QEIELLKQTLLELVEEIVDISNQLATLAESILRSQEHE* |
| Ga0134032_12418601 | 3300012376 | Grasslands Soil | MPEMGGETMTNDQQIEMLKQTLLALAEEIVDISNQLATLAESIMRSQEKA* |
| Ga0134029_12552202 | 3300012377 | Grasslands Soil | MTTDQKIEMLTQQKRLLDLAKEILNISHQLATLAESIMLSQEHD* |
| Ga0134025_11007021 | 3300012378 | Grasslands Soil | MTTDQDIEMLKQMLRDLAAEIQKVSCQLATLAESIMRSQEHA* |
| Ga0134025_12017841 | 3300012378 | Grasslands Soil | MTTDQEIELLKQTLQDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134058_10481481 | 3300012379 | Grasslands Soil | QSGRKQVNRPEIGGESMTTDQEIEVLKQTLRDMAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134026_12562692 | 3300012381 | Grasslands Soil | MPEIGGESMTTDQQIDMLTQQKRLLDLAQEILNISHQLADLAESIMRSQENA* |
| Ga0134038_10777082 | 3300012382 | Grasslands Soil | MPEIGGETMTNDQQIELLKQRLLDLVEEIVNISNQLATLAESILRSQEHE* |
| Ga0134038_11972651 | 3300012382 | Grasslands Soil | MTTDQEIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQ |
| Ga0134038_12099442 | 3300012382 | Grasslands Soil | MPEIGGETMTNDQQIVLLKKRLLDLVEEIVDISNQLATLAESILRSQEHG* |
| Ga0134033_10362451 | 3300012383 | Grasslands Soil | MPEIGGESMTTDQEIEMLKQMLRDLAAEIQKVSCQLATLAKSIMRSQ |
| Ga0134033_10364721 | 3300012383 | Grasslands Soil | MPEIGGESMTTDQEIDTLKQALRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134033_11047191 | 3300012383 | Grasslands Soil | RDAIPEIGGESMTTDQEIETLKQTLRDMAAEIHIISCQLATLAESIMRSQEHT* |
| Ga0134033_12054521 | 3300012383 | Grasslands Soil | MTTDQQIEVLKQSLRDLAAEIHIISCQLATLAESIMR |
| Ga0134033_12115161 | 3300012383 | Grasslands Soil | MPEIGGESMTTDQEIEMLKQTLRDLAAEIQKVSCQLATLAESIMRSQE |
| Ga0134033_12819102 | 3300012383 | Grasslands Soil | MTKDQQIVLLKKRLLDLVEEIVDISNQLATLAESILRSQEH |
| Ga0134036_10960441 | 3300012384 | Grasslands Soil | IEMLMQQKRLLDLAQEILNISHQLATLAESIMRSQENA* |
| Ga0134036_11212551 | 3300012384 | Grasslands Soil | MTKDQQIVLLKQTLLDLVEEIVDISHQLATLAESILRSQEHD* |
| Ga0134036_11613371 | 3300012384 | Grasslands Soil | MTTDQEIETLKQALRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134036_12195202 | 3300012384 | Grasslands Soil | MTNDQQIELLKQTLLDLAEEIVDISNQLATLAESIMRSQEHG* |
| Ga0134036_12381853 | 3300012384 | Grasslands Soil | MTTDQEIELLKQTLRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134036_12722002 | 3300012384 | Grasslands Soil | MTNDQQIELLKKRLLDLAEEIQDISNQLATLAESILRSQQEA* |
| Ga0134023_10175922 | 3300012385 | Grasslands Soil | MPEIRGESMTTDQEIETLKQALRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134023_10911533 | 3300012385 | Grasslands Soil | MTTDQKIEMLTHQKRLLDLAKEILDISNQLATLAESIMRSQENA* |
| Ga0134030_10882472 | 3300012387 | Grasslands Soil | MPEIGGETMTNDQQIELLKQRLLDLVEEIVNISNQLATLAESILRSQEHD* |
| Ga0134030_12313251 | 3300012387 | Grasslands Soil | HTKPEIGGESMTTDQEIEMLKQMLRDLAAEIQKVSCQLATLAESIMRSQENT* |
| Ga0134031_11055961 | 3300012388 | Grasslands Soil | MTTDQEIAKLKQTLRDLAAEIHIISCQLATLAESIMQSQ |
| Ga0134040_11596331 | 3300012389 | Grasslands Soil | MTTDQQIEMLMQQKRLLDLAKEILDISNQLATLAESIMRSQENT* |
| Ga0134054_10093371 | 3300012390 | Grasslands Soil | MPEIGGESMTTDQKIEMLTQQKRLLDLAKEILDISHQLATLAESIMRSQEHE* |
| Ga0134054_10277531 | 3300012390 | Grasslands Soil | DQQIEMLTQQQRLLDLAQEILDISNQLATLAESIMRSQENA* |
| Ga0134054_12082971 | 3300012390 | Grasslands Soil | MTNDQQIELLKQRLLDLVEEIVNISNQLATLAESILRSQEHA* |
| Ga0134035_11364602 | 3300012391 | Grasslands Soil | MTKDQEIEMLKKRLLDLVEEIVDISNQLATLAESILRSQEHG* |
| Ga0134055_10165572 | 3300012401 | Grasslands Soil | MTNDQQIEMLKQTLLDLVEEILVISNQLATLAESILRS |
| Ga0134055_13278031 | 3300012401 | Grasslands Soil | MPMTKDQQIVLLKQTLLDLVEEIVDISHQLATLAESILRSQEHD* |
| Ga0134055_13688091 | 3300012401 | Grasslands Soil | VSLAHSPATGKLMPEIGGESMTTDQEIETLKQALRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0134041_10886542 | 3300012405 | Grasslands Soil | MTTDQQIEMLMQQKRLLDLAQEILDISHQLATLAESIMLSQEQP* |
| Ga0134053_13230401 | 3300012406 | Grasslands Soil | RITKDQQIAMLKQRLLAMAEEIENISHQLATLAESIMRSQENA* |
| Ga0134053_13562871 | 3300012406 | Grasslands Soil | MTTDQEIEMLKQTLRDLAAEIQKVSCQLATLAESIMRSQENA* |
| Ga0134053_13734362 | 3300012406 | Grasslands Soil | MPEIGGESMTTDQKIEMLTQQKRLLDLAKEILDISHQLATLAESIMRSQEHD* |
| Ga0134050_11175932 | 3300012407 | Grasslands Soil | MPEIGGEFMTTDQKIEMLTQQKRLLDLAKEILDISNQLATLAESIMRSQENT* |
| Ga0134045_10109531 | 3300012409 | Grasslands Soil | MTTDQEIEMLKRALRDLAAEIHIISCQLATLAESIMRSQENA* |
| Ga0066655_107317691 | 3300018431 | Grasslands Soil | MTTDQEIELLKQTLHDLAAEIHIISCQLATLAESIMRSQENA |
| Ga0066662_120749271 | 3300018468 | Grasslands Soil | MTTDQEIETLKQMLRDLAAEIHIISCQLATLAESIMRSQENA |
| Ga0066669_112941192 | 3300018482 | Grasslands Soil | MPEIGGESMTTDQEIAKLKQTLRDLAAEIHIISCQLATLAESIMQSQENA |
| Ga0242665_102130151 | 3300022724 | Soil | MLTQQKRLLDLAQEILDISHQLATLAESIMRSQENT |
| Ga0314782_034233_332_460 | 3300034661 | Soil | MTNEQQIEVLKQRLLDLVEEILVISNQLATLAESILRSQEKS |
| ⦗Top⦘ |