Basic Information | |
---|---|
Family ID | F024724 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 204 |
Average Sequence Length | 45 residues |
Representative Sequence | MKNLIQVKYYFKEHPNTTLSVFLKTQEQVDAFKQKHPNYVYVETN |
Number of Associated Samples | 154 |
Number of Associated Scaffolds | 204 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 65.69 % |
% of genes near scaffold ends (potentially truncated) | 30.39 % |
% of genes from short scaffolds (< 2000 bps) | 76.47 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.66 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (44.118 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.020 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.627 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (49.020 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.70% β-sheet: 28.77% Coil/Unstructured: 57.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 204 Family Scaffolds |
---|---|---|
PF00154 | RecA | 18.63 |
PF00136 | DNA_pol_B | 7.84 |
PF00132 | Hexapep | 3.43 |
PF03104 | DNA_pol_B_exo1 | 2.94 |
PF07460 | NUMOD3 | 2.45 |
PF02195 | ParBc | 2.45 |
PF05118 | Asp_Arg_Hydrox | 1.96 |
PF04851 | ResIII | 1.47 |
PF13759 | 2OG-FeII_Oxy_5 | 1.47 |
PF00011 | HSP20 | 1.47 |
PF03796 | DnaB_C | 0.98 |
PF00733 | Asn_synthase | 0.98 |
PF02672 | CP12 | 0.98 |
PF08423 | Rad51 | 0.98 |
PF01555 | N6_N4_Mtase | 0.49 |
PF03819 | MazG | 0.49 |
PF00111 | Fer2 | 0.49 |
PF13884 | Peptidase_S74 | 0.49 |
PF14602 | Hexapep_2 | 0.49 |
PF05996 | Fe_bilin_red | 0.49 |
PF14328 | DUF4385 | 0.49 |
PF08804 | gp32 | 0.49 |
PF05433 | Rick_17kDa_Anti | 0.49 |
COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
---|---|---|---|
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 19.61 |
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 10.78 |
COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.47 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.98 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.98 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.49 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.49 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.88 % |
Unclassified | root | N/A | 44.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10001256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10270 | Open in IMG/M |
3300000929|NpDRAFT_10187720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1112 | Open in IMG/M |
3300001580|Draft_10065361 | All Organisms → Viruses | 2185 | Open in IMG/M |
3300001580|Draft_10276026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 37f | 731 | Open in IMG/M |
3300001838|RCM33_1016940 | Not Available | 545 | Open in IMG/M |
3300001956|GOS2266_1034865 | All Organisms → Viruses → Predicted Viral | 1779 | Open in IMG/M |
3300002133|S2T7BSa_1398517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Bellamyvirus sp. | 867 | Open in IMG/M |
3300003277|JGI25908J49247_10007407 | All Organisms → Viruses → Predicted Viral | 3467 | Open in IMG/M |
3300003277|JGI25908J49247_10029925 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
3300003277|JGI25908J49247_10048331 | Not Available | 1122 | Open in IMG/M |
3300003277|JGI25908J49247_10061285 | Not Available | 958 | Open in IMG/M |
3300003277|JGI25908J49247_10105071 | Not Available | 677 | Open in IMG/M |
3300003388|JGI25910J50241_10007267 | All Organisms → Viruses → Predicted Viral | 4029 | Open in IMG/M |
3300003388|JGI25910J50241_10066381 | Not Available | 1067 | Open in IMG/M |
3300003394|JGI25907J50239_1022122 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
3300003490|JGI25926J51410_1000606 | Not Available | 6440 | Open in IMG/M |
3300003497|JGI25925J51416_10092607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Bellamyvirus sp. | 731 | Open in IMG/M |
3300004124|Ga0066178_10231087 | Not Available | 535 | Open in IMG/M |
3300004457|Ga0066224_1098925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 573 | Open in IMG/M |
3300005074|Ga0070431_1183434 | Not Available | 740 | Open in IMG/M |
3300005097|Ga0072505_1309317 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
3300005517|Ga0070374_10044634 | All Organisms → Viruses → Predicted Viral | 2301 | Open in IMG/M |
3300005527|Ga0068876_10000042 | Not Available | 90273 | Open in IMG/M |
3300005527|Ga0068876_10001182 | Not Available | 20643 | Open in IMG/M |
3300005581|Ga0049081_10109906 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
3300005582|Ga0049080_10013998 | All Organisms → Viruses → Predicted Viral | 2792 | Open in IMG/M |
3300005582|Ga0049080_10019624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2357 | Open in IMG/M |
3300005582|Ga0049080_10169817 | Not Available | 727 | Open in IMG/M |
3300005583|Ga0049085_10170899 | Not Available | 728 | Open in IMG/M |
3300005584|Ga0049082_10095233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 1044 | Open in IMG/M |
3300005584|Ga0049082_10326128 | Not Available | 510 | Open in IMG/M |
3300005837|Ga0078893_10000658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 119877 | Open in IMG/M |
3300005940|Ga0073913_10095635 | Not Available | 514 | Open in IMG/M |
3300005941|Ga0070743_10139541 | Not Available | 807 | Open in IMG/M |
3300005955|Ga0073922_1042426 | Not Available | 572 | Open in IMG/M |
3300007539|Ga0099849_1001786 | Not Available | 10076 | Open in IMG/M |
3300007539|Ga0099849_1190435 | Not Available | 776 | Open in IMG/M |
3300007539|Ga0099849_1257675 | Not Available | 639 | Open in IMG/M |
3300007617|Ga0102897_1092611 | Not Available | 938 | Open in IMG/M |
3300007634|Ga0102901_1150396 | Not Available | 661 | Open in IMG/M |
3300008055|Ga0108970_10830394 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300008113|Ga0114346_1315891 | Not Available | 528 | Open in IMG/M |
3300008262|Ga0114337_1265130 | Not Available | 645 | Open in IMG/M |
3300008996|Ga0102831_1051316 | Not Available | 1383 | Open in IMG/M |
3300008999|Ga0102816_1054230 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
3300009026|Ga0102829_1069989 | Not Available | 1071 | Open in IMG/M |
3300009026|Ga0102829_1125589 | Not Available | 812 | Open in IMG/M |
3300009026|Ga0102829_1310408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 526 | Open in IMG/M |
3300009039|Ga0105152_10135935 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
3300009149|Ga0114918_10035300 | All Organisms → Viruses → Predicted Viral | 3514 | Open in IMG/M |
3300009149|Ga0114918_10066339 | All Organisms → Viruses → Predicted Viral | 2348 | Open in IMG/M |
3300009149|Ga0114918_10199841 | All Organisms → Viruses → Predicted Viral | 1162 | Open in IMG/M |
3300009169|Ga0105097_10209433 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
3300009218|Ga0103848_1000164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7799 | Open in IMG/M |
3300009218|Ga0103848_1007265 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
3300009225|Ga0103851_1032609 | Not Available | 832 | Open in IMG/M |
3300009504|Ga0114946_10345200 | Not Available | 778 | Open in IMG/M |
3300010297|Ga0129345_1298507 | Not Available | 558 | Open in IMG/M |
3300010299|Ga0129342_1087999 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
3300010299|Ga0129342_1105477 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
3300010318|Ga0136656_1158816 | Not Available | 771 | Open in IMG/M |
3300010318|Ga0136656_1314738 | Not Available | 507 | Open in IMG/M |
3300010354|Ga0129333_10006194 | Not Available | 11319 | Open in IMG/M |
3300010354|Ga0129333_10309803 | Not Available | 1411 | Open in IMG/M |
3300010354|Ga0129333_10433084 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
3300010354|Ga0129333_10643206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 917 | Open in IMG/M |
3300010354|Ga0129333_10693829 | Not Available | 876 | Open in IMG/M |
3300010354|Ga0129333_10933656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 732 | Open in IMG/M |
3300010389|Ga0136549_10007362 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 7681 | Open in IMG/M |
3300011011|Ga0139556_1003010 | All Organisms → Viruses → Predicted Viral | 2525 | Open in IMG/M |
3300011995|Ga0153800_1038398 | All Organisms → Viruses | 513 | Open in IMG/M |
3300012017|Ga0153801_1000940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6434 | Open in IMG/M |
3300012523|Ga0129350_1465764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 597 | Open in IMG/M |
3300012528|Ga0129352_10329047 | Not Available | 896 | Open in IMG/M |
3300012666|Ga0157498_1001928 | All Organisms → Viruses → Predicted Viral | 3620 | Open in IMG/M |
3300012967|Ga0129343_1295538 | Not Available | 826 | Open in IMG/M |
3300012968|Ga0129337_1331166 | Not Available | 654 | Open in IMG/M |
3300013087|Ga0163212_1286409 | Not Available | 510 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10042174 | All Organisms → Viruses → Predicted Viral | 3761 | Open in IMG/M |
3300013181|Ga0116836_1034958 | Not Available | 557 | Open in IMG/M |
3300013231|Ga0116832_1028522 | Not Available | 801 | Open in IMG/M |
3300013372|Ga0177922_10273538 | All Organisms → Viruses → Predicted Viral | 1867 | Open in IMG/M |
3300013372|Ga0177922_11315986 | Not Available | 820 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10061070 | All Organisms → Viruses → Predicted Viral | 2916 | Open in IMG/M |
3300014819|Ga0119954_1001109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 9100 | Open in IMG/M |
3300017722|Ga0181347_1055324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1192 | Open in IMG/M |
3300017736|Ga0181365_1040085 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
3300017736|Ga0181365_1172336 | Not Available | 507 | Open in IMG/M |
3300017771|Ga0181425_1268550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 526 | Open in IMG/M |
3300017777|Ga0181357_1010020 | All Organisms → Viruses → Predicted Viral | 3776 | Open in IMG/M |
3300017777|Ga0181357_1115039 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
3300017777|Ga0181357_1322013 | Not Available | 520 | Open in IMG/M |
3300017784|Ga0181348_1114834 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
3300017788|Ga0169931_10145650 | All Organisms → Viruses → Predicted Viral | 2138 | Open in IMG/M |
3300017952|Ga0181583_10252645 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
3300017967|Ga0181590_10315192 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
3300017967|Ga0181590_10925244 | Not Available | 572 | Open in IMG/M |
3300017968|Ga0181587_11030698 | Not Available | 502 | Open in IMG/M |
3300018421|Ga0181592_10066284 | All Organisms → Viruses → Predicted Viral | 2853 | Open in IMG/M |
3300018421|Ga0181592_10486407 | Not Available | 856 | Open in IMG/M |
3300018424|Ga0181591_10099481 | All Organisms → Viruses → Predicted Viral | 2381 | Open in IMG/M |
3300018428|Ga0181568_10469665 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
3300018558|Ga0188836_100323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1264 | Open in IMG/M |
3300018558|Ga0188836_100419 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
3300018775|Ga0188848_1002833 | All Organisms → Viruses → Predicted Viral | 1989 | Open in IMG/M |
3300018775|Ga0188848_1004041 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
3300019096|Ga0188835_1001458 | All Organisms → Viruses → Predicted Viral | 2883 | Open in IMG/M |
3300019784|Ga0181359_1001090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 6941 | Open in IMG/M |
3300019784|Ga0181359_1007111 | All Organisms → Viruses → Predicted Viral | 3785 | Open in IMG/M |
3300019784|Ga0181359_1022461 | All Organisms → Viruses → Predicted Viral | 2397 | Open in IMG/M |
3300019784|Ga0181359_1086299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1169 | Open in IMG/M |
3300019784|Ga0181359_1188505 | Not Available | 674 | Open in IMG/M |
3300019784|Ga0181359_1196033 | Not Available | 654 | Open in IMG/M |
3300019784|Ga0181359_1220569 | Not Available | 596 | Open in IMG/M |
3300020074|Ga0194113_10274590 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
3300020084|Ga0194110_10031532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 5117 | Open in IMG/M |
3300020109|Ga0194112_10247064 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
3300020151|Ga0211736_10880219 | All Organisms → Viruses → Predicted Viral | 3101 | Open in IMG/M |
3300020159|Ga0211734_11000058 | Not Available | 1230 | Open in IMG/M |
3300020193|Ga0194131_10426996 | Not Available | 594 | Open in IMG/M |
3300020196|Ga0194124_10111755 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
3300020214|Ga0194132_10183221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Namakavirus → Namakavirus smbcm6 | 1202 | Open in IMG/M |
3300020239|Ga0211501_1006859 | All Organisms → Viruses → Predicted Viral | 2468 | Open in IMG/M |
3300020239|Ga0211501_1080227 | Not Available | 662 | Open in IMG/M |
3300020408|Ga0211651_10269102 | Not Available | 649 | Open in IMG/M |
3300021356|Ga0213858_10001260 | Not Available | 12048 | Open in IMG/M |
3300021376|Ga0194130_10116565 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
3300021376|Ga0194130_10444724 | Not Available | 676 | Open in IMG/M |
3300021424|Ga0194117_10526011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 524 | Open in IMG/M |
3300021959|Ga0222716_10177334 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
3300021960|Ga0222715_10162524 | Not Available | 1372 | Open in IMG/M |
3300021961|Ga0222714_10099753 | All Organisms → Viruses → Predicted Viral | 1841 | Open in IMG/M |
3300021962|Ga0222713_10503471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 724 | Open in IMG/M |
3300021962|Ga0222713_10788018 | Not Available | 532 | Open in IMG/M |
3300021963|Ga0222712_10661159 | Not Available | 594 | Open in IMG/M |
3300022176|Ga0212031_1048168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 714 | Open in IMG/M |
3300022190|Ga0181354_1206776 | Not Available | 581 | Open in IMG/M |
3300022190|Ga0181354_1248882 | Not Available | 507 | Open in IMG/M |
3300022407|Ga0181351_1192343 | Not Available | 690 | Open in IMG/M |
3300022407|Ga0181351_1268149 | Not Available | 520 | Open in IMG/M |
3300022752|Ga0214917_10006104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 12646 | Open in IMG/M |
3300022752|Ga0214917_10053779 | All Organisms → Viruses → Predicted Viral | 2693 | Open in IMG/M |
3300023116|Ga0255751_10452729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 620 | Open in IMG/M |
3300024262|Ga0210003_1058116 | All Organisms → Viruses → Predicted Viral | 1926 | Open in IMG/M |
3300024346|Ga0244775_10235989 | All Organisms → Viruses → Predicted Viral | 1527 | Open in IMG/M |
3300025674|Ga0208162_1001884 | Not Available | 10552 | Open in IMG/M |
3300027320|Ga0208923_1030992 | Not Available | 952 | Open in IMG/M |
3300027393|Ga0209867_1046372 | Not Available | 647 | Open in IMG/M |
3300027534|Ga0255125_1110642 | Not Available | 554 | Open in IMG/M |
3300027563|Ga0209552_1065547 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
3300027581|Ga0209651_1021435 | All Organisms → Viruses → Predicted Viral | 2029 | Open in IMG/M |
3300027608|Ga0208974_1026725 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
3300027621|Ga0208951_1044176 | All Organisms → Viruses → Predicted Viral | 1316 | Open in IMG/M |
3300027627|Ga0208942_1102169 | Not Available | 814 | Open in IMG/M |
3300027644|Ga0209356_1196132 | Not Available | 546 | Open in IMG/M |
3300027649|Ga0208960_1006813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 5255 | Open in IMG/M |
3300027656|Ga0209357_1009327 | All Organisms → Viruses → Predicted Viral | 3688 | Open in IMG/M |
3300027689|Ga0209551_1260506 | Not Available | 518 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1121166 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1124416 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1027192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3831 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1153509 | Not Available | 919 | Open in IMG/M |
3300027732|Ga0209442_1072142 | All Organisms → Viruses → Predicted Viral | 1440 | Open in IMG/M |
3300027756|Ga0209444_10143070 | Not Available | 924 | Open in IMG/M |
3300027772|Ga0209768_10401504 | Not Available | 545 | Open in IMG/M |
3300027785|Ga0209246_10290965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 628 | Open in IMG/M |
3300027797|Ga0209107_10006804 | All Organisms → Viruses | 6423 | Open in IMG/M |
3300027798|Ga0209353_10113855 | Not Available | 1217 | Open in IMG/M |
3300027808|Ga0209354_10090874 | Not Available | 1244 | Open in IMG/M |
3300027836|Ga0209230_10410455 | Not Available | 775 | Open in IMG/M |
3300027892|Ga0209550_10468975 | Not Available | 763 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1113534 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
(restricted) 3300028114|Ga0247835_1053917 | All Organisms → Viruses → Predicted Viral | 1756 | Open in IMG/M |
3300028276|Ga0268282_1022072 | All Organisms → Viruses | 1715 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1287629 | Not Available | 572 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1043369 | Not Available | 2745 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10284191 | Not Available | 864 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10047957 | All Organisms → Viruses → Predicted Viral | 4065 | Open in IMG/M |
3300029930|Ga0119944_1035784 | Not Available | 627 | Open in IMG/M |
3300031519|Ga0307488_10758347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 542 | Open in IMG/M |
3300031565|Ga0307379_10720506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 892 | Open in IMG/M |
3300031566|Ga0307378_11048282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 660 | Open in IMG/M |
3300031578|Ga0307376_10104562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 1991 | Open in IMG/M |
3300031673|Ga0307377_10175373 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
3300031707|Ga0315291_10236828 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
3300031746|Ga0315293_10148014 | Not Available | 1961 | Open in IMG/M |
3300031746|Ga0315293_10409256 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
3300031746|Ga0315293_10426594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1038 | Open in IMG/M |
3300031746|Ga0315293_10531578 | Not Available | 903 | Open in IMG/M |
3300031772|Ga0315288_10432700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Bellamyvirus sp. | 1321 | Open in IMG/M |
3300031772|Ga0315288_11313669 | Not Available | 613 | Open in IMG/M |
3300031851|Ga0315320_10060115 | All Organisms → Viruses → Predicted Viral | 2947 | Open in IMG/M |
3300031873|Ga0315297_11663287 | Not Available | 512 | Open in IMG/M |
3300031885|Ga0315285_10120663 | All Organisms → Viruses → Predicted Viral | 2240 | Open in IMG/M |
3300032046|Ga0315289_10818081 | Not Available | 817 | Open in IMG/M |
3300032053|Ga0315284_12072242 | Not Available | 573 | Open in IMG/M |
3300032116|Ga0315903_10952112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 607 | Open in IMG/M |
3300032164|Ga0315283_12307912 | Not Available | 526 | Open in IMG/M |
3300032173|Ga0315268_10312870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1523 | Open in IMG/M |
3300032177|Ga0315276_10634911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1147 | Open in IMG/M |
3300033233|Ga0334722_11238318 | Not Available | 522 | Open in IMG/M |
3300034072|Ga0310127_302910 | Not Available | 546 | Open in IMG/M |
3300034073|Ga0310130_0027259 | Not Available | 1778 | Open in IMG/M |
3300034112|Ga0335066_0062119 | All Organisms → Viruses → Predicted Viral | 2455 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.02% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.33% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.35% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.39% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.39% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.41% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.41% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.41% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.92% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.92% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.94% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.96% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.96% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.47% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.47% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.47% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.98% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.98% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.98% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.98% |
Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.98% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.49% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.49% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.49% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.49% |
Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.49% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.49% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.49% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.49% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.49% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.49% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.49% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.49% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.49% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.49% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.49% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.49% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.49% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.49% |
Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.49% |
Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.49% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
3300001956 | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 | Environmental | Open in IMG/M |
3300002133 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - S2T7BSa (116f) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
3300005097 | MiSeq S massa metagenome | Host-Associated | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013181 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 9m_Station6_GOM_Metagenome | Environmental | Open in IMG/M |
3300013231 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018558 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p8 | Environmental | Open in IMG/M |
3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020239 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555909-ERR598959) | Environmental | Open in IMG/M |
3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027534 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
3300028276 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_120m | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_1000125616 | 3300000756 | Freshwater And Sediment | MEDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVKESN* |
NpDRAFT_101877201 | 3300000929 | Freshwater And Marine | MMTNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKH |
Draft_100653614 | 3300001580 | Hydrocarbon Resource Environments | MNMIRVKYYFKEHPNTTLSVFFKTQEQAEAFKSKHPNYVYVPVV* |
Draft_102760264 | 3300001580 | Hydrocarbon Resource Environments | MIRVKYYFKEHPNTTLSVFFKTQEQAEAFKSKHPDYVYVTTV* |
RCM33_10169403 | 3300001838 | Marine Plankton | MIRVKYYFKEHPNTTLSVFLKTQDQVDAFKAKHPDYVYVGETK* |
GOS2266_10348651 | 3300001956 | Marine | TDGTKMIQVKYYFKEHPKTSLSVFLKDQKEVDAFKQKHPNYVYVEA* |
S2T7BSa_13985172 | 3300002133 | Marine | MENLIRVKYYFKEHPNTTLSVFLKTQEQVESYKAKHPNYVYVEESN* |
JGI25908J49247_100074074 | 3300003277 | Freshwater Lake | MKNLIQVKYYFKEHPKTTLSIYLETQEQVETFKTKHPDYVYVTENN* |
JGI25908J49247_100299251 | 3300003277 | Freshwater Lake | QVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYITENN* |
JGI25908J49247_100483313 | 3300003277 | Freshwater Lake | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYITENN* |
JGI25908J49247_100612853 | 3300003277 | Freshwater Lake | MMKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYV |
JGI25908J49247_101050711 | 3300003277 | Freshwater Lake | MKDLIRVEYYFKEYPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK* |
JGI25910J50241_100072672 | 3300003388 | Freshwater Lake | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYVTENN* |
JGI25910J50241_100663813 | 3300003388 | Freshwater Lake | MTNLIQVKYSFKEHPKTTLSIYLETQEQVEEFKTKHPDYVYVTENN* |
JGI25907J50239_10221222 | 3300003394 | Freshwater Lake | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYITENN* |
JGI25926J51410_10006065 | 3300003490 | Freshwater Lake | MKNLIRVKYYFREHPDTTLSVFFKTQEQVESYKAKHRNYVYVEESK* |
JGI25925J51416_100926073 | 3300003497 | Freshwater Lake | MEDLIXVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVKESN* |
Ga0066178_102310873 | 3300004124 | Freshwater Lake | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYV |
Ga0066224_10989252 | 3300004457 | Marine | METKMIQVKYYFKEHPKTSLSVFLKTEEQVKAFKENHPDYIYV* |
Ga0070431_11834342 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | METKMIQVKYYFKEHPKTSLSVFLKDQKEVDAFKQKHPNYVYVEA* |
Ga0072505_13093172 | 3300005097 | Marine Benthic Sponge Stylissa Massa Associated | MIQVKYYFKEHPKTSLSVFLKTEEQVKAFKEKHPDYIYV* |
Ga0070374_100446343 | 3300005517 | Freshwater Lake | MMKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYITENN* |
Ga0068876_10000042131 | 3300005527 | Freshwater Lake | MKDLIQVKYYFKEHPNTTLSVFLKTVEQVEAFKAKHPDYVYVGETK* |
Ga0068876_100011822 | 3300005527 | Freshwater Lake | MENLIQVKYYFKEHPNTTLSVFLKTKEQVEAFKAKHPDYVYVEAK* |
Ga0049081_101099062 | 3300005581 | Freshwater Lentic | MEDLIRVKYYFKEHPNTTLSVFLKTQEQVKSYKTKHPNYVYIEESK* |
Ga0049080_100139984 | 3300005582 | Freshwater Lentic | MNMIRVKYYYKEHPNTTLSVFLKTQEQVDAFKSKHPDYVYVPIV* |
Ga0049080_100196243 | 3300005582 | Freshwater Lentic | MKDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK* |
Ga0049080_101698173 | 3300005582 | Freshwater Lentic | MKNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYVTEKN* |
Ga0049085_101708993 | 3300005583 | Freshwater Lentic | MMKNLIQVKYYFKEHPKTTLSIYLETQEQVESFKIKHPDYVYITENN* |
Ga0049082_100952331 | 3300005584 | Freshwater Lentic | MKNLIQVKYYFKEHPNTALSIYLKTQEQVEAFKTKHPDYVYITE |
Ga0049082_103261282 | 3300005584 | Freshwater Lentic | MEDLIRVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVKESN* |
Ga0078893_1000065869 | 3300005837 | Marine Surface Water | METKMIQVKYYFKEHPKTSLSVFLKTEEQVKAFKEKHPDYIYV* |
Ga0073913_100956351 | 3300005940 | Sand | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVY |
Ga0070743_101395412 | 3300005941 | Estuarine | MKDLIQVKYYFKEHPNTTLSVFLKTLEQVEAFKAKHPDYVYVENK* |
Ga0073922_10424263 | 3300005955 | Sand | MKNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYITENN* |
Ga0099849_10017864 | 3300007539 | Aqueous | MKNLIQVKYYYKEHPNTTLSVFLKDQQQVDAFKQKHPNYVYIESK* |
Ga0099849_11904353 | 3300007539 | Aqueous | MKNLIQVKYYFKEHPNTTLSVFLKNQQQVDAFKQKHPNYVYVEAN* |
Ga0099849_12576752 | 3300007539 | Aqueous | MKDLIQVKYYFKEHPNTTLSVFLKNQKQVDAFKQKHPNYVYVETN* |
Ga0102897_10926112 | 3300007617 | Estuarine | MMKNLIQVKYSFKEHPKTTLSIYLETQEQVEEFKTKHPDYVYVTEKN* |
Ga0102901_11503962 | 3300007634 | Estuarine | MMKNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYITENN* |
Ga0108970_108303943 | 3300008055 | Estuary | MMKNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYVTEKN* |
Ga0114346_13158912 | 3300008113 | Freshwater, Plankton | LIQVKYYFKEHPNTTLSVFLKTVEQVEAFKAKHPDYVYIGETK* |
Ga0114337_12651303 | 3300008262 | Freshwater, Plankton | SLPDMENLIQVKYYFKEHPNTTLSVFLKTKEQVEAFKAKHPDYVYVEAK* |
Ga0102831_10513163 | 3300008996 | Estuarine | MMKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPD |
Ga0102816_10542302 | 3300008999 | Estuarine | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYVTEKN* |
Ga0102829_10699893 | 3300009026 | Estuarine | MMKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYVTE |
Ga0102829_11255892 | 3300009026 | Estuarine | MTNLIQVKYSFKEHPKTTLSIYLETQEQVEEFKTKHPDYVYVTEKN* |
Ga0102829_13104083 | 3300009026 | Estuarine | MEDLIRVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVKE |
Ga0105152_101359352 | 3300009039 | Lake Sediment | MMKNLIQVKYYFKEHPNTALSIYLETQEQVEEFKTKHPDYVYITENN* |
Ga0114918_100353003 | 3300009149 | Deep Subsurface | MEDLIRVKYYFKEHPNTTLSVFLKTQEQVEAYKSKHPNYVYIKESN* |
Ga0114918_100663393 | 3300009149 | Deep Subsurface | MENLIRVKYYFKEHPNTTLSVFLKTQEQVESYKAKHPNYVYIEESK* |
Ga0114918_101998413 | 3300009149 | Deep Subsurface | MENLIRVKYYFRDHPNTTLSVFLKTQEQVESYKAKHPNYVYIEESK* |
Ga0105097_102094331 | 3300009169 | Freshwater Sediment | MENLIRVKYYFKEYPNTTLSVFFKTQEQADAFKSKHPDYVYVVAV* |
Ga0103848_10001644 | 3300009218 | River Water | MIRVKYYFKQHPNTTLSVFLKTQEQVDAFKAKHPDYVYIGETK* |
Ga0103848_10072652 | 3300009218 | River Water | MKDLIQVKYYFKEHPQTTLSVFLKTEEQVQAFKAKHPNYVYVGEKQ* |
Ga0103851_10326092 | 3300009225 | River Water | MIRVKYYFKQHPNTTLSVFLKTQEQVDAFKAKHPDYGYIGETK* |
Ga0114946_103452001 | 3300009504 | Sediment | VKYYYKEYPNTTLSVFLKTQEQVEAFKAKHPDYVYVPSV* |
Ga0129345_12985072 | 3300010297 | Freshwater To Marine Saline Gradient | MKNLIQVKYYFKEHPNTTLSVFLKTQEQVDAFKQKHPNYVYVETN* |
Ga0129342_10879992 | 3300010299 | Freshwater To Marine Saline Gradient | MKDLIQVKYYFKEHPNTTLSVFLKNQEQVNAFKQKHPNYVYIESK* |
Ga0129342_11054772 | 3300010299 | Freshwater To Marine Saline Gradient | MKNLIQVKYYFKEHPNTTLSVFLKNQQQVDAFKQKHPNYIYVETN* |
Ga0136656_11588163 | 3300010318 | Freshwater To Marine Saline Gradient | MIRVKYYFKEHPNALLSVFLKTEEQVKDFKAKHPDYVYVGETK* |
Ga0136656_13147382 | 3300010318 | Freshwater To Marine Saline Gradient | YYFKEHPNTTLSIFLKTEEQVEAFKAKHPDYVYVESK* |
Ga0129333_1000619417 | 3300010354 | Freshwater To Marine Saline Gradient | MNMIRVKYCFKEQPNTTLSVFLKTQEQVEAFKAKHPDYVYFGETK* |
Ga0129333_103098034 | 3300010354 | Freshwater To Marine Saline Gradient | MIRVKYYYKEHPNTTLSVFLKTQEQVEAFKVKHPDYVYVGETK* |
Ga0129333_104330844 | 3300010354 | Freshwater To Marine Saline Gradient | MNMIRVKYYFKEHPNTTLSVFLKTQEQVEALKSKHPDYVYVGETK* |
Ga0129333_106432063 | 3300010354 | Freshwater To Marine Saline Gradient | MIRVKYYFKEHPNTTLSVFLKTEKQVEDFKAKHPDYVYVGETK* |
Ga0129333_106938292 | 3300010354 | Freshwater To Marine Saline Gradient | MNMIRVKYYFKEHPNTTLSVFLKTQEQVEAFKVKHPDYVYVGETK* |
Ga0129333_109336562 | 3300010354 | Freshwater To Marine Saline Gradient | MENLIQVKYYFKEHPNTTLSVFLKTREQVEAFKAKHPNYVYVENK* |
Ga0136549_100073626 | 3300010389 | Marine Methane Seep Sediment | MKNLIQVKYYYKEYPNTTLSVFLKDQQQVDAFKQKHPNYVYIESK* |
Ga0139556_10030103 | 3300011011 | Freshwater | MTNLIQVKYSFKEHSKTTLSIYLKTQEQVEEFKTKHPDYVYITENN* |
Ga0153800_10383981 | 3300011995 | Freshwater | MKDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSK |
Ga0153801_10009401 | 3300012017 | Freshwater | VEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK* |
Ga0129350_14657641 | 3300012523 | Aqueous | METKMIQVKYYFKEHPKTSLSVFLKDQKEVDAFKQKH |
Ga0129352_103290471 | 3300012528 | Aqueous | DGMKNLIQVKYYFKEHPNTTLSVFLKTQEQVDAFKQKHPNYVYVETN* |
Ga0157498_10019283 | 3300012666 | Freshwater, Surface Ice | MEDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK* |
Ga0129343_12955383 | 3300012967 | Aqueous | IQVKYYFKEHPNTTLSVFLKNQKQVDAFKQKHPNYVYVETN* |
Ga0129337_13311662 | 3300012968 | Aqueous | MKDLIQVKYYFKEHPNTTLSVFLKTNEQVEAFKAKHPDYVYVESK* |
Ga0163212_12864092 | 3300013087 | Freshwater | LRDMKDLIQVKYYFKEHPNTTLSVFLKTAEQVEAFKAKHPNYVYVESK* |
(restricted) Ga0172367_100421746 | 3300013126 | Freshwater | MKNKSLRDMKDLIQVKYYFKEHPNTTLSVFLKTTEQVEAFKAKHPDYVYVGETK* |
Ga0116836_10349581 | 3300013181 | Marine | MKNLIQVKYYFKEHPNTTLSVFLKDQQQVDAFKEKHPNYVYVDIK* |
Ga0116832_10285221 | 3300013231 | Marine | DGMKDLIQVKYYFKEHPNTTLSVFLKNQEQVDAFKQKHPNYVYVETN* |
Ga0177922_102735383 | 3300013372 | Freshwater | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVKEFKTKHPDYVYVTENN* |
Ga0177922_113159861 | 3300013372 | Freshwater | WTLQKNLTQTIRDGNLMEDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVKESN* |
(restricted) Ga0172376_100610705 | 3300014720 | Freshwater | MNKDLIQVKYYFKEHPNTTLPVFLKTTEQVEAFKAKHPDYVYVGETK* |
Ga0119954_100110913 | 3300014819 | Freshwater | MIRIKYYYKEYPNTTLSVFLKNEEQVEAFKAKHPDYVYIDE* |
Ga0181347_10553242 | 3300017722 | Freshwater Lake | MKNLIQVKYYFKEHPKTALSIYLKTQEQVKEFKTKHPDYVYVTENN |
Ga0181365_10400853 | 3300017736 | Freshwater Lake | MKDLIRVEYYFKEYPNTTLSVFLKTQEQVDAYKSKHPNYVYVKESN |
Ga0181365_11723362 | 3300017736 | Freshwater Lake | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYVTENN |
Ga0181425_12685501 | 3300017771 | Seawater | METKMIQVKYYFKEHPKTSLSVFLKTEEQVKAFKENHPNYIYV |
Ga0181357_10100201 | 3300017777 | Freshwater Lake | MKDLIRVKYYFKEYPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0181357_11150393 | 3300017777 | Freshwater Lake | MMKNLIQVKYYFKEHPKTTLSIYLKNQEQVEAFKTKHPDYVYITENN |
Ga0181357_13220132 | 3300017777 | Freshwater Lake | MKDLIRVKYYFKEYPNTTLSVFLKTKEQVESYKAKHPNYVYIEESK |
Ga0181348_11148342 | 3300017784 | Freshwater Lake | MEDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVKEGN |
Ga0169931_101456505 | 3300017788 | Freshwater | MENLIQVKYYFKEHPNTTLSVFLKTREQVEAFKAKHPDYVYVEAK |
Ga0181583_102526452 | 3300017952 | Salt Marsh | MKNLIQVKYYFKEHPNTTLSVFLKNQQQVDAFKQKHPNYIYVETN |
Ga0181590_103151923 | 3300017967 | Salt Marsh | YYFKEHPNTTLSVFLKTEEQVEAFKAKHPDYVYVESK |
Ga0181590_109252442 | 3300017967 | Salt Marsh | MKNLIQVKYYFKEHPNTTLSVFLKDQKQVDAFKQKHPNYVYVETN |
Ga0181587_110306982 | 3300017968 | Salt Marsh | MKNLIQVKYYFKEHPNTTLSVFLKNQQQVDAFKQKHPN |
Ga0181592_100662846 | 3300018421 | Salt Marsh | MKDLIQVKYYFKEHPNTTLSVFLKTNEQVEAFKAKHPDYVYVESK |
Ga0181592_104864073 | 3300018421 | Salt Marsh | MKNLIQVKYYFKEHPNTTLSVFLKDQKQVDAFKQKHPNYIYVETN |
Ga0181591_100994811 | 3300018424 | Salt Marsh | MKNLIKVKYYLKKHPNPPLSVSLKDQKQVDAFKQKHHNYIYVETN |
Ga0181568_104696651 | 3300018428 | Salt Marsh | RSASSMKNLIQVKYYFKEHPNTTLSVFLKDQQQVDAFKEKHPNYVYVDIK |
Ga0188836_1003232 | 3300018558 | Freshwater Lake | MMKNLIQVKYYFKEHPNTTLSVFLKTQEQVEYYKANHPNYVYIEESK |
Ga0188836_1004192 | 3300018558 | Freshwater Lake | MEDLIRVKYYFKEHPNTTLSVFLKTQEQVEAYKSKHPNYVYIKESN |
Ga0188848_10028332 | 3300018775 | Freshwater Lake | MEDLIRVKYYFKEHPNTTLSVFLKTQEQVEAYKSKHPNYVYVKESN |
Ga0188848_10040413 | 3300018775 | Freshwater Lake | MMYNETGKDFIRVKYYFKDHPNTTLSVFFKTNDQAEAFKTKHPDYVYVGS |
Ga0188835_10014582 | 3300019096 | Freshwater Lake | MENLIRVKYYFRDHPNTTLSVFLKTQEQVESYKAKHPNYVYIEESK |
Ga0181359_10010905 | 3300019784 | Freshwater Lake | MKNLIRVKYYFREHPDTTLSVFFKTQEQVESYKAKHRNYVYVEESK |
Ga0181359_10071113 | 3300019784 | Freshwater Lake | MEDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0181359_10224613 | 3300019784 | Freshwater Lake | MMKNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYVTEKN |
Ga0181359_10862993 | 3300019784 | Freshwater Lake | MENLIRVKYYFKEHPNTTLSVFLKTKEQVESYKAKHPNYVYIEESK |
Ga0181359_11885052 | 3300019784 | Freshwater Lake | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKKKHPDYVYITENN |
Ga0181359_11960333 | 3300019784 | Freshwater Lake | MKNLIQVKYYFKEHPKTTLSIYLETQEQVETFKTKHPDYVYVTENN |
Ga0181359_12205692 | 3300019784 | Freshwater Lake | MKDLIRVEYYFKEYPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0194113_102745902 | 3300020074 | Freshwater Lake | MKDLIRVKYYFKDHPNTTLSVFLKTQEQVESYKAKHPNYVYIEKSK |
Ga0194110_100315323 | 3300020084 | Freshwater Lake | MKDLIQVKYYFKEHPNTTLSVFLKTAEQVEAFKAKHPNYVYVGETK |
Ga0194112_102470645 | 3300020109 | Freshwater Lake | NKSLRDMKDLIQVKYYFKEHPNTTLSVFLKTAEQVEAFKAKHPNYVYVGETK |
Ga0211736_108802197 | 3300020151 | Freshwater | MKDLIQVKYYFKEHPNTTLSVFLKTKEQVEAFKAKHPDYVYVGE |
Ga0211734_110000581 | 3300020159 | Freshwater | LRDMKDLIQVKYYFKEHPNTTLSVFLKTVEQVEAFKAKHPDYVYVGETK |
Ga0194131_104269961 | 3300020193 | Freshwater Lake | DMKDLIQVKYYFKEHPNTTLSVFLKTVEQVEAFKAKHPNYVYVESK |
Ga0194124_101117557 | 3300020196 | Freshwater Lake | KYYFKEHPNTTLSVFLKTAEQVEAFKAKHPNYVYVESK |
Ga0194132_101832214 | 3300020214 | Freshwater Lake | IQVKYYFKEHPNTTLSVFLKTAEQVEAFKAKHPNYVYVGETK |
Ga0211501_10068593 | 3300020239 | Marine | METKMIQVKYYFKEHPKTSLSVFLKDQKEVDAFKQKHPNYVYVEA |
Ga0211501_10802272 | 3300020239 | Marine | MKNLIQVKYYFKEHPNTTLSVFLKDQQQVDAFKEKHPNYVYVDIK |
Ga0211651_102691021 | 3300020408 | Marine | LPMETKMIQVKYYFKEHPKTSLSVFLKTEEQVKAFKEKHPDYIYV |
Ga0213858_1000126013 | 3300021356 | Seawater | METKMIQVKYYFKEHPKTSLSVFLKTEEQVKAFKEKHPDYIYV |
Ga0194130_101165655 | 3300021376 | Freshwater Lake | VKYYFKEHPNTTLSVFLKTAEQVEAFKAKHPNYVYVESK |
Ga0194130_104447241 | 3300021376 | Freshwater Lake | YFKEHPNTTLSVFLKTAEQVEAFKAKHPNYVYVESK |
Ga0194117_105260111 | 3300021424 | Freshwater Lake | MKDLIQVKYYFKEHPNTTLSVFLKTTEQVEAFKAKHPNYVY |
Ga0222716_101773343 | 3300021959 | Estuarine Water | MKNLIQVKYYFKEHPNTTLSVFLKDQQQVDAFKQKHPNYVYVEAN |
Ga0222715_101625245 | 3300021960 | Estuarine Water | MKDLIQVKYYFKEHPNTTLSVFLKTNEQVEAFKAKHPDYVYIELK |
Ga0222714_100997532 | 3300021961 | Estuarine Water | MMKNLIQVKYYFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYVTEKN |
Ga0222713_105034713 | 3300021962 | Estuarine Water | MNELIRVRYYFKEHPQSTLSVFLKTQQQVDAFKEKHPDYIYIEETAK |
Ga0222713_107880181 | 3300021962 | Estuarine Water | MKNLIQVKYYFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYVTEKN |
Ga0222712_106611592 | 3300021963 | Estuarine Water | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYVTEKN |
Ga0212031_10481681 | 3300022176 | Aqueous | MKDLIQVKYYFKEHPNTTLSVFLKTEEQVEAFKAKHPDY |
Ga0181354_12067762 | 3300022190 | Freshwater Lake | MKNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYVTEKN |
Ga0181354_12488823 | 3300022190 | Freshwater Lake | MEDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVKESN |
Ga0181351_11923432 | 3300022407 | Freshwater Lake | MMKNLIQVKYYFKEHPKTTLSIYLKNQEQVEAFKTKHPDYVYVTENN |
Ga0181351_12681492 | 3300022407 | Freshwater Lake | MKNLIQVKYYFKEHPKTALSIYLKTEEQVEEFKTKHPDYVYITENN |
Ga0214917_1000610410 | 3300022752 | Freshwater | MIRIKYYYKEYPNTTLSVFLKNEEQVEAFKAKHPDYVYIDE |
Ga0214917_100537793 | 3300022752 | Freshwater | MKNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKKKHPDYVYVTENN |
Ga0255751_104527291 | 3300023116 | Salt Marsh | MKNKSLRDMKDLIQVKYYFKEHPNTTLSVFLKTNEQVEAFKAKHPDYVYVESK |
Ga0210003_10581163 | 3300024262 | Deep Subsurface | MENLIRVKYYFKEHPNTTLSVFLKTQEQVESYKAKHPNYVYIEESK |
Ga0244775_102359892 | 3300024346 | Estuarine | MKDLIQVKYYFKEHPNTTLSVFLKTLEQVEAFKAKHPDYVYVENK |
Ga0208162_10018845 | 3300025674 | Aqueous | MKNLIQVKYYYKEHPNTTLSVFLKDQQQVDAFKQKHPNYVYIESK |
Ga0208923_10309923 | 3300027320 | Estuarine | MTNLIQVKYSFKEHPKTTLSIYLETQEQVEEFKTKHPDYVYVTENN |
Ga0209867_10463722 | 3300027393 | Sand | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYITENN |
Ga0255125_11106422 | 3300027534 | Freshwater | MANLIQVKYSFEEHPKTTLSIYLKTQEQVEAFKTKHPDYVYITENN |
Ga0209552_10655473 | 3300027563 | Freshwater Lake | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVKEFKTKHPDYVYVTENN |
Ga0209651_10214353 | 3300027581 | Freshwater Lake | MEDLIRVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0208974_10267252 | 3300027608 | Freshwater Lentic | MEDLIRVKYYFKEHPNTTLSVFLKTQEQVKSYKTKHPNYVYIEESK |
Ga0208951_10441763 | 3300027621 | Freshwater Lentic | QKNSKRKIRSGCIMTNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYITENN |
Ga0208942_11021693 | 3300027627 | Freshwater Lentic | MMKNLIQVKYYFKEHPKTTLSIYLETQEQVESFKIKHPDYVYITENN |
Ga0209356_11961322 | 3300027644 | Freshwater Lake | DGNLMKDLIRVEYYFKEYPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0208960_10068132 | 3300027649 | Freshwater Lentic | MTNLIQVKYFFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYITENN |
Ga0209357_10093272 | 3300027656 | Freshwater Lake | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYVTENN |
Ga0209551_12605061 | 3300027689 | Freshwater Lake | VKYSFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYITENN |
(restricted) Ga0247836_11211661 | 3300027728 | Freshwater | SFKEHPKTTLSIYLKTQEQVEEFKTKHPDYIYITENN |
(restricted) Ga0247836_11244161 | 3300027728 | Freshwater | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVEEFKTKHPDYIYITENN |
(restricted) Ga0247833_10271921 | 3300027730 | Freshwater | MIKNLIQVKYYFKEHPKTTLSIYLETQEQVEAFKTKHPDYVYVTENN |
(restricted) Ga0247833_11535091 | 3300027730 | Freshwater | MKNLIQVKYYFKEYPNTALSIYLETQEQVEEFKTKHPDYVYVTENN |
Ga0209442_10721422 | 3300027732 | Freshwater Lake | MMKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKKKHPDYVYITENN |
Ga0209444_101430702 | 3300027756 | Freshwater Lake | TQTIRDGNLMEDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0209768_104015041 | 3300027772 | Freshwater Lake | NSKRKIRSGCMMKNLIQVKYYFKEHPKTALSIYLKTREQVEAFKKKHPDYVYITENN |
Ga0209246_102909651 | 3300027785 | Freshwater Lake | MEDLIRVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVK |
Ga0209107_100068042 | 3300027797 | Freshwater And Sediment | MKDLIKVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0209353_101138553 | 3300027798 | Freshwater Lake | MTNLIQVKYSFKEHPKTTLSIYLETQEQVEEFKTKHPDYVYVTEN |
Ga0209354_100908743 | 3300027808 | Freshwater Lake | MMKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDY |
Ga0209230_104104551 | 3300027836 | Freshwater And Sediment | SFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYITENN |
Ga0209550_104689753 | 3300027892 | Freshwater Lake | MKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYI |
(restricted) Ga0247834_11135341 | 3300027977 | Freshwater | MKNLIQVKYYFKEYPNTALSIYLETQEQVEEFKTKHPDYVYATENN |
(restricted) Ga0247835_10539171 | 3300028114 | Freshwater | KEYPNTALSIYLETQEQVEAFKTKHPDYVYVTENN |
Ga0268282_10220721 | 3300028276 | Saline Water | KNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYITENN |
(restricted) Ga0247843_12876292 | 3300028569 | Freshwater | MMKNLIEVKYYFKEHPNTALSIYLKTQEQVEAFKTKHPDYVYITENN |
(restricted) Ga0247844_10433693 | 3300028571 | Freshwater | MKNLIQVKYYFKEYPNTALSIYLETQEQVEEFKTKHPDCVYA |
(restricted) Ga0247840_102841911 | 3300028581 | Freshwater | MIKNLIQVKYYFKEHPKTTLSIYLETQEQVEAFKTKHPDYVYVTEN |
(restricted) Ga0247841_100479573 | 3300029286 | Freshwater | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVEEFKTKHPDYVYVTENN |
Ga0119944_10357842 | 3300029930 | Aquatic | MKKKSLFDMENLIQVKYYFKEHPNTTLSVFLKTTEQVEAFKAKHPDYVYVEAK |
Ga0307488_107583473 | 3300031519 | Sackhole Brine | MEDVIRVKYYFKDYPNTTLSVFLKTQEQADAFRAKHPDYVYIEESN |
Ga0307379_107205061 | 3300031565 | Soil | MENLIRVKYYFKEHPNTTLSVFLKTQEQVESYKAKHPNYVYVEESN |
Ga0307378_110482821 | 3300031566 | Soil | MEDLIRVKYYFKEHPNTTLSVFLKTQEQVESYKAKHPNYVYIEESN |
Ga0307376_101045624 | 3300031578 | Soil | MEDLIRVKYYFKEHPNTTLSVFLKTQEQVESYKTKHPNYVYIEESK |
Ga0307377_101753733 | 3300031673 | Soil | MEDLIRVKYYFKEHPNTTLSVFLKIQEQVEAYKSKHPNYVYVKESN |
Ga0315291_102368284 | 3300031707 | Sediment | MNMIRVKYYFKEHPNTTLSVFLKTQEQVDAFKAKHPDYVYVPIV |
Ga0315293_101480142 | 3300031746 | Sediment | MTMIRVKYYFKEHPNTTLSVFLKTQEQVDAFKAKHPDYVYVPIV |
Ga0315293_104092561 | 3300031746 | Sediment | MKDLIRVEYYFKEYPNTTLSVFLKTQEQVDAYKSKHPNY |
Ga0315293_104265942 | 3300031746 | Sediment | MENLIRVKYYFKDHPNTTLSVFLKTQEQVECYKAKHPNYVYIEESK |
Ga0315293_105315783 | 3300031746 | Sediment | MKDLIRVEYYFKEYPNTTLSVFLKTQEQVDAYKSKH |
Ga0315288_104327002 | 3300031772 | Sediment | MKDLIRVEYYFKEYPNTTLSIFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0315288_113136691 | 3300031772 | Sediment | IQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYITENN |
Ga0315320_100601151 | 3300031851 | Seawater | METKMIQVKYYFKEHPKTSLSVFLKTEEQVKAFKENH |
Ga0315297_116632872 | 3300031873 | Sediment | KRKIRSGCIMKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYITENN |
Ga0315285_101206634 | 3300031885 | Sediment | MTMIRVKYYFKEHPNTTLSVFLKTQEQVDAFKSKHPDYVYVPVV |
Ga0315289_108180812 | 3300032046 | Sediment | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVKEFKTKHPDYVYITENN |
Ga0315284_120722422 | 3300032053 | Sediment | MEDLIRVEYYFKEHPNTTLSVFLKTQEQVDAYKSKHPNYVYVKESN |
Ga0315903_109521122 | 3300032116 | Freshwater | MENLIQVKYYFKEHPNTTLSVFLKTEEQVEASKAKHPDYVYVEAK |
Ga0315283_123079122 | 3300032164 | Sediment | SKRKIRSGCIMKNLIQVKYYFKEHPKTALSIYLKTQEQVEAFKTKHPDYVYVTENN |
Ga0315268_103128703 | 3300032173 | Sediment | MTNLIQVKYSFKEHPKTTLSIYLKTQEQVEAFKTKHPDYVYITENN |
Ga0315276_106349111 | 3300032177 | Sediment | FRDHPNTTLSVFLKTQEQVESYKAKHPNYVYIEESK |
Ga0334722_112383181 | 3300033233 | Sediment | KEYPNTTLSVFLKTQEQVDAYKSKHPNYVYIEESK |
Ga0310127_302910_141_272 | 3300034072 | Fracking Water | MIRVKYYFKEHPNTTLSVFLKNEEQVKDFKAKHPNYVYVGETK |
Ga0310130_0027259_1653_1778 | 3300034073 | Fracking Water | RVKYYYKEYPNTTLSVFLKTEEQVKDFKSKHPNYVYVGETK |
Ga0335066_0062119_2175_2306 | 3300034112 | Freshwater | MIRVKYYYKEYPNTTLSVFLKTEEQVEAFKAKHPDCVYVGETK |
⦗Top⦘ |