| Basic Information | |
|---|---|
| Family ID | F024614 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 205 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DSYPVSTGPVGSVDKIRLQRVVDVMQQFIGFPSFNIDSMLMGSG |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 205 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.71 % |
| % of genes from short scaffolds (< 2000 bps) | 87.80 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.171 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.585 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.927 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.561 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.39% β-sheet: 0.00% Coil/Unstructured: 73.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 205 Family Scaffolds |
|---|---|---|
| PF12680 | SnoaL_2 | 9.76 |
| PF12697 | Abhydrolase_6 | 8.29 |
| PF07690 | MFS_1 | 4.88 |
| PF08281 | Sigma70_r4_2 | 4.39 |
| PF00501 | AMP-binding | 3.41 |
| PF07719 | TPR_2 | 2.93 |
| PF08352 | oligo_HPY | 2.44 |
| PF09339 | HTH_IclR | 2.44 |
| PF04672 | Methyltransf_19 | 1.95 |
| PF00574 | CLP_protease | 1.95 |
| PF04286 | DUF445 | 1.95 |
| PF02687 | FtsX | 1.46 |
| PF08044 | DUF1707 | 1.46 |
| PF02702 | KdpD | 1.46 |
| PF01047 | MarR | 1.46 |
| PF00665 | rve | 0.98 |
| PF09660 | DUF2397 | 0.98 |
| PF09594 | GT87 | 0.98 |
| PF16859 | TetR_C_11 | 0.98 |
| PF01614 | IclR | 0.98 |
| PF13561 | adh_short_C2 | 0.98 |
| PF00582 | Usp | 0.98 |
| PF12681 | Glyoxalase_2 | 0.98 |
| PF08240 | ADH_N | 0.49 |
| PF13280 | WYL | 0.49 |
| PF00378 | ECH_1 | 0.49 |
| PF00355 | Rieske | 0.49 |
| PF13414 | TPR_11 | 0.49 |
| PF12852 | Cupin_6 | 0.49 |
| PF00296 | Bac_luciferase | 0.49 |
| PF13560 | HTH_31 | 0.49 |
| PF01022 | HTH_5 | 0.49 |
| PF00931 | NB-ARC | 0.49 |
| PF00724 | Oxidored_FMN | 0.49 |
| PF13193 | AMP-binding_C | 0.49 |
| PF12277 | DUF3618 | 0.49 |
| PF13558 | SbcC_Walker_B | 0.49 |
| PF02801 | Ketoacyl-synt_C | 0.49 |
| PF00027 | cNMP_binding | 0.49 |
| PF14789 | THDPS_M | 0.49 |
| PF05721 | PhyH | 0.49 |
| PF13602 | ADH_zinc_N_2 | 0.49 |
| PF00578 | AhpC-TSA | 0.49 |
| PF00903 | Glyoxalase | 0.49 |
| PF05977 | MFS_3 | 0.49 |
| PF00282 | Pyridoxal_deC | 0.49 |
| PF00583 | Acetyltransf_1 | 0.49 |
| PF00122 | E1-E2_ATPase | 0.49 |
| PF03795 | YCII | 0.49 |
| PF00196 | GerE | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 205 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.90 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 3.90 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.95 |
| COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 1.95 |
| COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 1.95 |
| COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 1.46 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.98 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.98 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.98 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.98 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.98 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.49 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.49 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.49 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.49 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.49 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.49 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.17 % |
| Unclassified | root | N/A | 26.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_108369936 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300003219|JGI26341J46601_10040288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis taiwanensis | 1493 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10306847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300003659|JGI25404J52841_10022971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1347 | Open in IMG/M |
| 3300004091|Ga0062387_100764838 | Not Available | 715 | Open in IMG/M |
| 3300004091|Ga0062387_100913200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300004153|Ga0063455_100381012 | Not Available | 821 | Open in IMG/M |
| 3300004635|Ga0062388_100357825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1248 | Open in IMG/M |
| 3300005332|Ga0066388_103830241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 768 | Open in IMG/M |
| 3300005335|Ga0070666_10322208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1103 | Open in IMG/M |
| 3300005338|Ga0068868_100054641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3148 | Open in IMG/M |
| 3300005341|Ga0070691_10020042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3087 | Open in IMG/M |
| 3300005341|Ga0070691_10021427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 2990 | Open in IMG/M |
| 3300005435|Ga0070714_100618221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora longispora | 1041 | Open in IMG/M |
| 3300005435|Ga0070714_100883319 | Not Available | 867 | Open in IMG/M |
| 3300005436|Ga0070713_101297316 | Not Available | 705 | Open in IMG/M |
| 3300005437|Ga0070710_10021704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3351 | Open in IMG/M |
| 3300005437|Ga0070710_10786602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
| 3300005439|Ga0070711_100202017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1534 | Open in IMG/M |
| 3300005439|Ga0070711_100947824 | Not Available | 736 | Open in IMG/M |
| 3300005518|Ga0070699_100578050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1024 | Open in IMG/M |
| 3300005548|Ga0070665_100839885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 932 | Open in IMG/M |
| 3300005577|Ga0068857_100615188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1028 | Open in IMG/M |
| 3300005591|Ga0070761_10307741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 955 | Open in IMG/M |
| 3300005610|Ga0070763_10247645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 965 | Open in IMG/M |
| 3300005614|Ga0068856_100227316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1881 | Open in IMG/M |
| 3300005614|Ga0068856_100309097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1598 | Open in IMG/M |
| 3300005712|Ga0070764_10238821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1031 | Open in IMG/M |
| 3300005842|Ga0068858_100812324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 912 | Open in IMG/M |
| 3300005843|Ga0068860_100876923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 913 | Open in IMG/M |
| 3300005995|Ga0066790_10000556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14251 | Open in IMG/M |
| 3300006028|Ga0070717_10315708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1391 | Open in IMG/M |
| 3300006028|Ga0070717_10598103 | Not Available | 1000 | Open in IMG/M |
| 3300006028|Ga0070717_10624722 | Not Available | 977 | Open in IMG/M |
| 3300006028|Ga0070717_11660270 | Not Available | 578 | Open in IMG/M |
| 3300006102|Ga0075015_100131231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → unclassified Kineosporia → Kineosporia sp. R_H_3 | 1288 | Open in IMG/M |
| 3300006162|Ga0075030_101468937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 534 | Open in IMG/M |
| 3300006174|Ga0075014_100098463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1359 | Open in IMG/M |
| 3300006175|Ga0070712_100975920 | Not Available | 733 | Open in IMG/M |
| 3300006354|Ga0075021_10452185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 810 | Open in IMG/M |
| 3300006797|Ga0066659_10797761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300006804|Ga0079221_10648903 | Not Available | 723 | Open in IMG/M |
| 3300006804|Ga0079221_10951470 | Not Available | 638 | Open in IMG/M |
| 3300006804|Ga0079221_11234375 | Not Available | 583 | Open in IMG/M |
| 3300006871|Ga0075434_100051190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4103 | Open in IMG/M |
| 3300006914|Ga0075436_100938998 | Not Available | 648 | Open in IMG/M |
| 3300006914|Ga0075436_101371485 | Not Available | 536 | Open in IMG/M |
| 3300006953|Ga0074063_14281186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300006954|Ga0079219_10940605 | Not Available | 706 | Open in IMG/M |
| 3300009098|Ga0105245_12834967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
| 3300009520|Ga0116214_1388165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300009523|Ga0116221_1061889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1713 | Open in IMG/M |
| 3300009551|Ga0105238_11545497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
| 3300009551|Ga0105238_12695962 | Not Available | 533 | Open in IMG/M |
| 3300009645|Ga0116106_1065076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CB01249 | 1201 | Open in IMG/M |
| 3300009672|Ga0116215_1376722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300009700|Ga0116217_10531233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia asiatica | 737 | Open in IMG/M |
| 3300009700|Ga0116217_10767108 | Not Available | 595 | Open in IMG/M |
| 3300009824|Ga0116219_10363605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 810 | Open in IMG/M |
| 3300009839|Ga0116223_10130544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1571 | Open in IMG/M |
| 3300010379|Ga0136449_100506834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2093 | Open in IMG/M |
| 3300010379|Ga0136449_104541820 | Not Available | 509 | Open in IMG/M |
| 3300010396|Ga0134126_11064516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 903 | Open in IMG/M |
| 3300010876|Ga0126361_10412929 | Not Available | 616 | Open in IMG/M |
| 3300012200|Ga0137382_10930208 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012209|Ga0137379_11319379 | Not Available | 627 | Open in IMG/M |
| 3300012210|Ga0137378_10284300 | Not Available | 1539 | Open in IMG/M |
| 3300012210|Ga0137378_10471365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1161 | Open in IMG/M |
| 3300012211|Ga0137377_10730456 | Not Available | 924 | Open in IMG/M |
| 3300012212|Ga0150985_118579557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300012351|Ga0137386_10951518 | Not Available | 613 | Open in IMG/M |
| 3300012356|Ga0137371_10613589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
| 3300012924|Ga0137413_11286290 | Not Available | 586 | Open in IMG/M |
| 3300012930|Ga0137407_10038048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3817 | Open in IMG/M |
| 3300012960|Ga0164301_11049717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300012985|Ga0164308_11909265 | Not Available | 554 | Open in IMG/M |
| 3300012987|Ga0164307_11253658 | Not Available | 617 | Open in IMG/M |
| 3300012989|Ga0164305_11393737 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300013104|Ga0157370_11528986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300013306|Ga0163162_10295969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1750 | Open in IMG/M |
| 3300013306|Ga0163162_13174872 | Not Available | 527 | Open in IMG/M |
| 3300013307|Ga0157372_10623457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1257 | Open in IMG/M |
| 3300014495|Ga0182015_10360338 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300014657|Ga0181522_10924123 | Not Available | 539 | Open in IMG/M |
| 3300014745|Ga0157377_11006941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
| 3300014969|Ga0157376_10493838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1202 | Open in IMG/M |
| 3300016294|Ga0182041_10320608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1292 | Open in IMG/M |
| 3300016294|Ga0182041_12014976 | Not Available | 538 | Open in IMG/M |
| 3300016422|Ga0182039_10215423 | Not Available | 1542 | Open in IMG/M |
| 3300016445|Ga0182038_10243354 | Not Available | 1442 | Open in IMG/M |
| 3300017926|Ga0187807_1024125 | Not Available | 1877 | Open in IMG/M |
| 3300017942|Ga0187808_10152815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300017946|Ga0187879_10331444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora longispora | 844 | Open in IMG/M |
| 3300017955|Ga0187817_10964086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300017972|Ga0187781_10228433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → unclassified Hamadaea → Hamadaea sp. | 1315 | Open in IMG/M |
| 3300017973|Ga0187780_10875587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300017974|Ga0187777_10287354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PIP175 | 1122 | Open in IMG/M |
| 3300017975|Ga0187782_11613641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia asiatica | 512 | Open in IMG/M |
| 3300018043|Ga0187887_10777708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Friedmanniella → environmental samples → uncultured Friedmanniella sp. | 566 | Open in IMG/M |
| 3300018047|Ga0187859_10311836 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300018060|Ga0187765_10208116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300018060|Ga0187765_10549715 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018482|Ga0066669_12336683 | Not Available | 511 | Open in IMG/M |
| 3300020082|Ga0206353_11657117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300021374|Ga0213881_10016833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3003 | Open in IMG/M |
| 3300021401|Ga0210393_10352914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1197 | Open in IMG/M |
| 3300021401|Ga0210393_10363091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1179 | Open in IMG/M |
| 3300021403|Ga0210397_10145003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1654 | Open in IMG/M |
| 3300021403|Ga0210397_10344806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1103 | Open in IMG/M |
| 3300021420|Ga0210394_10934198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
| 3300021474|Ga0210390_10551165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 969 | Open in IMG/M |
| 3300021477|Ga0210398_10392941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 1131 | Open in IMG/M |
| 3300022840|Ga0224549_1014097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1137 | Open in IMG/M |
| 3300025900|Ga0207710_10221494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 940 | Open in IMG/M |
| 3300025906|Ga0207699_10284894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora longispora | 1149 | Open in IMG/M |
| 3300025906|Ga0207699_11006011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300025914|Ga0207671_10882188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
| 3300025916|Ga0207663_10424396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1021 | Open in IMG/M |
| 3300025916|Ga0207663_10838250 | Not Available | 733 | Open in IMG/M |
| 3300025928|Ga0207700_10165806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1838 | Open in IMG/M |
| 3300025928|Ga0207700_11795476 | Not Available | 539 | Open in IMG/M |
| 3300025929|Ga0207664_10044323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 3483 | Open in IMG/M |
| 3300025929|Ga0207664_10170907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1860 | Open in IMG/M |
| 3300025932|Ga0207690_11200525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300026078|Ga0207702_10330457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1454 | Open in IMG/M |
| 3300026294|Ga0209839_10001245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13136 | Open in IMG/M |
| 3300026557|Ga0179587_11144147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300027590|Ga0209116_1053285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 875 | Open in IMG/M |
| 3300027641|Ga0208827_1043665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1534 | Open in IMG/M |
| 3300027775|Ga0209177_10314082 | Not Available | 601 | Open in IMG/M |
| 3300028379|Ga0268266_10090954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2675 | Open in IMG/M |
| 3300028720|Ga0307317_10328800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300028780|Ga0302225_10214108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300028784|Ga0307282_10083801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1463 | Open in IMG/M |
| 3300028789|Ga0302232_10101537 | Not Available | 1473 | Open in IMG/M |
| 3300028828|Ga0307312_10555013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 759 | Open in IMG/M |
| 3300028828|Ga0307312_11071683 | Not Available | 533 | Open in IMG/M |
| 3300028877|Ga0302235_10490394 | Not Available | 522 | Open in IMG/M |
| 3300028879|Ga0302229_10232808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 837 | Open in IMG/M |
| 3300029993|Ga0302304_10300487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 587 | Open in IMG/M |
| 3300029999|Ga0311339_10603683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1092 | Open in IMG/M |
| 3300030056|Ga0302181_10276374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 752 | Open in IMG/M |
| 3300030058|Ga0302179_10312260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 692 | Open in IMG/M |
| 3300030399|Ga0311353_10669357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 899 | Open in IMG/M |
| 3300030490|Ga0302184_10137081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1073 | Open in IMG/M |
| 3300030494|Ga0310037_10308927 | Not Available | 672 | Open in IMG/M |
| 3300030520|Ga0311372_10974367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 1124 | Open in IMG/M |
| 3300030520|Ga0311372_12134888 | Not Available | 648 | Open in IMG/M |
| 3300030524|Ga0311357_10686914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 931 | Open in IMG/M |
| 3300031027|Ga0302308_10211346 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300031028|Ga0302180_10564391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 551 | Open in IMG/M |
| 3300031469|Ga0170819_15218207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
| 3300031469|Ga0170819_15449214 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031525|Ga0302326_11382403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 952 | Open in IMG/M |
| 3300031544|Ga0318534_10614408 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031564|Ga0318573_10105576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1450 | Open in IMG/M |
| 3300031564|Ga0318573_10249493 | Not Available | 946 | Open in IMG/M |
| 3300031681|Ga0318572_10437071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 778 | Open in IMG/M |
| 3300031718|Ga0307474_10219285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1452 | Open in IMG/M |
| 3300031719|Ga0306917_10263951 | Not Available | 1323 | Open in IMG/M |
| 3300031719|Ga0306917_10564119 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300031723|Ga0318493_10536076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300031736|Ga0318501_10141673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae | 1232 | Open in IMG/M |
| 3300031751|Ga0318494_10077067 | Not Available | 1806 | Open in IMG/M |
| 3300031771|Ga0318546_11278381 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031798|Ga0318523_10431337 | Not Available | 654 | Open in IMG/M |
| 3300031805|Ga0318497_10002886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7035 | Open in IMG/M |
| 3300031845|Ga0318511_10418938 | Not Available | 615 | Open in IMG/M |
| 3300031860|Ga0318495_10251289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
| 3300031860|Ga0318495_10388337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300031890|Ga0306925_11040551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 832 | Open in IMG/M |
| 3300031890|Ga0306925_11595758 | Not Available | 635 | Open in IMG/M |
| 3300031896|Ga0318551_10041291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2290 | Open in IMG/M |
| 3300031939|Ga0308174_10215530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1473 | Open in IMG/M |
| 3300031946|Ga0310910_10574254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 894 | Open in IMG/M |
| 3300031959|Ga0318530_10092917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1192 | Open in IMG/M |
| 3300032060|Ga0318505_10208711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 915 | Open in IMG/M |
| 3300032064|Ga0318510_10033031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1744 | Open in IMG/M |
| 3300032065|Ga0318513_10272185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 822 | Open in IMG/M |
| 3300032066|Ga0318514_10132195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1286 | Open in IMG/M |
| 3300032067|Ga0318524_10425093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 694 | Open in IMG/M |
| 3300032068|Ga0318553_10157106 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300032160|Ga0311301_10182044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3669 | Open in IMG/M |
| 3300032160|Ga0311301_10824346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CB01249 | 1268 | Open in IMG/M |
| 3300032160|Ga0311301_11446420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300032160|Ga0311301_12765581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia asiatica | 537 | Open in IMG/M |
| 3300032205|Ga0307472_101747620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300032770|Ga0335085_10159829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2813 | Open in IMG/M |
| 3300032770|Ga0335085_11127639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 838 | Open in IMG/M |
| 3300032805|Ga0335078_10682507 | Not Available | 1277 | Open in IMG/M |
| 3300032805|Ga0335078_10859336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1096 | Open in IMG/M |
| 3300032805|Ga0335078_12627525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 515 | Open in IMG/M |
| 3300032828|Ga0335080_10091208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 3379 | Open in IMG/M |
| 3300032892|Ga0335081_11102359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300032893|Ga0335069_10001649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 35733 | Open in IMG/M |
| 3300032895|Ga0335074_11086910 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300032896|Ga0335075_10224155 | Not Available | 2208 | Open in IMG/M |
| 3300032896|Ga0335075_11367716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300033158|Ga0335077_10098219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 3440 | Open in IMG/M |
| 3300033290|Ga0318519_10197593 | Not Available | 1146 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.49% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.49% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.49% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.49% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.49% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1083699364 | 3300000956 | Soil | LGSVDEIRLQRVVDVMRRFLGFGKFDIGSMLMSSASSAGGG* |
| JGI26341J46601_100402881 | 3300003219 | Bog Forest Soil | AAVMGLDSYPVSTGLVXSVDKIRLQRVVNVMQQFIGFPSFNIDSMLMGGG* |
| JGIcombinedJ51221_103068472 | 3300003505 | Forest Soil | VSTGPVGSVDTAQLKRVVNIMQQFIGFDQAFNIDSMLMGGRSR* |
| JGI25404J52841_100229712 | 3300003659 | Tabebuia Heterophylla Rhizosphere | VALIGSGEFALAAVLALDSYPFSPGPVGSVDKIRLERVVNVMQQFIAFPKFSIDTMIMPHT* |
| Ga0062387_1007648382 | 3300004091 | Bog Forest Soil | VSNGPVGSVDKLRLQRVVDVMKQFLGFPKFDISSMLMGSG* |
| Ga0062387_1009132001 | 3300004091 | Bog Forest Soil | ALMSLESYPFSSGPVGSVDTVRLQRVVDVMREFMGFPAFDIDSMLMGR* |
| Ga0063455_1003810122 | 3300004153 | Soil | VDVVRLKRVVDVMHQFLGFPAFDITSMLMGSGQGHGATG* |
| Ga0062388_1003578253 | 3300004635 | Bog Forest Soil | AAVMTLDQYPVSTGPVGSVDEVRLQRVVDVMQQFLGFGSFNVSSMLMHG* |
| Ga0066388_1038302411 | 3300005332 | Tropical Forest Soil | TAAVLALDSYPVSHGPVGSVDKIRLERVVNVMRQFIKFPAFNIDSMLMDSG* |
| Ga0070666_103222081 | 3300005335 | Switchgrass Rhizosphere | VSAETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSADS |
| Ga0068868_1000546413 | 3300005338 | Miscanthus Rhizosphere | PVSTGPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSADS* |
| Ga0070691_100200421 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG* |
| Ga0070691_100214271 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | SAETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSADS* |
| Ga0070714_1006182211 | 3300005435 | Agricultural Soil | VSKETAAVMALDSYPVSSGPAGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMDG* |
| Ga0070714_1008833192 | 3300005435 | Agricultural Soil | ALDSYPVSHGPAGSVDKIRLERVVNVMQQFIGFPKFNIDSMLMPGT* |
| Ga0070713_1012973161 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AVSKETAAVMALDSYPVSSGPVGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMNG* |
| Ga0070710_100217041 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG* |
| Ga0070710_107866021 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSADS* |
| Ga0070711_1002020173 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VMALDSYPVSSGPAGSVDLVRLERVVNVMHQFLGFGTFNVKSMLMNG* |
| Ga0070711_1009478242 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MALDSYPVSSGPAGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMDG* |
| Ga0070699_1005780502 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PGPVGSVDKIRLERVVNVMQQFIGFPKFNIDTMLMPGSGP* |
| Ga0070665_1008398852 | 3300005548 | Switchgrass Rhizosphere | VSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG* |
| Ga0068857_1006151881 | 3300005577 | Corn Rhizosphere | VSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMDRASSAGG* |
| Ga0070761_103077411 | 3300005591 | Soil | TAAVMALDNYPVSDGPVGTVDEVRLQRVANVMHQFLPFPQFNISTMLIGG* |
| Ga0070763_102476451 | 3300005610 | Soil | YPVSTGPAGRVDAVQLKRVVDVMQQFIGFGQAFNIDSMLMGG* |
| Ga0068856_1002273161 | 3300005614 | Corn Rhizosphere | YPVSTGPPGSVDKVRLQRVVDVMRQFLKSPAFSISSMLMGNGRGRATG* |
| Ga0068856_1003090971 | 3300005614 | Corn Rhizosphere | MALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG* |
| Ga0070764_102388212 | 3300005712 | Soil | PTAAALMSVDDYPVSSGPVGTVDQVRLQRVVNVMQQFLGFDPSFSIDSMLMNGG* |
| Ga0068858_1008123241 | 3300005842 | Switchgrass Rhizosphere | MALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMGSASSAGG* |
| Ga0068860_1008769232 | 3300005843 | Switchgrass Rhizosphere | DKIRLQRVVDVMRQFLGFGDFDIGSMLMGSASTAGG* |
| Ga0066790_1000055613 | 3300005995 | Soil | MSLSAYPVSPGPVGSVDKIRLRRVVNLMQQFIGLPAFNIDSMLMRG* |
| Ga0070717_103157081 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG* |
| Ga0070717_105981034 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKETAAVMALDSYPVSSGPVGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMNG* |
| Ga0070717_106247222 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SGPAGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMNG* |
| Ga0070717_116602701 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AVMALDSYPVSSGPAGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMDG* |
| Ga0075015_1001312311 | 3300006102 | Watersheds | TGPAGSVDTVQLKRVVDVMQQFIGLGQAFNIDSMLMGG* |
| Ga0075030_1014689371 | 3300006162 | Watersheds | VMGVDSYPVSTGPVGSVDKTRLQRVVDVMQQFIGFPSFNIGSMLMGSG* |
| Ga0075014_1000984631 | 3300006174 | Watersheds | IMSLENYPVSTGPAGSVDTVQLKRVVDVMQQFIGLGQAFNIDSMLMGG* |
| Ga0070712_1009759201 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YPVSSGPAGSVDLVRLERVVNVMHQFLGFATFDVKSMLMDG* |
| Ga0075021_104521851 | 3300006354 | Watersheds | VSTGPAGSVDTVQLKRVVNIMQQFIGFDQAFNIDSMLMGGRSR* |
| Ga0066659_107977611 | 3300006797 | Soil | VSTGPVGSVDKVRLQRVVDVMRRFLAFPTFDIGSMLKGRG* |
| Ga0079221_106489033 | 3300006804 | Agricultural Soil | PKITAAMMSLQSYPVSTGPAGSVDKVRLQRVADAMHQFIGFPAFSIDSMLMGG* |
| Ga0079221_109514701 | 3300006804 | Agricultural Soil | DKVRLQRVVDVMRQFLKSPAFSISSMLMGNGRGRATG* |
| Ga0079221_112343751 | 3300006804 | Agricultural Soil | VSSGPAGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMNG* |
| Ga0075434_1000511901 | 3300006871 | Populus Rhizosphere | AVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSADS* |
| Ga0075436_1009389982 | 3300006914 | Populus Rhizosphere | GLPKITAAMMSLQSYPVSTGPAGSVDKVRLQRVADAMHQFIGFPAFSIDSMLMGG* |
| Ga0075436_1013714852 | 3300006914 | Populus Rhizosphere | ALDSYPVSTGPPGSVDKVRLQRVVDVMRQFLKSPAFSISSMLMGNGRGRATG* |
| Ga0074063_142811861 | 3300006953 | Soil | YPVSTGPVGSVDKIRLQRVVDVMRRFLGFGKFDIGSMLMGSTSSTGG* |
| Ga0079219_109406051 | 3300006954 | Agricultural Soil | KITAAMMSLQSYPVSTGPAGSVDKVRLQRVADAMHQFIGFPAFSIDSMLMGG* |
| Ga0105245_128349672 | 3300009098 | Miscanthus Rhizosphere | VMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG* |
| Ga0116214_13881651 | 3300009520 | Peatlands Soil | PVSTGPAGSVDTVQLKRVVDVMQQFVGFGQAFNIDSMLMGG* |
| Ga0116221_10618892 | 3300009523 | Peatlands Soil | AETAAVMALDSYPFSNGPVGSVDQVRLQRVVDVMQQFLGFPKFDIGSMLMGNG* |
| Ga0105238_115454972 | 3300009551 | Corn Rhizosphere | VSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMGSASSAGG* |
| Ga0105238_126959622 | 3300009551 | Corn Rhizosphere | AVLALDSYPFSSGPVGSVDKIRLERVVNVMQQFIRFPKFNIDTMLMPHT* |
| Ga0116106_10650762 | 3300009645 | Peatland | PVSTGPVGSVDKIRLQRVVNVMQQFIGFPSFNIDSMLMGSG* |
| Ga0116215_13767223 | 3300009672 | Peatlands Soil | PVSTGPAGSVDTVQLKRVVDVMQQFIGFGQAFNIDSMLMGG* |
| Ga0116217_105312332 | 3300009700 | Peatlands Soil | GPVGSVDTVQLQRVVEVMQQFLMIPKFNIDSMLLTG* |
| Ga0116217_107671081 | 3300009700 | Peatlands Soil | MSLEGYPFSSGPVGSVDTVRLQRVVDVMHQFMGFPVFNIDSMLMSSG* |
| Ga0116219_103636051 | 3300009824 | Peatlands Soil | VGSVDEARLQRVVDVMQQFIGFPSSFNINSMLMSGG* |
| Ga0116223_101305443 | 3300009839 | Peatlands Soil | GVDSYPVSTGPVGSVDKTRLQRVVDVMQQFIGFPSSFNINSMLMSGG* |
| Ga0136449_1005068343 | 3300010379 | Peatlands Soil | ALDTYPVSTGPVGSVDKVRLQRVVNVMQQFIGFPSFNLNSMLMGNG* |
| Ga0136449_1045418202 | 3300010379 | Peatlands Soil | VSTGPVGSVDKIRLQRIVNVMQQFIGFPSFNIDSMLMGSA* |
| Ga0134126_110645161 | 3300010396 | Terrestrial Soil | AETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSADS* |
| Ga0126361_104129292 | 3300010876 | Boreal Forest Soil | VGSVDKVRLQRVVDVMQQFLGFSSSFNINSMLTGG* |
| Ga0137382_109302081 | 3300012200 | Vadose Zone Soil | VDKVRLQRVVDVMRQFLAFPTFDIGSMLMGSASSAGG* |
| Ga0137379_113193791 | 3300012209 | Vadose Zone Soil | SHGPAGSVDKIRLERVVNVMQQFIGFPKFNIDTMLMPGT* |
| Ga0137378_102843001 | 3300012210 | Vadose Zone Soil | GSVDKVRLQRVVDVMHQFLGFPKFDIDSMLMDSG* |
| Ga0137378_104713652 | 3300012210 | Vadose Zone Soil | AVLALDSYPVSHGPAGSVDKIRLERVVNVMQQFIGFPKFNIDTMLMPAGP* |
| Ga0137377_107304562 | 3300012211 | Vadose Zone Soil | TGPVGSVDKARLQRVVNVMRQFIGSPRFDIGSMLMGGNG* |
| Ga0150985_1185795572 | 3300012212 | Avena Fatua Rhizosphere | VSAKTAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRRFLGFGKFDIGSMLMGSASSAGGG* |
| Ga0137386_109515181 | 3300012351 | Vadose Zone Soil | DSYPVSTGPPGSVDKIRLQRVVDVMRRFLGLPKFDIGSMLMGRG* |
| Ga0137371_106135892 | 3300012356 | Vadose Zone Soil | AVLALDSYPVSHGPVGSVDKIRLERVVNVMQQFIGFPKFNIDTMLMPGA* |
| Ga0137413_112862902 | 3300012924 | Vadose Zone Soil | TASVMALDSYPVSSGPVGSVDLVRLERVVNVMHQFLGLPKFDIKSMMMNAG* |
| Ga0137407_100380481 | 3300012930 | Vadose Zone Soil | KQTAAVLALDSYPVSHGPAGGVDKIRLERVVNVMQQFIGFPKFNIGTMLMPGT* |
| Ga0164301_110497171 | 3300012960 | Soil | IRLQRVVDVMRQFLGFGDFDTGSMLMGSVSTAGG* |
| Ga0164308_119092652 | 3300012985 | Soil | AAVMALDSYPVSTGPPGSVDKVRLQRVVDVMRQFLKSPAFSISSMLMGNGRGRATG* |
| Ga0164307_112536582 | 3300012987 | Soil | AVMALDSYPVATGPPGSVDKVRLQRVVDVMRQFLNSPAFNISSMLIGSGRGRATG* |
| Ga0164305_113937372 | 3300012989 | Soil | AILALDSYPVSEGPVGTVDTVRLERVVNVMRQFIGFGKFNIGTMLMNGS* |
| Ga0157370_115289862 | 3300013104 | Corn Rhizosphere | STGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG* |
| Ga0163162_102959693 | 3300013306 | Switchgrass Rhizosphere | ETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMGSASSAGG* |
| Ga0163162_131748722 | 3300013306 | Switchgrass Rhizosphere | LDSYPFSAGPVGSVNKIRLERVVNVMQQFIRFPKFNIDTMIMPHT* |
| Ga0157372_106234573 | 3300013307 | Corn Rhizosphere | AETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG* |
| Ga0182015_103603381 | 3300014495 | Palsa | LTPATAALMSLDEYPVSSGPVGTVDKIRLQRVVNVMQQFLGFDPSFKID |
| Ga0181522_109241232 | 3300014657 | Bog | AVDKETAAVMALDNYPVSDGPVGSVDAVRLQRVANVMHQFLPFPQFSISTMLKGSG* |
| Ga0157377_110069412 | 3300014745 | Miscanthus Rhizosphere | DSYPVSTGPVGSVDKIRLQRVVDVMRQLLGFGDFDTGSMLMGSASTAGG* |
| Ga0157376_104938383 | 3300014969 | Miscanthus Rhizosphere | GSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASTAGG* |
| Ga0182041_103206082 | 3300016294 | Soil | GPVGRVDKVRLQRVVDVMRQFLRLPKFDIDSMLMGSG |
| Ga0182041_120149761 | 3300016294 | Soil | TGPAGSVDRVRLERVVNVMQQFIGFPSFSVSSMLMNDGS |
| Ga0182039_102154232 | 3300016422 | Soil | SYPVSPGPVGSVDAVRLQRVVDVMRQVIGFPPFNVDSMLMGG |
| Ga0182038_102433541 | 3300016445 | Soil | LEGYPFSPGPVGSVDRPRLQRVVDVMRQFIGFPAFNIGSMLMR |
| Ga0187807_10241253 | 3300017926 | Freshwater Sediment | KVTAAVMGVDSYPVSTGPVGSVDRIRLQRVVNVMQQFIGFPSFNIDSMLMGSG |
| Ga0187808_101528151 | 3300017942 | Freshwater Sediment | GPAGSVDKLRLQRVVDVMQPFLGFGKFDIGSMLMGSG |
| Ga0187879_103314442 | 3300017946 | Peatland | SPATAAVMALNSYPVSSGPAGSVDLTRLQRVVNVMQRYLGFPDFNIKSMLMNGG |
| Ga0187817_109640862 | 3300017955 | Freshwater Sediment | YPVSSGPVGSVDKVRLQRVVDVMQQFIGFPAFNIDSMLMGG |
| Ga0187781_102284332 | 3300017972 | Tropical Peatland | VPKQIAAVMALDDYPVSTGPVGTVDAVRLQRVVDVMEEFLMIPKFNIDSMLLNG |
| Ga0187780_108755871 | 3300017973 | Tropical Peatland | PLGGVDKVRLQRVVDVMQQFLGFDSSFNINSMLTGG |
| Ga0187777_102873541 | 3300017974 | Tropical Peatland | LDSYPVSTGPVGSVDTEQLKRVVDVMQQFIGFDPAFSIDSILMGG |
| Ga0187782_116136411 | 3300017975 | Tropical Peatland | TAAVMALDDYPFSTGPVGSVDPDRLQRVVDVMQQFLMIPKFSIDSMLLNG |
| Ga0187887_107777081 | 3300018043 | Peatland | AATAALMSLDQYPVSSGPVGTVDKARLQRVVNVMQQFLGFDPSFNIDSMLINGG |
| Ga0187859_103118362 | 3300018047 | Peatland | PVSSGPVGTVDKIRLQRVVNVMQQFLGFDPSFKIDSMLMNGG |
| Ga0187765_102081161 | 3300018060 | Tropical Peatland | TAAVMALDSYPVSAGPVGSVDKVRLQRVVDVMQQFLAFGKFDIDSMLMGRG |
| Ga0187765_105497152 | 3300018060 | Tropical Peatland | MLLGEHGRVDPARPERVVDVMQQFLGFQASFNVKSMQTGG |
| Ga0187784_107015512 | 3300018062 | Tropical Peatland | MALDSYPFSTGAVGAVDKVRLERVVDAMQQYLGLDQAFNINSMLMGG |
| Ga0066669_123366831 | 3300018482 | Grasslands Soil | PVGSVDKIRLERVVHGMQQFIGFPKFNIDTMIMPGP |
| Ga0206353_116571171 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | SAETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSAGG |
| Ga0213881_100168331 | 3300021374 | Exposed Rock | ALESYPVSPGPAGRVDTVRLQRIVQVMQQFTGFPPFSIDSMLMKGK |
| Ga0210393_103529143 | 3300021401 | Soil | STGPVGSVDKVRLQRVVDVMQQFIGFPSFNINSMLMGGG |
| Ga0210393_103630911 | 3300021401 | Soil | PVGSVDKVRLQRVVDVMQQFIGFPSFNINSMLMGSG |
| Ga0210397_101450031 | 3300021403 | Soil | VGSVDKVRLQRVVDVMQQFIGFPSFNINSMLMGSG |
| Ga0210397_103448063 | 3300021403 | Soil | VSRQTAAVLALDSYPVSHGPTGSVDKIRLERVVNVMQQFIGFPKFNIDTMLMPGA |
| Ga0210394_109341982 | 3300021420 | Soil | AGRVDAVQLKRVVDVMQQFIGFGQAFNIDSMLMGGRSR |
| Ga0210390_105511651 | 3300021474 | Soil | PVTSGPVGTVDKDQLQRVVDVMQQYLGFDQNFNINSMLMNGGAGD |
| Ga0210398_103929411 | 3300021477 | Soil | KATAALMSVDEYPVSSGPVGTVDKDQLQRVVDVMQQYLGFDQNFNINSMLMNGG |
| Ga0224549_10140971 | 3300022840 | Soil | FITGPVGSVDKVQLERVVDVMQQFLGFDSSFNVNSMLTGG |
| Ga0207710_102214941 | 3300025900 | Switchgrass Rhizosphere | PVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG |
| Ga0207699_102848941 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMDG |
| Ga0207699_110060111 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG |
| Ga0207671_108821882 | 3300025914 | Corn Rhizosphere | TAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSADS |
| Ga0207663_104243961 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AVMALDSYPVSSGPAGSVDLVRLERVVNVMHQFLGFGTFNVKSMLMNG |
| Ga0207663_108382502 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PVSSGPAGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMDG |
| Ga0207700_101658063 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDIGSMLMGSASTAGG |
| Ga0207700_117954761 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSGPVGSVDLVRLERVVNVMHQFLGFGTFDVKSMLMNG |
| Ga0207664_100443231 | 3300025929 | Agricultural Soil | YPVSTRPVGSVDKIRLQRVVDVMRQFLGFGQFDIGSMLMGSASSADS |
| Ga0207664_101709071 | 3300025929 | Agricultural Soil | LDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAGG |
| Ga0207690_112005252 | 3300025932 | Corn Rhizosphere | TAAVMALDSYPVSTGPVGSVDKIRLQGVVDVMRQFLGFGDFDTGSMLMGSASTAGG |
| Ga0207702_103304573 | 3300026078 | Corn Rhizosphere | GPPGSVDKIRLQRVVDVMRRFLKLPAFDISSMLLGSR |
| Ga0209839_100012455 | 3300026294 | Soil | MSLSAYPVSPGPVGSVDKIRLRRVVNLMQQFIGLPAFNIDSMLMRG |
| Ga0179587_111441471 | 3300026557 | Vadose Zone Soil | KIRLQRVVDVMRQFPGLGKFDIGSMLMGSASSAGG |
| Ga0209116_10532852 | 3300027590 | Forest Soil | GPVGTVDKIRLQRVVNVMREFLGFDPSFNINSVLLNAGR |
| Ga0208827_10436652 | 3300027641 | Peatlands Soil | MALDSYPFSNGPVGSVDQVRLQRVVDVMQQFLGFPKFDIGSMLMGNG |
| Ga0209177_103140821 | 3300027775 | Agricultural Soil | QSYPVSTGPAGSVDKVRLQRVADAMHQFIGFPAFSIDSMLMGG |
| Ga0268266_100909543 | 3300028379 | Switchgrass Rhizosphere | GVSAETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGDFDTGSMLMGSASTAG |
| Ga0307317_103288001 | 3300028720 | Soil | MALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMGSASSAGG |
| Ga0302225_102141082 | 3300028780 | Palsa | TKTTAALMSVDQYPVTSGPVGTVDKLQLQRVVSVMQQFLGFDPSFNIDSMLINGG |
| Ga0307282_100838011 | 3300028784 | Soil | LDTYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMGSASSADD |
| Ga0302232_101015372 | 3300028789 | Palsa | AEAALMSVDEYPVSSGPVGTVDKIRLQRVVNVMQQFLGFDPSFNIDSMLINGG |
| Ga0307312_105550132 | 3300028828 | Soil | VSAETAAVMALDSYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMGSASSAGG |
| Ga0307312_110716831 | 3300028828 | Soil | VGSVDKIRLQRIVNVMQQFIGFPKFNIDTMLMPHT |
| Ga0302235_104903942 | 3300028877 | Palsa | PLGLNKVTAALMSVDEYPVGSGPVGTVDKIRLQRVVNVMQQFLGFDPSFNIDSMLINGG |
| Ga0302229_102328081 | 3300028879 | Palsa | GPVGTVDKIRLQRVVNVMQQFLGFDPSFKIDSMLMNGG |
| Ga0302304_103004871 | 3300029993 | Palsa | PATAALMSLDEYPVSSGPVGTVDKIRLQRVVNVMQQFLGFNQNFNIDSMLINGG |
| Ga0311339_106036832 | 3300029999 | Palsa | MSVDEYPVSSGPVGTVDKVRLQRVVNVMQQFLGFDQNFNIDSMLINGG |
| Ga0302181_102763741 | 3300030056 | Palsa | PVGTVDKVRLQRVVNVMQQFLGFDQNFNIDSMLINGG |
| Ga0302179_103122601 | 3300030058 | Palsa | RPVGTVDKDQLQRVVNVMQQYLGFDPNFNINSMLVNGG |
| Ga0311353_106693572 | 3300030399 | Palsa | ITGPVGSVDKVQLERVVDVMQQFLGFDSSFNVNSMLTGG |
| Ga0302184_101370811 | 3300030490 | Palsa | SVDEYPVSSGPVGTVDKVRLQRVVNVMQQFLGFDPSFNIGSMLMNGG |
| Ga0310037_103089272 | 3300030494 | Peatlands Soil | NGGQLGSVDKVRLQRVVDAMQQFLGFESSFNINSMLTGG |
| Ga0311372_109743672 | 3300030520 | Palsa | PAPLGLSKETAALMSVDEYPVTSGLVGTVDKDQLQRVVDVMQQYLGFDQNFNINSMLMNG |
| Ga0311372_121348882 | 3300030520 | Palsa | GLMSLDEYPVSTGGVGDVDQISLQRVVDVMQQFIGFDPSFKVSTMLMGGR |
| Ga0311357_106869142 | 3300030524 | Palsa | SKQTAALMSLDEYPVSSGPVGTVDKAQLQRVVNVMQQFLGFDQNFNIDSMLVKGG |
| Ga0302308_102113462 | 3300031027 | Palsa | EAALMSVDEYPVSSGPVGTVDKIRLQRVVNVMQQFLGFDPSFNIDSMLINGG |
| Ga0302180_105643912 | 3300031028 | Palsa | LSKQTAALMSLDEYPVSSGPVGTVDKAQLQRVVNVMQQFLGFDQNFNIDSMLVKGG |
| Ga0170819_152182073 | 3300031469 | Forest Soil | VSHGPAGSVDKVRLQRVADVMHQFLGFPKFGIDLMLMDSGAGLG |
| Ga0170819_154492141 | 3300031469 | Forest Soil | TAAVMALDSYPVSDGPPGSVDRVRLQRVVDVMHQFLGFPTFDIGSMLMGSASSAGG |
| Ga0302326_113824031 | 3300031525 | Palsa | TSGLVGTVDKDQLQRVVDVMQQYLGFDQNFNINSMLMNGG |
| Ga0318534_106144081 | 3300031544 | Soil | VLALDSYPVSHGPVGSVDRIRLERVVNVMQQFIKFPTFDIDTMLMNSG |
| Ga0318573_101055761 | 3300031564 | Soil | ESYPVSTGPAGSVDTVQLRRVVDVMQQFIGFGPSFSIDSMLMGG |
| Ga0318573_102494931 | 3300031564 | Soil | GLPRSTAAIMSLESYPVSPGPVGSVDAVRLQRVVDVMRQFIGFPPFNVDSMLMGG |
| Ga0318572_104370712 | 3300031681 | Soil | FSTSSLDTVDKVRLQRVVDVMQQFLKFDSAFNINSMLTGG |
| Ga0307474_102192852 | 3300031718 | Hardwood Forest Soil | GVSRQTAAVLALDSYPVSHGPAGSVDKIRLERVVNVMQQFIGFPKFNIDSMLMPGT |
| Ga0306917_102639511 | 3300031719 | Soil | SYPVSPGPVGSVDPVRVQRVVDVMRQFIGFPPFSIDSMLMGG |
| Ga0306917_105641191 | 3300031719 | Soil | PVSTGPVGSVDQVRLQRVVDVMQQFLGFGKFDIDSMLMGSG |
| Ga0318493_105360762 | 3300031723 | Soil | GLPRTTAAVMCLESYPVSSGPVGSVDPVRLQRVVDVMRQFIGFPPFGIGSMLMHG |
| Ga0318501_101416733 | 3300031736 | Soil | HGLLGTVDKVRLQRVVDVMQQFLKFNSSFNINSMLVGG |
| Ga0318494_100770672 | 3300031751 | Soil | TAIMCLESYPVSPGPVGSVDPVRVQRVVDVMRQFIGFPPFSIDSMLMGG |
| Ga0318546_112783812 | 3300031771 | Soil | YLVSHGPVGSVDRIRLERVVNVMQQFIKFPKFDIDTMLMNSG |
| Ga0318552_104188951 | 3300031782 | Soil | PKETAALISLDSYPVSTGPVGSVDMAQLKRVVDIMQRFLGFNKAFNIDSMLMGG |
| Ga0318523_104313372 | 3300031798 | Soil | EAVGSVDAARLQSEVDLMQQFLGFPSFNINSMLMGG |
| Ga0318497_100028861 | 3300031805 | Soil | PVGRVDKVRLQRVVDVMRQFLRFPKFDIDSMLMGSG |
| Ga0318497_103042672 | 3300031805 | Soil | GLPRVTAAIMSLESYPVSAGLAGSVDTERLRRVVDVMQQFIGFDPSFNIDSMLMGG |
| Ga0318511_104189381 | 3300031845 | Soil | LALDSYPVSHGPVGSVDRIRLERVVNVMQQFIKFPKFDIDTMLMNSG |
| Ga0318495_102512891 | 3300031860 | Soil | VMCLESYPVSSGPVGSVDPVRLQRVVDVMRQFIGFPPFGIGSMLMHG |
| Ga0318495_103883371 | 3300031860 | Soil | PPGGVDKVRLQRVVEVMQQFLKFDSAFNINSMLLGG |
| Ga0306925_110405511 | 3300031890 | Soil | PRPLGLPRSTTAIMCLESYPVSPGPVGSVDPVRVQRVVDVMRQFIGFPPFSIDSMLMGG |
| Ga0306925_115957581 | 3300031890 | Soil | GLPRDTAAVMSLESYPVSTGPAGSVDTEQLRRVVDVMQQFIGFGPSFSIDSMLMGG |
| Ga0318551_100412911 | 3300031896 | Soil | PVGSVDKVRLQRVVDVMQQFLQFPRFDIGSMLRSSG |
| Ga0308174_102155303 | 3300031939 | Soil | VSAETAALMALDSYPVSTGPPGSVDKVRLQRVVDVMRQFLNSPAFNISSMLMRNGRGGPT |
| Ga0310910_105742541 | 3300031946 | Soil | PVGSVDMAQLKRVVDIMQRFLGFNRAFNIDSMLMGG |
| Ga0318530_100929171 | 3300031959 | Soil | AGSVDTKRLRRVVDVMQQFIGFDPSFNIDSMLMGG |
| Ga0318562_104124552 | 3300032008 | Soil | LGLPRVTAAIMSLESYPVSAGLAGSVDTERLRRVVDVMQQFIGFDPSFNIDSMLMGG |
| Ga0318505_102087111 | 3300032060 | Soil | STGPAGSVDTEQLRHVVDVMQEFLGFDRAFNIDSMLMGG |
| Ga0318510_100330311 | 3300032064 | Soil | GVSAETAAVMALDSYPVGTGPVGRVDKVRLQRVVDVMRQFLRFPKFDIDSMLMGSG |
| Ga0318513_102721851 | 3300032065 | Soil | PRDTAAVMSLESYPVSTGPAGSVDTEQLRRVVDVMQQFIGFDPSFNIDSMLMGG |
| Ga0318514_101321953 | 3300032066 | Soil | LDSYPVSTGPVGSVDMAQLKRVVDIMQRFLGFNRAFNIDSMLMGG |
| Ga0318524_104250932 | 3300032067 | Soil | TGSLDSVDKIWLQRVVDVMQQFLKFDSAFNINSMLTGG |
| Ga0318553_101571061 | 3300032068 | Soil | RQTAAVLALDSYPVSHGPVGSVDRIRLERVVNVMQQFIKFPKFDIDTMLMNSG |
| Ga0318553_104326191 | 3300032068 | Soil | NYPFTSRPLGTVDKVRLQRVVDVMQQFLKFNSSFNINSMLVGG |
| Ga0311301_101820444 | 3300032160 | Peatlands Soil | MGLDSYPVSTGPVGSVDKIRLQRVVNVMQQFIGFPSFNIDSMLMGSG |
| Ga0311301_108243461 | 3300032160 | Peatlands Soil | DSYPVSTGPVGSVDKIRLQRVVDVMQQFIGFPSFNIDSMLMGSG |
| Ga0311301_114464201 | 3300032160 | Peatlands Soil | STGPAGSVDTVQLKRVVDVMQQFIGLGQAFNIDSMLMGG |
| Ga0311301_127655811 | 3300032160 | Peatlands Soil | FSTGPVGTVDTIQLQRVVNVMQQFLMIPKFNIDSMLLTG |
| Ga0307472_1017476201 | 3300032205 | Hardwood Forest Soil | GPAGSVDKIRLQRVVDVMRQFLGFGKFDIGTMLMSSAPSAGG |
| Ga0335085_101598291 | 3300032770 | Soil | GSVDKIRLQRVADVMRRFLGFGKFDIGSMLMASASSAGG |
| Ga0335085_111276391 | 3300032770 | Soil | SLESYPVSTGPAGSVDTAQLKRVVDVMQQFIGFDQAFNIDSMLMGG |
| Ga0335078_106825073 | 3300032805 | Soil | VQTAAVMALDSYPVSTGPPGSVDQVRLQRVADFMRRFLRLPAFSVTSMLMNGGSG |
| Ga0335078_108593362 | 3300032805 | Soil | GPVGSVDKVRLQRVVDVMQQFLAFGKFDIDSMLMGRG |
| Ga0335078_126275252 | 3300032805 | Soil | PVSDGPVGSVDKLRLERVVNVMQQFLGFPKFDVDSMLMKSG |
| Ga0335080_100912081 | 3300032828 | Soil | YPVSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMGSAPSADR |
| Ga0335081_111023592 | 3300032892 | Soil | APFGVSKATAAVLALDRYPVSNGPVGTVDKVRLQRVVNAMQQFLGFPSFNVGSMLLNGG |
| Ga0335069_1000164920 | 3300032893 | Soil | MSLESYPVSTGPAGSVDTAQLKRVVDVMQQFIGFDQAFNIDSMLMGG |
| Ga0335074_110869102 | 3300032895 | Soil | YPTGSVDKIRLQRVVEVMQQFLGFDSSFNINSMLTGG |
| Ga0335075_102241553 | 3300032896 | Soil | SYPVSAGPPGTVDVVRLQRVVDVMRQFLHFGKFDLASMLIGQGHPAQG |
| Ga0335075_113677161 | 3300032896 | Soil | GPNDSVDEVRLQRVVDVMQQFLGFDSSFNINTMLTGG |
| Ga0335077_100982194 | 3300033158 | Soil | DTYPVSTGPVGSVDKIRLQRVVDVMRQFLGFGKFDIGSMLMGSAPSADR |
| Ga0318519_101975932 | 3300033290 | Soil | PFSSGPVGSVDKVRLQRVVDVMQQFLQFPRFDIGSMLRSSG |
| ⦗Top⦘ |