Basic Information | |
---|---|
Family ID | F024600 |
Family Type | Metagenome |
Number of Sequences | 205 |
Average Sequence Length | 43 residues |
Representative Sequence | RNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 205 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.41 % |
% of genes near scaffold ends (potentially truncated) | 89.76 % |
% of genes from short scaffolds (< 2000 bps) | 93.66 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.122 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.268 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.317 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.683 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 205 Family Scaffolds |
---|---|---|
PF00816 | Histone_HNS | 5.37 |
PF04392 | ABC_sub_bind | 3.90 |
PF06411 | HdeA | 1.46 |
PF00872 | Transposase_mut | 1.46 |
PF13683 | rve_3 | 1.46 |
PF13676 | TIR_2 | 1.46 |
PF01527 | HTH_Tnp_1 | 0.98 |
PF13442 | Cytochrome_CBB3 | 0.98 |
PF13649 | Methyltransf_25 | 0.98 |
PF10431 | ClpB_D2-small | 0.49 |
PF07883 | Cupin_2 | 0.49 |
PF11026 | DUF2721 | 0.49 |
PF01381 | HTH_3 | 0.49 |
PF03721 | UDPG_MGDP_dh_N | 0.49 |
PF00144 | Beta-lactamase | 0.49 |
PF00589 | Phage_integrase | 0.49 |
PF03404 | Mo-co_dimer | 0.49 |
PF13333 | rve_2 | 0.49 |
PF06078 | DUF937 | 0.49 |
PF00155 | Aminotran_1_2 | 0.49 |
PF04075 | F420H2_quin_red | 0.49 |
PF00581 | Rhodanese | 0.49 |
PF00196 | GerE | 0.49 |
PF13458 | Peripla_BP_6 | 0.49 |
PF00550 | PP-binding | 0.49 |
COG ID | Name | Functional Category | % Frequency in 205 Family Scaffolds |
---|---|---|---|
COG2916 | DNA-binding protein H-NS | Transcription [K] | 5.37 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.90 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.46 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.49 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.49 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.49 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.49 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.49 |
COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.12 % |
Unclassified | root | N/A | 4.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000580|AF_2010_repII_A01DRAFT_1045158 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 679 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10001937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5412 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1081444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1020705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1048632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
3300000955|JGI1027J12803_100430438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
3300000955|JGI1027J12803_100740678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300000955|JGI1027J12803_101657802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300004479|Ga0062595_102150601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
3300005093|Ga0062594_101681258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
3300005162|Ga0066814_10108461 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005332|Ga0066388_101147529 | Not Available | 1322 | Open in IMG/M |
3300005332|Ga0066388_106859106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
3300005436|Ga0070713_100638377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1013 | Open in IMG/M |
3300005467|Ga0070706_100104678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2632 | Open in IMG/M |
3300005471|Ga0070698_100968535 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300005557|Ga0066704_10299344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1087 | Open in IMG/M |
3300005557|Ga0066704_10872030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
3300005561|Ga0066699_11285992 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005575|Ga0066702_10966170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
3300005587|Ga0066654_10539473 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005713|Ga0066905_101469204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
3300005764|Ga0066903_101611673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1231 | Open in IMG/M |
3300005764|Ga0066903_101798827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1170 | Open in IMG/M |
3300005764|Ga0066903_101953730 | Not Available | 1125 | Open in IMG/M |
3300005764|Ga0066903_102166143 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300005764|Ga0066903_103303313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
3300005764|Ga0066903_103565339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 838 | Open in IMG/M |
3300005764|Ga0066903_103903151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 800 | Open in IMG/M |
3300005764|Ga0066903_104247221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
3300005764|Ga0066903_105053398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
3300005764|Ga0066903_105522762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
3300005764|Ga0066903_107413378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
3300005764|Ga0066903_108309485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
3300005764|Ga0066903_108443429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
3300005764|Ga0066903_108498203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300005764|Ga0066903_108833571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
3300006028|Ga0070717_10394465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1242 | Open in IMG/M |
3300006028|Ga0070717_10518913 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300006028|Ga0070717_10645764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12 | 960 | Open in IMG/M |
3300006028|Ga0070717_12076865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
3300006175|Ga0070712_101693298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300006797|Ga0066659_10074201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2235 | Open in IMG/M |
3300006903|Ga0075426_10334672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1111 | Open in IMG/M |
3300006969|Ga0075419_10868642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300007076|Ga0075435_100706234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12 | 877 | Open in IMG/M |
3300009137|Ga0066709_102282483 | Not Available | 743 | Open in IMG/M |
3300009147|Ga0114129_12369871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
3300009162|Ga0075423_10151635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2434 | Open in IMG/M |
3300010043|Ga0126380_10246560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1233 | Open in IMG/M |
3300010046|Ga0126384_10032008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3502 | Open in IMG/M |
3300010046|Ga0126384_10701887 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300010046|Ga0126384_11656390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
3300010047|Ga0126382_10829749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
3300010047|Ga0126382_11519549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300010048|Ga0126373_10793564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1009 | Open in IMG/M |
3300010048|Ga0126373_11437913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
3300010335|Ga0134063_10507251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12 | 604 | Open in IMG/M |
3300010358|Ga0126370_11711780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300010361|Ga0126378_11140516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
3300010361|Ga0126378_12809450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300010361|Ga0126378_13007153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300010361|Ga0126378_13448677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300010362|Ga0126377_10912226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 942 | Open in IMG/M |
3300010376|Ga0126381_100350223 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
3300010376|Ga0126381_103785758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
3300010398|Ga0126383_11659725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
3300010863|Ga0124850_1078842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 985 | Open in IMG/M |
3300011003|Ga0138514_100005051 | Not Available | 1929 | Open in IMG/M |
3300012096|Ga0137389_11554499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
3300012202|Ga0137363_10255447 | Not Available | 1425 | Open in IMG/M |
3300012202|Ga0137363_10779007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
3300012204|Ga0137374_10683471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
3300012212|Ga0150985_105226194 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300012353|Ga0137367_10702970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
3300012469|Ga0150984_102718057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1223 | Open in IMG/M |
3300012469|Ga0150984_121467963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
3300012532|Ga0137373_10731735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
3300012937|Ga0162653_100011246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
3300012939|Ga0162650_100016421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1025 | Open in IMG/M |
3300012957|Ga0164303_11070092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
3300012987|Ga0164307_11734985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300012989|Ga0164305_10408031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1042 | Open in IMG/M |
3300014325|Ga0163163_10827557 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300014969|Ga0157376_10568475 | Not Available | 1124 | Open in IMG/M |
3300015371|Ga0132258_13754616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1035 | Open in IMG/M |
3300016270|Ga0182036_11611071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
3300016294|Ga0182041_12092601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
3300016319|Ga0182033_10479089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1066 | Open in IMG/M |
3300016319|Ga0182033_10742756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 861 | Open in IMG/M |
3300016319|Ga0182033_11532808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
3300016341|Ga0182035_10147596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1801 | Open in IMG/M |
3300016357|Ga0182032_10079076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2252 | Open in IMG/M |
3300016357|Ga0182032_10135225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1801 | Open in IMG/M |
3300016357|Ga0182032_10412612 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300016404|Ga0182037_11375413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300016422|Ga0182039_10152726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1790 | Open in IMG/M |
3300016422|Ga0182039_10391687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1177 | Open in IMG/M |
3300016422|Ga0182039_11329961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
3300016422|Ga0182039_11812343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300016445|Ga0182038_10252617 | Not Available | 1418 | Open in IMG/M |
3300016445|Ga0182038_10359073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1209 | Open in IMG/M |
3300016445|Ga0182038_11091975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
3300016445|Ga0182038_11207507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300016445|Ga0182038_11405715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
3300018073|Ga0184624_10167864 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300018082|Ga0184639_10060363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1972 | Open in IMG/M |
3300018468|Ga0066662_10202122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1572 | Open in IMG/M |
3300018469|Ga0190270_10530062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1130 | Open in IMG/M |
3300021168|Ga0210406_10773210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 733 | Open in IMG/M |
3300021372|Ga0213877_10228133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
3300021405|Ga0210387_10562498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1014 | Open in IMG/M |
3300021478|Ga0210402_10317783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1443 | Open in IMG/M |
3300021560|Ga0126371_10780257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1102 | Open in IMG/M |
3300021560|Ga0126371_12247278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
3300022756|Ga0222622_10263063 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300025910|Ga0207684_10833431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium australiense | 778 | Open in IMG/M |
3300025915|Ga0207693_10040875 | All Organisms → cellular organisms → Bacteria | 3652 | Open in IMG/M |
3300025916|Ga0207663_11280958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
3300026035|Ga0207703_11770058 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300026088|Ga0207641_10401659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1316 | Open in IMG/M |
3300027646|Ga0209466_1126444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300027874|Ga0209465_10663290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300027909|Ga0209382_11559655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300028768|Ga0307280_10130996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411 | 855 | Open in IMG/M |
3300028828|Ga0307312_10821073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
3300031543|Ga0318516_10145810 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300031543|Ga0318516_10524976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300031544|Ga0318534_10852034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
3300031545|Ga0318541_10102971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1534 | Open in IMG/M |
3300031573|Ga0310915_10191109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1429 | Open in IMG/M |
3300031573|Ga0310915_10233851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1291 | Open in IMG/M |
3300031573|Ga0310915_10754622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 685 | Open in IMG/M |
3300031668|Ga0318542_10089735 | Not Available | 1469 | Open in IMG/M |
3300031679|Ga0318561_10392241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
3300031679|Ga0318561_10694775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 559 | Open in IMG/M |
3300031679|Ga0318561_10728805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
3300031682|Ga0318560_10380854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
3300031713|Ga0318496_10412962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
3300031713|Ga0318496_10779880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
3300031719|Ga0306917_10545080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 911 | Open in IMG/M |
3300031719|Ga0306917_11311677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 560 | Open in IMG/M |
3300031744|Ga0306918_10321745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1195 | Open in IMG/M |
3300031744|Ga0306918_10357431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1134 | Open in IMG/M |
3300031747|Ga0318502_10579510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
3300031748|Ga0318492_10016921 | All Organisms → cellular organisms → Bacteria | 3102 | Open in IMG/M |
3300031765|Ga0318554_10597582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 622 | Open in IMG/M |
3300031770|Ga0318521_10750832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
3300031770|Ga0318521_11049266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 500 | Open in IMG/M |
3300031781|Ga0318547_10498611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
3300031781|Ga0318547_10666240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
3300031781|Ga0318547_10908512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
3300031793|Ga0318548_10353126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
3300031794|Ga0318503_10072651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1072 | Open in IMG/M |
3300031796|Ga0318576_10217163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
3300031833|Ga0310917_10224572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1260 | Open in IMG/M |
3300031833|Ga0310917_10392431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 943 | Open in IMG/M |
3300031833|Ga0310917_10922165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
3300031879|Ga0306919_10039663 | All Organisms → cellular organisms → Bacteria | 3044 | Open in IMG/M |
3300031879|Ga0306919_10277891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1266 | Open in IMG/M |
3300031879|Ga0306919_10350552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1127 | Open in IMG/M |
3300031879|Ga0306919_11276902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300031879|Ga0306919_11469510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300031890|Ga0306925_10853392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 940 | Open in IMG/M |
3300031893|Ga0318536_10204136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1006 | Open in IMG/M |
3300031897|Ga0318520_11050983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
3300031910|Ga0306923_10590749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1247 | Open in IMG/M |
3300031910|Ga0306923_10991222 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300031910|Ga0306923_11629857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300031912|Ga0306921_12588477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
3300031941|Ga0310912_10317330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas harenae | 1207 | Open in IMG/M |
3300031941|Ga0310912_10393812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1078 | Open in IMG/M |
3300031945|Ga0310913_10784733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
3300031945|Ga0310913_10899804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
3300031945|Ga0310913_11127089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
3300031946|Ga0310910_10056887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2777 | Open in IMG/M |
3300031946|Ga0310910_10344697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1176 | Open in IMG/M |
3300031946|Ga0310910_10492025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → Defluviicoccus vanus | 973 | Open in IMG/M |
3300031946|Ga0310910_10703485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
3300031947|Ga0310909_10118994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2142 | Open in IMG/M |
3300031947|Ga0310909_11681637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300031954|Ga0306926_12577226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
3300031981|Ga0318531_10191815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 920 | Open in IMG/M |
3300032001|Ga0306922_10205866 | Not Available | 2111 | Open in IMG/M |
3300032001|Ga0306922_10835822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 960 | Open in IMG/M |
3300032001|Ga0306922_11902736 | Not Available | 582 | Open in IMG/M |
3300032043|Ga0318556_10448242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 675 | Open in IMG/M |
3300032051|Ga0318532_10217830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
3300032059|Ga0318533_10188039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium septicum | 1474 | Open in IMG/M |
3300032059|Ga0318533_10950479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
3300032059|Ga0318533_11109213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
3300032059|Ga0318533_11300177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300032063|Ga0318504_10177131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 990 | Open in IMG/M |
3300032063|Ga0318504_10353414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
3300032076|Ga0306924_10290042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1878 | Open in IMG/M |
3300032076|Ga0306924_10439755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1490 | Open in IMG/M |
3300032090|Ga0318518_10271453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
3300032091|Ga0318577_10397186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 659 | Open in IMG/M |
3300032091|Ga0318577_10436705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
3300032261|Ga0306920_101120945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1140 | Open in IMG/M |
3300033289|Ga0310914_10552772 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300033289|Ga0310914_11593825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300033289|Ga0310914_11792604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
3300033289|Ga0310914_11891342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300033551|Ga0247830_10454712 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.93% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.44% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.49% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A01DRAFT_10451583 | 3300000580 | Forest Soil | DLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
AF_2010_repII_A1DRAFT_100019379 | 3300000597 | Forest Soil | YNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSS* |
AF_2010_repII_A100DRAFT_10814443 | 3300000655 | Forest Soil | ALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKRN* |
AP72_2010_repI_A100DRAFT_10207052 | 3300000837 | Forest Soil | KRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
AP72_2010_repI_A100DRAFT_10486321 | 3300000837 | Forest Soil | GYYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
JGI1027J12803_1004304383 | 3300000955 | Soil | MIDLQTLEENLSKVTNFCSDEKNFKIPVMKAVEQVLGK* |
JGI1027J12803_1007406781 | 3300000955 | Soil | TLEDNVSKVKNYCYDEKNFKVPIMKAVETVLGKPSNPR* |
JGI1027J12803_1016578022 | 3300000955 | Soil | SGYYNAKRNNKIIDLEALEDNVSKVQNYCYDEKNFKVPIMKAVETVLGKSSNVR* |
Ga0062595_1021506011 | 3300004479 | Soil | NTRMIDLQTLEENLSKVTNYCSNEKNFKMPVMKAVEQVLGKQ* |
Ga0062594_1016812582 | 3300005093 | Soil | VAKNAKRNNRVIDLQSMEENMSKVQNYCNDEKNFKVPVMKAIEQVLGKTG* |
Ga0066814_101084611 | 3300005162 | Soil | NAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN* |
Ga0066388_1011475293 | 3300005332 | Tropical Forest Soil | KRNNRVLDLQTFEENMTKVTNFCSDEKNFKMPVMKAIEQVLGKSK* |
Ga0066388_1068591061 | 3300005332 | Tropical Forest Soil | YYNAKRNNKIIDLDTFEDNVSKVQSYCYEEKNFKVPIMKAVEQVLGGRK* |
Ga0070713_1006383771 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RNNRMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN* |
Ga0070706_1001046783 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0070698_1009685353 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066704_102993441 | 3300005557 | Soil | GYYNAKRNNRVIDLQSLEENMSKVTNYCSDEKNFKVPVMKGCRTGIG* |
Ga0066704_108720301 | 3300005557 | Soil | GYYNAKRNNRVIDLQSLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066699_112859921 | 3300005561 | Soil | MKRASRFNAKRNNRMIDQQALDENMSKVKNYCSDEKNFKVPVMKAVEQ |
Ga0066702_109661701 | 3300005575 | Soil | NAKRNNRVIDLQTFEENMSKVTNFCSDERNFKVPVMKAVEQVLGK* |
Ga0066654_105394732 | 3300005587 | Soil | MKRASRFNAKRNNRMIDQQALDENMSKVKNYCSDEKNFKVPVMKAVEQV |
Ga0066905_1014692041 | 3300005713 | Tropical Forest Soil | SAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066903_1016116731 | 3300005764 | Tropical Forest Soil | GYYSAKRNTRVIDLQSLEEKLSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066903_1017988273 | 3300005764 | Tropical Forest Soil | ISGYYHAKHNNRTLDLQAFEDNMNKVESYCSDEKNSKVPVMQAVERVLGISLDR* |
Ga0066903_1019537304 | 3300005764 | Tropical Forest Soil | YHAKHNNRTLDLQAFEDNMNKVESYCSDEKNSKVPVMEAVERVLGISLAK* |
Ga0066903_1021661433 | 3300005764 | Tropical Forest Soil | IDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066903_1033033133 | 3300005764 | Tropical Forest Soil | VIDLQTFEENMSKVMNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066903_1035653393 | 3300005764 | Tropical Forest Soil | KRNNRVIDLQTFEENMSKVTNFCSDEKNFKMPVMKAVEQVLGKSN* |
Ga0066903_1039031511 | 3300005764 | Tropical Forest Soil | VIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSS* |
Ga0066903_1042472211 | 3300005764 | Tropical Forest Soil | NAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMNAVEQVLGKKSN* |
Ga0066903_1050533982 | 3300005764 | Tropical Forest Soil | YYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQALGKSK* |
Ga0066903_1055227621 | 3300005764 | Tropical Forest Soil | RNNRVIDLQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVY* |
Ga0066903_1074133782 | 3300005764 | Tropical Forest Soil | NAKRNNKIIDLDTFEDNVSKVQSYCYEEKNFKVPIMKAVEQVLGGRK* |
Ga0066903_1083094851 | 3300005764 | Tropical Forest Soil | DLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066903_1084434292 | 3300005764 | Tropical Forest Soil | RNNRVIDLQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066903_1084982031 | 3300005764 | Tropical Forest Soil | VIDLQSLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0066903_1088335711 | 3300005764 | Tropical Forest Soil | RVIDLQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKRN* |
Ga0070717_103944654 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YYNAKRNNRMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN* |
Ga0070717_105189133 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YNAKRNNRMIDLQTFEENLSKVTNFCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0070717_106457641 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AKRNNRVIDLQSLEENMSKVTNYCSDEKNFKVPVMKAVERVLGNKSN* |
Ga0070717_120768651 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GYYNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0070712_1016932981 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IDLQTFEENMSKVQNFCSDEKNFKVPVMKAVEQVLGKGN* |
Ga0066659_100742016 | 3300006797 | Soil | FEENMSKVTNYCSDEKNFKVPVMRAVEQVLGKSN* |
Ga0075426_103346723 | 3300006903 | Populus Rhizosphere | RNNRVIDLQTFEENMSKVQNFCSDEKNFKVPVMKAVEQVLGKGN* |
Ga0075419_108686422 | 3300006969 | Populus Rhizosphere | VIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKGN* |
Ga0075435_1007062342 | 3300007076 | Populus Rhizosphere | ALEENMSKVTNYCSDEKNFKVPVMKAVEQALGNKSN* |
Ga0066709_1022824831 | 3300009137 | Grasslands Soil | MSGRAGSGYYYNAKRNNLMVDLQTLEENATKVQNYCYDEKNFKVPVMKAVERVLGGRR* |
Ga0114129_123698712 | 3300009147 | Populus Rhizosphere | IDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0075423_101516351 | 3300009162 | Populus Rhizosphere | VLDLQSFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKGN* |
Ga0126380_102465603 | 3300010043 | Tropical Forest Soil | RVIDLQTFEENLSKVTNYCYDEKNFKVPVMKAVEQVLGKSN* |
Ga0126384_100320088 | 3300010046 | Tropical Forest Soil | AKRNNRVIDLQTLEENMSKVNNYCSDEKNFKVPVMKAVEQVLGKRN* |
Ga0126384_107018871 | 3300010046 | Tropical Forest Soil | RVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0126384_116563901 | 3300010046 | Tropical Forest Soil | NNRIVDLQALEENMNKVQNYCYDEKNFKVPVMKAVETVLGK* |
Ga0126382_108297493 | 3300010047 | Tropical Forest Soil | LSGYYNAKRNNRIVDLQALEENMNKVQNYCYDEKNFKVPVMKAVEQVLGK* |
Ga0126382_115195491 | 3300010047 | Tropical Forest Soil | NRVIDLQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0126373_107935643 | 3300010048 | Tropical Forest Soil | VIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0126373_114379131 | 3300010048 | Tropical Forest Soil | NRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0134063_105072511 | 3300010335 | Grasslands Soil | LEENMSKVTNYCSDEKNFKVPVMKAVEQALGNKSN* |
Ga0126370_117117801 | 3300010358 | Tropical Forest Soil | HNNRTLDLQAFEENVSKVESYCSDEKNSKVPVMEAVERVLSISLDK* |
Ga0126378_111405162 | 3300010361 | Tropical Forest Soil | VIDLQTLEENMSKVTNYCSDEKNFNVPVMKAAGIG* |
Ga0126378_128094501 | 3300010361 | Tropical Forest Soil | IDLQTFEENMSKVTNFCSDEKNFKMPVMKAVEQVLGKSN* |
Ga0126378_130071532 | 3300010361 | Tropical Forest Soil | LQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0126378_134486771 | 3300010361 | Tropical Forest Soil | QALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0126377_109122261 | 3300010362 | Tropical Forest Soil | YNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMRAVEQVLGKSN* |
Ga0126381_1003502234 | 3300010376 | Tropical Forest Soil | VIDLQTLEENMGEMKNYCSDEKNFNVPVMKPVEQVLGKSN* |
Ga0126381_1037857581 | 3300010376 | Tropical Forest Soil | LEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKRN* |
Ga0126383_116597252 | 3300010398 | Tropical Forest Soil | RVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSKSVD* |
Ga0124850_10788421 | 3300010863 | Tropical Forest Soil | VIDLQTFEENMSKVTSYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0138514_1000050512 | 3300011003 | Soil | LDENVSKVKNYCSDEKNFKVPVMKAVEQVLGKGK* |
Ga0137389_115544992 | 3300012096 | Vadose Zone Soil | RNNRVIDLQSLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGNKSN* |
Ga0137363_102554472 | 3300012202 | Vadose Zone Soil | YNAKRNNRIIDLQTLEENVSKLQNYCYDEKNFKVPVMKAVEQVLSGPK* |
Ga0137363_107790072 | 3300012202 | Vadose Zone Soil | LEENMSKVTNYCSDEKNFKVPVMNAVEQVLGGRK* |
Ga0137374_106834712 | 3300012204 | Vadose Zone Soil | DLQTLEENATKVQNYCSDEKNFKVPVMKAVERVLGGRK* |
Ga0150985_1052261943 | 3300012212 | Avena Fatua Rhizosphere | VIDLQTLEDNMSKVKNYCSDEKNSKAPVMKAVGQVLGKNN* |
Ga0137367_107029702 | 3300012353 | Vadose Zone Soil | GYYNAKRNNVMVDLQTLEENATKVQNYCYDEKNFKVPVMKAVERVLGGRK* |
Ga0150984_1027180572 | 3300012469 | Avena Fatua Rhizosphere | MLDDNMSKVKNYCSDEKNFKVPVMKAVENVLGKSK* |
Ga0150984_1214679633 | 3300012469 | Avena Fatua Rhizosphere | MSGYYSAKRNNRMVDLQALEDNASKLQNYCYDEKNFKVPVMKAVEELFGGRKK* |
Ga0137373_107317352 | 3300012532 | Vadose Zone Soil | YNAKRNNSIIDLQTLEENVSKLQNHCYDEKNFKVPVMKAVEQVLGGRK* |
Ga0162653_1000112461 | 3300012937 | Soil | VAQWNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKGN* |
Ga0162650_1000164211 | 3300012939 | Soil | VAQWNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0164303_110700922 | 3300012957 | Soil | YNAKRNNRVIDLQMLDDNMSKVKNYCSDEKNFKVPVMKAVENVLGKSK* |
Ga0164307_117349852 | 3300012987 | Soil | MIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN* |
Ga0164305_104080311 | 3300012989 | Soil | RVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN* |
Ga0163163_108275571 | 3300014325 | Switchgrass Rhizosphere | NRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN* |
Ga0157376_105684752 | 3300014969 | Miscanthus Rhizosphere | ALEDNLSKVKNYCSDEKNGKVALMKAVENILGKKK* |
Ga0132258_137546161 | 3300015371 | Arabidopsis Rhizosphere | ILDLQVFEENMSKVTNFCSDEKNFKVPVMKAVEQVLGKSK* |
Ga0182036_116110712 | 3300016270 | Soil | AKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN |
Ga0182041_120926012 | 3300016294 | Soil | NNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKNN |
Ga0182033_104790892 | 3300016319 | Soil | LSGYYNAKRNNRVIDLQALEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0182033_107427561 | 3300016319 | Soil | QALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN |
Ga0182033_115328081 | 3300016319 | Soil | LQTLEENMSNVTNYCSDGKNFKVPVMKAVEQVLGKSN |
Ga0182035_101475961 | 3300016341 | Soil | RNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN |
Ga0182032_100790765 | 3300016357 | Soil | NAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN |
Ga0182032_101352256 | 3300016357 | Soil | ISGYYHAKHNNRTLDLQAFEENMNKVQSYCSDEKNSKVSVIEAVERVLGLSLDK |
Ga0182032_104126124 | 3300016357 | Soil | NLQALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN |
Ga0182037_113754132 | 3300016404 | Soil | YYNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN |
Ga0182039_101527265 | 3300016422 | Soil | RVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN |
Ga0182039_103916871 | 3300016422 | Soil | AKRNNQVIDLQTFEENMSKVMNYCSDEKNFKVPVMKAVERVLGKGN |
Ga0182039_113299611 | 3300016422 | Soil | RVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK |
Ga0182039_118123431 | 3300016422 | Soil | LSGYYNAQRNNRIVDLQALEENMNKVKNYCYDEKNFKVPVMKAVEQVLGGRK |
Ga0182038_102526171 | 3300016445 | Soil | RNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKRN |
Ga0182038_103590732 | 3300016445 | Soil | AKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0182038_110919751 | 3300016445 | Soil | QDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK |
Ga0182038_112075071 | 3300016445 | Soil | YHAKRNNRTLDLQAFEENMNKVQNYCYDEKNSKVPIMEAVERVLDK |
Ga0182038_114057153 | 3300016445 | Soil | VIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN |
Ga0184624_101678641 | 3300018073 | Groundwater Sediment | MLDDNMSKVKNYCNDEKNFKVPVMKAVENVLGKSK |
Ga0184639_100603631 | 3300018082 | Groundwater Sediment | MLDDNMSKVKNYCSDEKNFKVPVMKAVENVLGKSK |
Ga0066662_102021221 | 3300018468 | Grasslands Soil | MKRASRFNAKRNNRMIDQQALDENMSKVKNYCSDEKNFKVPVA |
Ga0190270_105300621 | 3300018469 | Soil | NNRVIDLETLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0210406_107732102 | 3300021168 | Soil | RNNRMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN |
Ga0213877_102281332 | 3300021372 | Bulk Soil | QDSAVAQDNVSKLTNYCYNEKNFKVPIMKAVEQVLGGRK |
Ga0210387_105624981 | 3300021405 | Soil | TFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN |
Ga0210402_103177832 | 3300021478 | Soil | VIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0126371_107802571 | 3300021560 | Tropical Forest Soil | QALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0126371_122472781 | 3300021560 | Tropical Forest Soil | GYYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0222622_102630633 | 3300022756 | Groundwater Sediment | CVAQRNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN |
Ga0207684_108334312 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LQTLEENMSKVTNYCSDEKNFRVPVMKAVEQVLGKSN |
Ga0207693_100408751 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AKRNNRMIDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN |
Ga0207663_112809582 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IDLQTFEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKGN |
Ga0207703_117700581 | 3300026035 | Switchgrass Rhizosphere | QTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN |
Ga0207641_104016591 | 3300026088 | Switchgrass Rhizosphere | GYYNAKRNNRVIDLQMLDDNMSKVKNYCSVEKNFKAPVMKAVENVLGKSK |
Ga0209466_11264443 | 3300027646 | Tropical Forest Soil | NRIVDLQALEENMNKVQNYCYAEKNFKVPVMNAVETVLGK |
Ga0209465_106632901 | 3300027874 | Tropical Forest Soil | YNAKRNNRVIDLQTFEENMSKVMNYCSDEKNFKVPVMKAVERVLGKSN |
Ga0209382_115596551 | 3300027909 | Populus Rhizosphere | TLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0307280_101309962 | 3300028768 | Soil | LCEPRLSAAWLSGYYNAVLDLQTFEENMSKVTNFCSDEKNFKVPVMKAVEQILGK |
Ga0307312_108210732 | 3300028828 | Soil | GYYNAKRNNRVIDLQTLEDNMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318516_101458102 | 3300031543 | Soil | VIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318516_105249761 | 3300031543 | Soil | ALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN |
Ga0318534_108520341 | 3300031544 | Soil | YYSAKRNNRVIDLQALEENMSKVTNYCSDEKNLKVPVMKAVEQVLGKSN |
Ga0318541_101029711 | 3300031545 | Soil | AKRNNRVVDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310915_101911092 | 3300031573 | Soil | MQTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGGRK |
Ga0310915_102338513 | 3300031573 | Soil | VIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN |
Ga0310915_107546223 | 3300031573 | Soil | GYYNAKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318542_100897351 | 3300031668 | Soil | LEDNVSKVKNYCYDEKNFKVPIMKAVETVLGKSSNAR |
Ga0318561_103922411 | 3300031679 | Soil | VIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318561_106947751 | 3300031679 | Soil | DLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318561_107288051 | 3300031679 | Soil | YNAKRNNRIVDLQALEENMNKVQNYCYDEKNFKVPVMKAVEQVLGK |
Ga0318560_103808542 | 3300031682 | Soil | DLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLCKSN |
Ga0318496_104129621 | 3300031713 | Soil | YNAKRNNRVIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEHVLGKGN |
Ga0318496_107798801 | 3300031713 | Soil | YYNAKRNNRVIDLQTFEENMSEVTNDCSDEKNFKVPVMKAVEQVLGKRN |
Ga0306917_105450801 | 3300031719 | Soil | YNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0306917_113116772 | 3300031719 | Soil | DLQALEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0306918_103217453 | 3300031744 | Soil | KRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0306918_103574312 | 3300031744 | Soil | LSGYYNAKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318502_105795101 | 3300031747 | Soil | NAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSKSVD |
Ga0318492_100169211 | 3300031748 | Soil | SGYYNAKRNNKIVDLDTLEDNVSKVTNYCYDEKNFKVPIMKAVETVLGKSSNAR |
Ga0318554_105975823 | 3300031765 | Soil | QTLEENMSKVTNYCSDEKSFKVPVMKAVEQVLGKSN |
Ga0318521_107508321 | 3300031770 | Soil | YNAKRNNRVIDLQTLEENMSNVTNYCSDGKNFKVPVMKAVEQVLGKSN |
Ga0318521_110492662 | 3300031770 | Soil | RNNRVIDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318547_104986112 | 3300031781 | Soil | DLQTLEENMSNVTNYCSDGKNFKVPVMKAVEQVLGKSN |
Ga0318547_106662401 | 3300031781 | Soil | SGYYNAKRNNKIIDLETLEDNVSKVTNYCYDEKNFKVPIMKAIETVLGKSSNTR |
Ga0318547_109085121 | 3300031781 | Soil | NNRVIDLQALEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318548_103531263 | 3300031793 | Soil | SGYYHAKHNNRTLDLQAFEENMNKVQSYCSDEKNSKVSVIEAVERVLGLSLDK |
Ga0318503_100726513 | 3300031794 | Soil | AKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318576_102171631 | 3300031796 | Soil | YSAKRNNRVIDLQALEENMSKVTNYCSDEKNLKVPVMKAVEQVLGKSN |
Ga0310917_102245721 | 3300031833 | Soil | QTFEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310917_103924313 | 3300031833 | Soil | LQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310917_109221651 | 3300031833 | Soil | ALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN |
Ga0306919_100396631 | 3300031879 | Soil | YYNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0306919_102778911 | 3300031879 | Soil | HNNRTLDLQAFEENMNKVESYCSDEKNSKVPVMEAVERVLGNPSNPR |
Ga0306919_103505522 | 3300031879 | Soil | RNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0306919_112769021 | 3300031879 | Soil | VIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK |
Ga0306919_114695102 | 3300031879 | Soil | KRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN |
Ga0306925_108533922 | 3300031890 | Soil | KRNNRVIDLQALEENMSKVSNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318536_102041361 | 3300031893 | Soil | GYYNAKRNNRIVDLQALEENMNKVKNYCYDEKNFKVPVMKAVEQVLGERK |
Ga0318520_110509831 | 3300031897 | Soil | RVLDLQAFEENMNKVQNYCYDEKNLKVPVMEAVETVLGKPSNAR |
Ga0306923_105907491 | 3300031910 | Soil | TLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0306923_109912221 | 3300031910 | Soil | RNNRVINLQALEENMSKVMNYCSDEKNFKVPVMKAVEQLLGKSN |
Ga0306923_116298571 | 3300031910 | Soil | KRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK |
Ga0306921_125884771 | 3300031912 | Soil | LSGYYNAKRNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN |
Ga0310912_103173302 | 3300031941 | Soil | NNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSKSVD |
Ga0310912_103938121 | 3300031941 | Soil | IDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310913_107847331 | 3300031945 | Soil | RTLDLQAFEENMNKVESYCSDEKNSKVPVMEAVERVLGNPSNPR |
Ga0310913_108998043 | 3300031945 | Soil | RVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQVLGKSN |
Ga0310913_111270892 | 3300031945 | Soil | NAKRNNQVIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310910_100568871 | 3300031946 | Soil | AKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN |
Ga0310910_103446973 | 3300031946 | Soil | DLQALEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310910_104920253 | 3300031946 | Soil | HAKHNNRTLDLQAFEENMNKVQSYCSDEKNSKVSVIEAVERVLGLSLDK |
Ga0310910_107034851 | 3300031946 | Soil | SGYHNAKRNNRVIDLQTLEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310909_101189941 | 3300031947 | Soil | LQALEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310909_116816371 | 3300031947 | Soil | ILEENMSNVTNYCSDGKNFKVPVMKAVEQVLGKSN |
Ga0306926_125772261 | 3300031954 | Soil | VINLQALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN |
Ga0318531_101918151 | 3300031981 | Soil | LSGYYNAKRNNRIVDLQALEENMNKVKNYCYDEKNFKVPVMKAVEQVLGERK |
Ga0306922_102058661 | 3300032001 | Soil | LQALEENMSKVTNYCSDEKNFKVPVMKAVEQLLGKSN |
Ga0306922_108358222 | 3300032001 | Soil | KRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0306922_119027363 | 3300032001 | Soil | YNAKRNNKIVDLDTLEDNVSKVTNYCYDEKNFKVPIMKAVETVLGKSSNTR |
Ga0318556_104482421 | 3300032043 | Soil | NNRVIDLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318532_102178301 | 3300032051 | Soil | YNAKRNNRVIDLQTLEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSKSVD |
Ga0318533_101880391 | 3300032059 | Soil | RNNRVIDLQDLEEKMSKVTNYCSDEKNFKMPVMKAVEQILGERK |
Ga0318533_109504793 | 3300032059 | Soil | NAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN |
Ga0318533_111092132 | 3300032059 | Soil | SGYYNAKRNNKIIDLETLEDNVSKVTNYCYDEKNFKVPIMKAVETVLGKSSNTR |
Ga0318533_113001771 | 3300032059 | Soil | IDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318504_101771312 | 3300032063 | Soil | VIDLQALEENLSKVTNYCSDEKNFKVPVMKAVEQIFGKSN |
Ga0318504_103534141 | 3300032063 | Soil | ALEENMNKVKNYCYDEKNFKVPVMKAVEQVLGEHK |
Ga0306924_102900421 | 3300032076 | Soil | AKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN |
Ga0306924_104397554 | 3300032076 | Soil | YNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQILGKSN |
Ga0318518_102714532 | 3300032090 | Soil | RNNRVIDLQTLEENMSKVTNYCSDEKNLKVPVMKAVEQVLGKSN |
Ga0318577_103971861 | 3300032091 | Soil | DLQDLEEKMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0318577_104367053 | 3300032091 | Soil | LQALEENMSKVTNYCSDEKNFKVPVMKAVEQIFGKSN |
Ga0306920_1011209451 | 3300032261 | Soil | LDLQAFEENMNKVESYCSDEKNSKVPVMEAVERVLGNPSNPR |
Ga0310914_105527721 | 3300033289 | Soil | LDTFEDNVSKVQSYCYEEKNFKVPIMKAVEQVLGGRK |
Ga0310914_115938252 | 3300033289 | Soil | YNAKRNNRVIDLQALEENMSKVTNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310914_117926041 | 3300033289 | Soil | LQALEENMSKVKNYCSDEKNFKVPVMKAVEQVLGKSN |
Ga0310914_118913421 | 3300033289 | Soil | HAKRNDRNLDLQAFEENMTKVQNYCYDEKNFKVPVMEAVERVLGKPSNAR |
Ga0247830_104547123 | 3300033551 | Soil | LQTLEDNMSKVKNYCSDEKNFKVPVMKAVGQVLGKSN |
⦗Top⦘ |