| Basic Information | |
|---|---|
| Family ID | F024504 |
| Family Type | Metagenome |
| Number of Sequences | 205 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 205 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 68.29 % |
| % of genes near scaffold ends (potentially truncated) | 37.56 % |
| % of genes from short scaffolds (< 2000 bps) | 79.02 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (76.098 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.512 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.488 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.317 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.45% β-sheet: 0.00% Coil/Unstructured: 42.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 205 Family Scaffolds |
|---|---|---|
| PF06378 | DUF1071 | 8.29 |
| PF09588 | YqaJ | 4.88 |
| PF07120 | DUF1376 | 3.90 |
| PF04404 | ERF | 2.44 |
| PF13392 | HNH_3 | 0.98 |
| PF02767 | DNA_pol3_beta_2 | 0.98 |
| PF01381 | HTH_3 | 0.49 |
| PF00145 | DNA_methylase | 0.49 |
| PF01391 | Collagen | 0.49 |
| PF03237 | Terminase_6N | 0.49 |
| PF00182 | Glyco_hydro_19 | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 205 Family Scaffolds |
|---|---|---|---|
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 3.90 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.98 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.49 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.49 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.63 % |
| Unclassified | root | N/A | 5.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10229266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300001839|RCM40_1044231 | Not Available | 1342 | Open in IMG/M |
| 3300001842|RCM30_1073627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300001849|RCM26_1043049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300003277|JGI25908J49247_10015735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2308 | Open in IMG/M |
| 3300003277|JGI25908J49247_10046357 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300003393|JGI25909J50240_1001001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7153 | Open in IMG/M |
| 3300003394|JGI25907J50239_1044220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300003499|JGI25930J51415_1077355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300004240|Ga0007787_10689194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300005069|Ga0071350_1011490 | All Organisms → Viruses → Predicted Viral | 2072 | Open in IMG/M |
| 3300005527|Ga0068876_10400256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300005580|Ga0049083_10099519 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300005581|Ga0049081_10017141 | All Organisms → Viruses → Predicted Viral | 2743 | Open in IMG/M |
| 3300005581|Ga0049081_10054055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1518 | Open in IMG/M |
| 3300005581|Ga0049081_10139252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300005581|Ga0049081_10150317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300005581|Ga0049081_10170310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300005581|Ga0049081_10309843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300005582|Ga0049080_10147932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300005582|Ga0049080_10167982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300005582|Ga0049080_10184496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300005582|Ga0049080_10221867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300005583|Ga0049085_10202576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300006802|Ga0070749_10355271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300006805|Ga0075464_10165768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1303 | Open in IMG/M |
| 3300006805|Ga0075464_10194415 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300006805|Ga0075464_10386569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300006805|Ga0075464_10767152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300006805|Ga0075464_10769262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300006805|Ga0075464_10784448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300006805|Ga0075464_10886496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300007363|Ga0075458_10007547 | Not Available | 3480 | Open in IMG/M |
| 3300007363|Ga0075458_10039253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1497 | Open in IMG/M |
| 3300007636|Ga0102856_1032577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300007708|Ga0102859_1029439 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
| 3300007708|Ga0102859_1105395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300007735|Ga0104988_10258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12510 | Open in IMG/M |
| 3300007973|Ga0105746_1279067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300008107|Ga0114340_1076270 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
| 3300008107|Ga0114340_1136909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300008110|Ga0114343_1072265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1263 | Open in IMG/M |
| 3300008110|Ga0114343_1119475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300008111|Ga0114344_1068648 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300008259|Ga0114841_1100304 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300008259|Ga0114841_1144302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300008259|Ga0114841_1180706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300008261|Ga0114336_1039878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6419 | Open in IMG/M |
| 3300008262|Ga0114337_1080459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1579 | Open in IMG/M |
| 3300008266|Ga0114363_1055906 | All Organisms → Viruses → Predicted Viral | 1552 | Open in IMG/M |
| 3300008266|Ga0114363_1076767 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
| 3300008266|Ga0114363_1222890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300008267|Ga0114364_1114174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300008267|Ga0114364_1133542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300008267|Ga0114364_1140680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300008267|Ga0114364_1189912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300008448|Ga0114876_1019624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3541 | Open in IMG/M |
| 3300008448|Ga0114876_1097571 | All Organisms → Viruses → Predicted Viral | 1179 | Open in IMG/M |
| 3300008448|Ga0114876_1143198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300008448|Ga0114876_1160981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300008448|Ga0114876_1165551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300008448|Ga0114876_1178040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300008448|Ga0114876_1229295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300008448|Ga0114876_1236329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300008448|Ga0114876_1250045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300008450|Ga0114880_1067333 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
| 3300008450|Ga0114880_1115069 | Not Available | 1018 | Open in IMG/M |
| 3300008450|Ga0114880_1136400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300008450|Ga0114880_1250455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300009056|Ga0102860_1053310 | Not Available | 1091 | Open in IMG/M |
| 3300009151|Ga0114962_10015801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5426 | Open in IMG/M |
| 3300009152|Ga0114980_10636007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300009155|Ga0114968_10031959 | All Organisms → Viruses → Predicted Viral | 3515 | Open in IMG/M |
| 3300009158|Ga0114977_10007524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6914 | Open in IMG/M |
| 3300009158|Ga0114977_10437003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300009159|Ga0114978_10003677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12516 | Open in IMG/M |
| 3300009159|Ga0114978_10752647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300009163|Ga0114970_10059613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2439 | Open in IMG/M |
| 3300009163|Ga0114970_10371737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300009164|Ga0114975_10069225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2060 | Open in IMG/M |
| 3300009164|Ga0114975_10172381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
| 3300009164|Ga0114975_10499525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300009180|Ga0114979_10501131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300009180|Ga0114979_10557076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300009183|Ga0114974_10238265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1094 | Open in IMG/M |
| 3300009184|Ga0114976_10531018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300010157|Ga0114964_10038430 | All Organisms → Viruses → Predicted Viral | 2575 | Open in IMG/M |
| 3300010160|Ga0114967_10000748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27700 | Open in IMG/M |
| 3300011268|Ga0151620_1194371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300011268|Ga0151620_1262154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300011334|Ga0153697_1331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15205 | Open in IMG/M |
| 3300011995|Ga0153800_1023164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300012006|Ga0119955_1023612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2111 | Open in IMG/M |
| 3300012017|Ga0153801_1013949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
| 3300012663|Ga0157203_1057128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300013372|Ga0177922_10480756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300017707|Ga0181363_1089516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300017716|Ga0181350_1122199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300017722|Ga0181347_1141737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300017722|Ga0181347_1159573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300017723|Ga0181362_1023316 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300017747|Ga0181352_1074118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300017747|Ga0181352_1096348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300017754|Ga0181344_1022121 | All Organisms → Viruses → Predicted Viral | 1968 | Open in IMG/M |
| 3300017761|Ga0181356_1062841 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300017761|Ga0181356_1157679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300017766|Ga0181343_1060851 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300017774|Ga0181358_1189844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300017777|Ga0181357_1228307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300017777|Ga0181357_1254674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300017777|Ga0181357_1278992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300017778|Ga0181349_1033136 | Not Available | 2073 | Open in IMG/M |
| 3300017780|Ga0181346_1042928 | All Organisms → Viruses → Predicted Viral | 1847 | Open in IMG/M |
| 3300017784|Ga0181348_1028983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2334 | Open in IMG/M |
| 3300017784|Ga0181348_1284181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300017784|Ga0181348_1290074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300017784|Ga0181348_1308733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300017785|Ga0181355_1235711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300017785|Ga0181355_1328237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300018420|Ga0181563_10053157 | All Organisms → Viruses → Predicted Viral | 2847 | Open in IMG/M |
| 3300019784|Ga0181359_1093100 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300019784|Ga0181359_1202542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300019784|Ga0181359_1224810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300020549|Ga0207942_1009659 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300020549|Ga0207942_1014162 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300021438|Ga0213920_1002201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9542 | Open in IMG/M |
| 3300021438|Ga0213920_1009313 | All Organisms → Viruses → Predicted Viral | 3013 | Open in IMG/M |
| 3300021952|Ga0213921_1050478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300021961|Ga0222714_10086776 | All Organisms → Viruses → Predicted Viral | 2022 | Open in IMG/M |
| 3300021961|Ga0222714_10185181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
| 3300021961|Ga0222714_10526467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300021962|Ga0222713_10337083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300021962|Ga0222713_10808915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300021963|Ga0222712_10421421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300021963|Ga0222712_10438661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300022179|Ga0181353_1002686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3884 | Open in IMG/M |
| 3300022179|Ga0181353_1053848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
| 3300022190|Ga0181354_1007986 | All Organisms → Viruses → Predicted Viral | 2994 | Open in IMG/M |
| 3300022190|Ga0181354_1057281 | Not Available | 1296 | Open in IMG/M |
| 3300022407|Ga0181351_1148671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300022752|Ga0214917_10019572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5617 | Open in IMG/M |
| 3300023174|Ga0214921_10328513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300023184|Ga0214919_10001891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33604 | Open in IMG/M |
| 3300023184|Ga0214919_10160027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis flava | 1769 | Open in IMG/M |
| 3300023184|Ga0214919_10748932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300024289|Ga0255147_1000169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26470 | Open in IMG/M |
| 3300024346|Ga0244775_10905027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300025896|Ga0208916_10155730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300025896|Ga0208916_10388514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300027593|Ga0255118_1037319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
| 3300027608|Ga0208974_1006316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4013 | Open in IMG/M |
| 3300027608|Ga0208974_1020559 | All Organisms → Viruses → Predicted Viral | 2051 | Open in IMG/M |
| 3300027608|Ga0208974_1067161 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300027608|Ga0208974_1127973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300027659|Ga0208975_1033101 | All Organisms → Viruses → Predicted Viral | 1642 | Open in IMG/M |
| 3300027710|Ga0209599_10018262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2006 | Open in IMG/M |
| 3300027734|Ga0209087_1008220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5452 | Open in IMG/M |
| 3300027734|Ga0209087_1011220 | All Organisms → Viruses → Predicted Viral | 4567 | Open in IMG/M |
| 3300027734|Ga0209087_1031251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2543 | Open in IMG/M |
| 3300027734|Ga0209087_1086387 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300027749|Ga0209084_1009191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6122 | Open in IMG/M |
| 3300027754|Ga0209596_1058600 | All Organisms → Viruses → Predicted Viral | 1971 | Open in IMG/M |
| 3300027759|Ga0209296_1002253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13999 | Open in IMG/M |
| 3300027759|Ga0209296_1080560 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
| 3300027763|Ga0209088_10401668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300027772|Ga0209768_10292829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300027808|Ga0209354_10434434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300027969|Ga0209191_1262051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300028025|Ga0247723_1007344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4677 | Open in IMG/M |
| 3300028025|Ga0247723_1026745 | All Organisms → Viruses → Predicted Viral | 1867 | Open in IMG/M |
| 3300028025|Ga0247723_1093024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300028027|Ga0247722_10018264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2914 | Open in IMG/M |
| 3300028027|Ga0247722_10134315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
| 3300031707|Ga0315291_10792238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300031707|Ga0315291_10827095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300031707|Ga0315291_10906389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300031707|Ga0315291_11240425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300031746|Ga0315293_10511106 | Not Available | 926 | Open in IMG/M |
| 3300031746|Ga0315293_10993683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300031758|Ga0315907_10400969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300031772|Ga0315288_11401220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300031772|Ga0315288_11705770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300031772|Ga0315288_11706108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300031784|Ga0315899_10204035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1991 | Open in IMG/M |
| 3300031787|Ga0315900_10194599 | Not Available | 1805 | Open in IMG/M |
| 3300031857|Ga0315909_10058103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3533 | Open in IMG/M |
| 3300031857|Ga0315909_10513876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300031857|Ga0315909_10713977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300031857|Ga0315909_10726009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300031857|Ga0315909_10989443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300031951|Ga0315904_11280138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300031952|Ga0315294_10611416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300031952|Ga0315294_10909466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300031997|Ga0315278_10656148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
| 3300031999|Ga0315274_10582134 | Not Available | 1242 | Open in IMG/M |
| 3300031999|Ga0315274_10849038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300032018|Ga0315272_10184065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
| 3300032092|Ga0315905_10728510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300032116|Ga0315903_10137886 | Not Available | 2261 | Open in IMG/M |
| 3300033996|Ga0334979_0001853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15525 | Open in IMG/M |
| 3300034012|Ga0334986_0316796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300034062|Ga0334995_0098482 | Not Available | 2224 | Open in IMG/M |
| 3300034066|Ga0335019_0304169 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300034092|Ga0335010_0387198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300034101|Ga0335027_0715552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.66% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.29% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.29% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.32% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.34% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.37% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.44% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.44% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.95% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.49% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.49% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.49% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.49% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.49% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_102292662 | 3300000882 | Freshwater And Marine | MIRKTIGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEGK* |
| RCM40_10442311 | 3300001839 | Marine Plankton | MDRPVVGITAPYRKSDYTYQNMLLDRIKDLEAIVKKLEQRIAQLEGKK* |
| RCM30_10736273 | 3300001842 | Marine Plankton | MNRPEVGVTAPYRKSDYTYQNMLLDRIKDLEAIVKKLE |
| RCM26_10430492 | 3300001849 | Marine Plankton | MDRPVVGLTAPYRKSDYTYQNMLLDRIKDLEAIVKKLEQRIAQLEGKK* |
| JGI25908J49247_100157357 | 3300003277 | Freshwater Lake | VIRKTIGVEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVL |
| JGI25908J49247_100463574 | 3300003277 | Freshwater Lake | VEAPYRKSDYTYQDMLLDRIKDLETLVAKLEQRIKVLEAK* |
| JGI25909J50240_100100113 | 3300003393 | Freshwater Lake | VIRKTIGVEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| JGI25907J50239_10442201 | 3300003394 | Freshwater Lake | MIRKTIGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| JGI25930J51415_10773552 | 3300003499 | Freshwater Lake | RPTVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0007787_106891941 | 3300004240 | Freshwater Lake | NMIRKTIGVEAPYRKPDFTYQDMLLDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0071350_10114905 | 3300005069 | Freshwater | VNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVVKLEQRIKVLEGK* |
| Ga0068876_104002562 | 3300005527 | Freshwater Lake | MDRPIVGVTAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEGKK* |
| Ga0049083_100995193 | 3300005580 | Freshwater Lentic | MIRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0049081_100171417 | 3300005581 | Freshwater Lentic | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0049081_100540552 | 3300005581 | Freshwater Lentic | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKILEAK* |
| Ga0049081_101392521 | 3300005581 | Freshwater Lentic | RKPIGVDAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0049081_101503172 | 3300005581 | Freshwater Lentic | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEEK* |
| Ga0049081_101703102 | 3300005581 | Freshwater Lentic | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLETLVAKLEQRIKVLEAK* |
| Ga0049081_103098431 | 3300005581 | Freshwater Lentic | GVNVNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0049080_101479323 | 3300005582 | Freshwater Lentic | MDRPTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0049080_101679821 | 3300005582 | Freshwater Lentic | EAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0049080_101844964 | 3300005582 | Freshwater Lentic | LIFFKTGVNMIRKTIGVEAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0049080_102218671 | 3300005582 | Freshwater Lentic | VNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0049085_102025763 | 3300005583 | Freshwater Lentic | MIRKTIGVEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQ |
| Ga0070749_103552712 | 3300006802 | Aqueous | MDRPVVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEGKK* |
| Ga0075464_101657683 | 3300006805 | Aqueous | MIRKTIGVEAPYRKPDFTYQDMLLDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0075464_101944152 | 3300006805 | Aqueous | MDRPVVGVTAPYRKSDYTYNNMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0075464_103865694 | 3300006805 | Aqueous | FKQELMMDRPTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0075464_107671521 | 3300006805 | Aqueous | PYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEGK* |
| Ga0075464_107692621 | 3300006805 | Aqueous | VNRKPIGVDAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0075464_107844481 | 3300006805 | Aqueous | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAK |
| Ga0075464_108864963 | 3300006805 | Aqueous | IGVEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0075458_100075471 | 3300007363 | Aqueous | KSDYTYKDMLLDRIKDLETLVAKLEQRIKVLEAK* |
| Ga0075458_100392531 | 3300007363 | Aqueous | KSDYTYKDMLLDRIKDLEALVVKLEQRIKKLEAK* |
| Ga0102856_10325773 | 3300007636 | Estuarine | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0102859_10294393 | 3300007708 | Estuarine | MIRKTIGVEAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0102859_11053951 | 3300007708 | Estuarine | MDRPTVGITAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0104988_1025818 | 3300007735 | Freshwater | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIRVLEGK* |
| Ga0105746_12790671 | 3300007973 | Estuary Water | MIRKTIGVEAPYRKSDYTHQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114340_10762703 | 3300008107 | Freshwater, Plankton | VNRKPIGVETPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEGKK* |
| Ga0114340_11369093 | 3300008107 | Freshwater, Plankton | MIRKPIGVEAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114343_10722655 | 3300008110 | Freshwater, Plankton | MGVNMIRKTIGVEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0114343_11194755 | 3300008110 | Freshwater, Plankton | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVVKLEQRIKVLEGK* |
| Ga0114344_10686483 | 3300008111 | Freshwater, Plankton | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEGKK* |
| Ga0114841_11003041 | 3300008259 | Freshwater, Plankton | MMDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114841_11443021 | 3300008259 | Freshwater, Plankton | VNRKPIGVEAPYRKSDYTYQDMLLDRIKDLEALVKKLEQRIHVLEKSN* |
| Ga0114841_11807061 | 3300008259 | Freshwater, Plankton | GVEAPYRKSDYTYQDMLLDRIKDLEGLVAKLEQRIKVLEAK* |
| Ga0114336_103987810 | 3300008261 | Freshwater, Plankton | MMDRQTVGITAPYRKSDYTYQNMLLDRIKDLEALVKKLEQRIAVL |
| Ga0114337_10804595 | 3300008262 | Freshwater, Plankton | MDRQTVGITAPYRKSDYTYQNMLLDRIKDLEALVATLEQRIKVLVGKK* |
| Ga0114363_10559062 | 3300008266 | Freshwater, Plankton | MMDRPTVGITAPYRKSDYTYQDMLLDRIKDLEALVKKLEQRIHVLEKSN* |
| Ga0114363_10767672 | 3300008266 | Freshwater, Plankton | MMDRQTVGITAPYRKSDYTYQNMLLDRIKDLEALVKKLEQRIAVLEKSN* |
| Ga0114363_12228902 | 3300008266 | Freshwater, Plankton | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLETLVAKLEQRIKVLEGKK* |
| Ga0114364_11141744 | 3300008267 | Freshwater, Plankton | APYRKPDFTFQDMLLDRIKVLEALVVKLEQRIKVLEGK* |
| Ga0114364_11335422 | 3300008267 | Freshwater, Plankton | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEGK* |
| Ga0114364_11406803 | 3300008267 | Freshwater, Plankton | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVVKLEQR |
| Ga0114364_11899121 | 3300008267 | Freshwater, Plankton | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVVKLEQRIKVLEGK |
| Ga0114876_10196243 | 3300008448 | Freshwater Lake | MDRPIVGVTAPYRKSDYTYQNMLLDRIKDLETLVAKLEQRIKVLEAK* |
| Ga0114876_10975712 | 3300008448 | Freshwater Lake | VNRKPIGVETPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114876_11431981 | 3300008448 | Freshwater Lake | VNRKPIGVETPYRKSDYTYQDMLLDRIKDLEALVKKLEQRIHVLEKSN* |
| Ga0114876_11609811 | 3300008448 | Freshwater Lake | FKQELMMDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114876_11655512 | 3300008448 | Freshwater Lake | MDRPTVGITAPYRKSDYTYQDMLLDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0114876_11780401 | 3300008448 | Freshwater Lake | NVNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0114876_12292952 | 3300008448 | Freshwater Lake | VNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEGK* |
| Ga0114876_12363292 | 3300008448 | Freshwater Lake | MDRPTVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114876_12500451 | 3300008448 | Freshwater Lake | NVNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0114880_10673334 | 3300008450 | Freshwater Lake | VNRKPIGVDAPYRKSDYTYKDMLIDRIKDLEALIAKLEQRIKVLETK* |
| Ga0114880_11150694 | 3300008450 | Freshwater Lake | GVNVNRKPIGVEAPYRKPDFTFQDMLLDRIKVLETLVAKLEQRIKVLEAK* |
| Ga0114880_11364002 | 3300008450 | Freshwater Lake | MIRKTIGVEAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114880_12504552 | 3300008450 | Freshwater Lake | MMDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEGKK* |
| Ga0102860_10533104 | 3300009056 | Estuarine | IGVEAPYRKSDYTYKDMLIDRIKVLEALVAKLEQRIKVLEAK* |
| Ga0114962_100158012 | 3300009151 | Freshwater Lake | MMDRPTVGITAPYRKSDYTYQDMLLDRIKDLETLVAKLEQRIKVLEAK* |
| Ga0114980_106360072 | 3300009152 | Freshwater Lake | VIRKTIGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114968_100319597 | 3300009155 | Freshwater Lake | MMDRKTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114977_100075242 | 3300009158 | Freshwater Lake | MMDRPTVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114977_104370033 | 3300009158 | Freshwater Lake | MMDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAR* |
| Ga0114978_1000367720 | 3300009159 | Freshwater Lake | MMDRPTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114978_107526471 | 3300009159 | Freshwater Lake | MDRQTVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114970_100596134 | 3300009163 | Freshwater Lake | MIRKTIGVEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114970_103717373 | 3300009163 | Freshwater Lake | MIRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEGKK* |
| Ga0114975_100692253 | 3300009164 | Freshwater Lake | MMDRQTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114975_101723814 | 3300009164 | Freshwater Lake | MMDRPTVGITAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114975_104995251 | 3300009164 | Freshwater Lake | MMDRPNVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114979_105011311 | 3300009180 | Freshwater Lake | TVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114979_105570761 | 3300009180 | Freshwater Lake | MDRPNVGITAPYRKSDYTYKNMLIDRIKDLEALVAKLEQRIKVLEAR* |
| Ga0114974_102382652 | 3300009183 | Freshwater Lake | MDRPTVGITAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114976_105310181 | 3300009184 | Freshwater Lake | MVDRQTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0114964_100384307 | 3300010157 | Freshwater Lake | MDRPTVGITAPYRKSDYTYQDMLLDRIKDLETLVAKLEQRIKVLEAK* |
| Ga0114967_1000074824 | 3300010160 | Freshwater Lake | MDRKTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0151620_11943713 | 3300011268 | Freshwater | GITAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0151620_12621542 | 3300011268 | Freshwater | MMDRPTVGITAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLE |
| Ga0153697_133122 | 3300011334 | Freshwater | MDRPVVGVTAPYRKSDYTYNNMLLDRIKDLEALVAKLEQRIKVLEGK* |
| Ga0153800_10231641 | 3300011995 | Freshwater | RPTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0119955_10236127 | 3300012006 | Freshwater | MMDRPTVGITAPYRKSEYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0153801_10139495 | 3300012017 | Freshwater | MGVNVNRKPIGVDAPYRKSDYTYKDMLLDRIKDLEALVAKLE |
| Ga0157203_10571283 | 3300012663 | Freshwater | IGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0177922_104807561 | 3300013372 | Freshwater | IGVDAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK* |
| Ga0181363_10895161 | 3300017707 | Freshwater Lake | MDRPIVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKV |
| Ga0181350_11221991 | 3300017716 | Freshwater Lake | MNRKPIGVDAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181347_11417373 | 3300017722 | Freshwater Lake | GVNMIRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181347_11595733 | 3300017722 | Freshwater Lake | MIRKTIGVEAPYRKSDYTYQDMLIDRIKDLEALVA |
| Ga0181362_10233161 | 3300017723 | Freshwater Lake | MIRKTIGVEAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLETK |
| Ga0181352_10741182 | 3300017747 | Freshwater Lake | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKMLEAK |
| Ga0181352_10963483 | 3300017747 | Freshwater Lake | MDRPIVGITAPYRKSDYTYQDMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0181344_10221213 | 3300017754 | Freshwater Lake | MDRPIVGITAPYRKSDYTYKDMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0181356_10628413 | 3300017761 | Freshwater Lake | VIRKTIGGEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181356_11576792 | 3300017761 | Freshwater Lake | MDRPTVGITAPYRKSDYTHQDMLLDRIKDLEALVKKLEQRIAVLEKSN |
| Ga0181343_10608516 | 3300017766 | Freshwater Lake | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQR |
| Ga0181358_11898441 | 3300017774 | Freshwater Lake | IRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLETK |
| Ga0181357_12283074 | 3300017777 | Freshwater Lake | NMIRKTIGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAR |
| Ga0181357_12546743 | 3300017777 | Freshwater Lake | ELIFFKTGVNVNRKPIGVDAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181357_12789922 | 3300017777 | Freshwater Lake | MIRKTIGVEAPYRKSDYTHQDMLLDRIKDLEALVAKLEQRIKVLETK |
| Ga0181349_10331365 | 3300017778 | Freshwater Lake | IFFKQELMMDSPTVGITAPYRKSDYTHQDMLLDRIKDLEALVKKLEQRIAVLEKSN |
| Ga0181346_10429286 | 3300017780 | Freshwater Lake | KQELMMDRPIVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLETK |
| Ga0181348_10289831 | 3300017784 | Freshwater Lake | GVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181348_12841811 | 3300017784 | Freshwater Lake | KLIFFKTGVNMIRKTIGVEAPYRKSDYTYKDMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0181348_12900741 | 3300017784 | Freshwater Lake | APYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLETK |
| Ga0181348_13087331 | 3300017784 | Freshwater Lake | KPIGVDAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181355_12357113 | 3300017785 | Freshwater Lake | VNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLE |
| Ga0181355_13282371 | 3300017785 | Freshwater Lake | DVNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK |
| Ga0181563_100531578 | 3300018420 | Salt Marsh | MDRPVVGVTAPYRKSDYTYNNMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181359_10931001 | 3300019784 | Freshwater Lake | MDRPTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181359_12025421 | 3300019784 | Freshwater Lake | RKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181359_12248102 | 3300019784 | Freshwater Lake | VIRKTIGVEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0207942_10096592 | 3300020549 | Freshwater | VNRKPIGVETPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0207942_10141622 | 3300020549 | Freshwater | MDRQTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0213920_100220113 | 3300021438 | Freshwater | MDRPVVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKKLEAK |
| Ga0213920_10093138 | 3300021438 | Freshwater | MDRPVVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEGKK |
| Ga0213921_10504782 | 3300021952 | Freshwater | MDRPTVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIRVLEGK |
| Ga0222714_100867766 | 3300021961 | Estuarine Water | MDRPIVGITAPYRKSEYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0222714_101851814 | 3300021961 | Estuarine Water | MDRPIVGVTAPYRKSDYTYNNMLLDRIKDLEALVAKLEQRIKVLEGK |
| Ga0222714_105264672 | 3300021961 | Estuarine Water | MIRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0222713_103370833 | 3300021962 | Estuarine Water | VIRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEGK |
| Ga0222713_108089153 | 3300021962 | Estuarine Water | PYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0222712_104214213 | 3300021963 | Estuarine Water | MDRPVVGVTAPYRKSDYTYNNMLLDRIKDLEALVAKLEQRIKVLESK |
| Ga0222712_104386612 | 3300021963 | Estuarine Water | MDRPTVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEEK |
| Ga0181353_10026863 | 3300022179 | Freshwater Lake | MIRKTIGVEAPYRKPDFTYQDMLLDRIKVLEALVAKLEQRIKVLEAK |
| Ga0181353_10538483 | 3300022179 | Freshwater Lake | MDRPIVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0181354_10079863 | 3300022190 | Freshwater Lake | MIRKTIGVEAPYRKSDYTYKDMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0181354_10572811 | 3300022190 | Freshwater Lake | KSDYTHQDMLLDRIKDLEALVKKLEQRIAVLEKSN |
| Ga0181351_11486712 | 3300022407 | Freshwater Lake | MIRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLETK |
| Ga0214917_100195722 | 3300022752 | Freshwater | MDRPIVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0214921_103285134 | 3300023174 | Freshwater | MDRPVVGVTAPYRKSEYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0214919_1000189132 | 3300023184 | Freshwater | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0214919_101600272 | 3300023184 | Freshwater | MDRPTVGITAPYRKSEYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0214919_107489321 | 3300023184 | Freshwater | PIVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0255147_100016916 | 3300024289 | Freshwater | MDRTVVGLTAPYRKSDYTYQNMLLDRIKDLEAIVKKLEQRIAQLEGKK |
| Ga0244775_109050274 | 3300024346 | Estuarine | VNMIRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0208916_101557304 | 3300025896 | Aqueous | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEGK |
| Ga0208916_103885141 | 3300025896 | Aqueous | RKSDYTYKDMLLDRIKDLEALVAKLEQRIRVLEGK |
| Ga0255118_10373191 | 3300027593 | Freshwater | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVA |
| Ga0208974_10063165 | 3300027608 | Freshwater Lentic | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKILEAK |
| Ga0208974_10205594 | 3300027608 | Freshwater Lentic | MIRKTIGVEAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0208974_10671614 | 3300027608 | Freshwater Lentic | VNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLET |
| Ga0208974_11279731 | 3300027608 | Freshwater Lentic | PYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0208975_10331014 | 3300027659 | Freshwater Lentic | VNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK |
| Ga0209599_100182621 | 3300027710 | Deep Subsurface | MIRKTIGVEAPYRKPDFTYQDMLLDRIKVLEALVAKLEQRI |
| Ga0209087_100822011 | 3300027734 | Freshwater Lake | VIRKTIGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0209087_101122010 | 3300027734 | Freshwater Lake | MDRQTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0209087_10312512 | 3300027734 | Freshwater Lake | MDRPTVGITAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0209087_10863875 | 3300027734 | Freshwater Lake | VIRKTIGVEAPYRKSDYTYQNMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0209084_100919113 | 3300027749 | Freshwater Lake | MDRPTVGITAPYRKSDYTYQDMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0209596_10586006 | 3300027754 | Freshwater Lake | MDRKTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0209296_100225312 | 3300027759 | Freshwater Lake | MMDRPTVGITAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0209296_10805603 | 3300027759 | Freshwater Lake | VNRKPIGVDAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEENK |
| Ga0209088_104016681 | 3300027763 | Freshwater Lake | RKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0209768_102928293 | 3300027772 | Freshwater Lake | NVIRKTIGVEAPYRKSDYTYKDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0209354_104344341 | 3300027808 | Freshwater Lake | MIRKTIGVEAPYRKSNYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0209191_12620511 | 3300027969 | Freshwater Lake | MDRPNVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0247723_100734414 | 3300028025 | Deep Subsurface Sediment | GVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK |
| Ga0247723_10267456 | 3300028025 | Deep Subsurface Sediment | PTVGITAPYRKSDYTYKDMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0247723_10930242 | 3300028025 | Deep Subsurface Sediment | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLETLVAKLEQRIKVLEGKK |
| Ga0247722_100182642 | 3300028027 | Deep Subsurface Sediment | VIRKPIGVEAPYRKPDFTFQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0247722_101343151 | 3300028027 | Deep Subsurface Sediment | PYRKPDFTFQDMLLDRIKVLEALVAKLEQRIRVLEGK |
| Ga0315291_107922385 | 3300031707 | Sediment | GVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315291_108270954 | 3300031707 | Sediment | MGVNVNRKPIGVDAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315291_109063891 | 3300031707 | Sediment | RKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315291_112404252 | 3300031707 | Sediment | MGVNVNRKPIGVDAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLETK |
| Ga0315293_105111062 | 3300031746 | Sediment | MIRKTIGVEAPYRKSDYTYQDMLLDRIKDLEALVKNLEQRIAVLEKSN |
| Ga0315293_109936831 | 3300031746 | Sediment | EAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315907_104009694 | 3300031758 | Freshwater | MIRKPIGVEAPYRKSDYTYQDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315288_114012201 | 3300031772 | Sediment | MIRKTIGVEAPHRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLETK |
| Ga0315288_117057702 | 3300031772 | Sediment | YRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315288_117061081 | 3300031772 | Sediment | APYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315899_102040352 | 3300031784 | Freshwater | VNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVVKLEQRIKVLEGK |
| Ga0315900_101945994 | 3300031787 | Freshwater | MDRQTVGITAPYRKSDYTYQNMLLDRIKDLEALVKKLEQRIAVLEKSN |
| Ga0315909_100581038 | 3300031857 | Freshwater | VNRKPIGVETPYRKSDYTYQDMLLDRIKDLEALVKKLEQRIHVLEKSN |
| Ga0315909_105138763 | 3300031857 | Freshwater | VNRKPIGVEAPYRKPDFTFQDMLLDRIKVLETLVAKLEQRIKVLEGK |
| Ga0315909_107139771 | 3300031857 | Freshwater | MMDRQTVGITAPYRKSDYTYQNMLLDRIKDLEALVKKLEQRIAVLEKSN |
| Ga0315909_107260091 | 3300031857 | Freshwater | GVNVNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK |
| Ga0315909_109894432 | 3300031857 | Freshwater | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEGKK |
| Ga0315904_112801381 | 3300031951 | Freshwater | MDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEGKKXKS |
| Ga0315294_106114165 | 3300031952 | Sediment | IGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315294_109094663 | 3300031952 | Sediment | MIRKTIGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLETK |
| Ga0315278_106561481 | 3300031997 | Sediment | MIRKTIGVEAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEAK |
| Ga0315274_105821341 | 3300031999 | Sediment | GVNMIRKTIGVEAPYRKSDYTYKDMLIDRIKDLEALVKNLEQRIAVLEKSN |
| Ga0315274_108490381 | 3300031999 | Sediment | KTIGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315272_101840651 | 3300032018 | Sediment | NMIRKTIGVEAPYRKSDYTYKDMLIDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315905_107285102 | 3300032092 | Freshwater | MIRKTIGVEAPYRKSDYTHQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0315903_101378866 | 3300032116 | Freshwater | GVNMDRPVVGITAPYRKSDYTYQDMLLDRIKDLEALVKKLEQRIHVLEKSN |
| Ga0334979_0001853_12477_12623 | 3300033996 | Freshwater | MMDRPTVGITAPYRKSDYTYQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0334986_0316796_553_699 | 3300034012 | Freshwater | MMDRPTVGITAPYRKSDYTYQNMLLDRIKDLETLVAKLEQRIKVLEAK |
| Ga0334995_0098482_11_142 | 3300034062 | Freshwater | VGITAPYRKSDYTYQNMLLDRIKDLEALVKKLEQRIAVLEKSN |
| Ga0335019_0304169_385_531 | 3300034066 | Freshwater | MMDRPTVGITAPYRKSDYTHQDMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0335010_0387198_74_220 | 3300034092 | Freshwater | MMDRPTVGITAPYRKSDYTYQNMLLDRIKDLEALVAKLEQRIKVLEAK |
| Ga0335027_0715552_392_535 | 3300034101 | Freshwater | VNRKPIGVNAPYRKPDFTFQDMLLDRIKVLEALVAKLEQRIKVLEGK |
| ⦗Top⦘ |