| Basic Information | |
|---|---|
| Family ID | F024376 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 206 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VLEQALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Number of Associated Samples | 177 |
| Number of Associated Scaffolds | 206 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 95.15 % |
| % of genes from short scaffolds (< 2000 bps) | 87.38 % |
| Associated GOLD sequencing projects | 164 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.117 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.136 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.816 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 206 Family Scaffolds |
|---|---|---|
| PF02661 | Fic | 75.24 |
| PF00155 | Aminotran_1_2 | 1.46 |
| PF03167 | UDG | 1.46 |
| PF03795 | YCII | 0.97 |
| PF17209 | Hfq | 0.97 |
| PF04055 | Radical_SAM | 0.97 |
| PF04253 | TFR_dimer | 0.97 |
| PF13185 | GAF_2 | 0.97 |
| PF07715 | Plug | 0.49 |
| PF13193 | AMP-binding_C | 0.49 |
| PF13292 | DXP_synthase_N | 0.49 |
| PF00160 | Pro_isomerase | 0.49 |
| PF01261 | AP_endonuc_2 | 0.49 |
| PF10282 | Lactonase | 0.49 |
| PF01625 | PMSR | 0.49 |
| PF02518 | HATPase_c | 0.49 |
| PF07690 | MFS_1 | 0.49 |
| PF02823 | ATP-synt_DE_N | 0.49 |
| PF09722 | Xre_MbcA_ParS_C | 0.49 |
| PF07007 | LprI | 0.49 |
| PF13620 | CarboxypepD_reg | 0.49 |
| PF00486 | Trans_reg_C | 0.49 |
| PF02646 | RmuC | 0.49 |
| PF13545 | HTH_Crp_2 | 0.49 |
| PF02481 | DNA_processg_A | 0.49 |
| PF00903 | Glyoxalase | 0.49 |
| PF00730 | HhH-GPD | 0.49 |
| PF10543 | ORF6N | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
|---|---|---|---|
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.46 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.46 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.46 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 0.97 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.49 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.49 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.49 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.49 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.49 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.49 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.49 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.12 % |
| Unclassified | root | N/A | 3.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10577110 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100182190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1987 | Open in IMG/M |
| 3300004091|Ga0062387_101604759 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004092|Ga0062389_104131472 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300004635|Ga0062388_100037532 | All Organisms → cellular organisms → Bacteria | 3040 | Open in IMG/M |
| 3300005093|Ga0062594_101242745 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005171|Ga0066677_10107917 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300005179|Ga0066684_10104961 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300005181|Ga0066678_10747539 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005184|Ga0066671_10902114 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005187|Ga0066675_11415444 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005332|Ga0066388_102477262 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005332|Ga0066388_105696434 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005336|Ga0070680_101988687 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005343|Ga0070687_101256779 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005434|Ga0070709_10312752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300005434|Ga0070709_11063850 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005437|Ga0070710_10042978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2501 | Open in IMG/M |
| 3300005445|Ga0070708_100976837 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300005450|Ga0066682_10950730 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005457|Ga0070662_101429304 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005534|Ga0070735_10723959 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005536|Ga0070697_101455514 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005536|Ga0070697_101733692 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005542|Ga0070732_10042779 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
| 3300005554|Ga0066661_10219112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300005576|Ga0066708_10086656 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300005586|Ga0066691_10947559 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005591|Ga0070761_10865157 | Not Available | 570 | Open in IMG/M |
| 3300005598|Ga0066706_10249865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1380 | Open in IMG/M |
| 3300005602|Ga0070762_10807108 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005712|Ga0070764_10943210 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005921|Ga0070766_10479458 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005995|Ga0066790_10204214 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300006028|Ga0070717_12071347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300006032|Ga0066696_10040976 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300006047|Ga0075024_100653216 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006050|Ga0075028_100062655 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300006059|Ga0075017_100390880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300006102|Ga0075015_100398602 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006174|Ga0075014_100858963 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006176|Ga0070765_100796956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300006354|Ga0075021_10388813 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300006796|Ga0066665_10085673 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300007076|Ga0075435_100379761 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300009510|Ga0116230_11158048 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009520|Ga0116214_1271135 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009524|Ga0116225_1253117 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300009547|Ga0116136_1053108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1132 | Open in IMG/M |
| 3300009616|Ga0116111_1144101 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300009624|Ga0116105_1030405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
| 3300009672|Ga0116215_1442221 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009700|Ga0116217_10029253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4217 | Open in IMG/M |
| 3300009824|Ga0116219_10496209 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300009826|Ga0123355_11360952 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300009839|Ga0116223_10028901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3787 | Open in IMG/M |
| 3300010046|Ga0126384_11024758 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300010046|Ga0126384_11510950 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010159|Ga0099796_10108015 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300010341|Ga0074045_10075290 | Not Available | 2373 | Open in IMG/M |
| 3300010358|Ga0126370_10711926 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300010358|Ga0126370_10831080 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010360|Ga0126372_11412712 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300010376|Ga0126381_100522059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300010376|Ga0126381_101143487 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300010376|Ga0126381_101146732 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300010376|Ga0126381_102744203 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300011270|Ga0137391_10003158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12466 | Open in IMG/M |
| 3300011271|Ga0137393_10493004 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300011271|Ga0137393_11350494 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300012189|Ga0137388_10331357 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300012200|Ga0137382_10971295 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300012201|Ga0137365_11253083 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012203|Ga0137399_11061232 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012205|Ga0137362_11551546 | Not Available | 549 | Open in IMG/M |
| 3300012207|Ga0137381_11790738 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012210|Ga0137378_11499298 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012362|Ga0137361_11121194 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012362|Ga0137361_11511999 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012363|Ga0137390_10013589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7318 | Open in IMG/M |
| 3300012363|Ga0137390_10738496 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300012469|Ga0150984_120634029 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300012683|Ga0137398_10592028 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300012924|Ga0137413_10562208 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012927|Ga0137416_11809430 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012929|Ga0137404_10583512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1004 | Open in IMG/M |
| 3300012929|Ga0137404_11669145 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012944|Ga0137410_10794309 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300013832|Ga0120132_1033046 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300014162|Ga0181538_10546110 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300014201|Ga0181537_10891086 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300014493|Ga0182016_10211581 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300014501|Ga0182024_12086447 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300014638|Ga0181536_10354697 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300016371|Ga0182034_10953322 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300016404|Ga0182037_10169877 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300017925|Ga0187856_1004151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9745 | Open in IMG/M |
| 3300017930|Ga0187825_10241007 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300017933|Ga0187801_10421264 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300017935|Ga0187848_10410553 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300017975|Ga0187782_10403376 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300017975|Ga0187782_10953133 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300017975|Ga0187782_11562786 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300017988|Ga0181520_11100716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300017996|Ga0187891_1004068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9747 | Open in IMG/M |
| 3300018008|Ga0187888_1060481 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300018025|Ga0187885_10245348 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300018034|Ga0187863_10185508 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300018046|Ga0187851_10075735 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
| 3300018062|Ga0187784_10849454 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300018090|Ga0187770_10394981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1086 | Open in IMG/M |
| 3300018090|Ga0187770_11207013 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300018090|Ga0187770_11779983 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300019240|Ga0181510_1033918 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300019786|Ga0182025_1300622 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300019787|Ga0182031_1363527 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300020061|Ga0193716_1004727 | All Organisms → cellular organisms → Bacteria | 7297 | Open in IMG/M |
| 3300020150|Ga0187768_1163159 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300020579|Ga0210407_10005884 | All Organisms → cellular organisms → Bacteria | 9443 | Open in IMG/M |
| 3300020580|Ga0210403_11125533 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300021181|Ga0210388_10267224 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300021181|Ga0210388_11141514 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300021181|Ga0210388_11253290 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300021401|Ga0210393_10091315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2419 | Open in IMG/M |
| 3300021405|Ga0210387_10147378 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300021405|Ga0210387_11145200 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300021406|Ga0210386_11575025 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300021433|Ga0210391_11523959 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021478|Ga0210402_10445067 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300021478|Ga0210402_11144314 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300021478|Ga0210402_11546456 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021559|Ga0210409_11308872 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300021560|Ga0126371_13323839 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300022873|Ga0224550_1039916 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300023101|Ga0224557_1304927 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300023250|Ga0224544_1016314 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300024225|Ga0224572_1045227 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300025878|Ga0209584_10135147 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300025898|Ga0207692_10052127 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300025900|Ga0207710_10630738 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300025906|Ga0207699_11012912 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025940|Ga0207691_10820672 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300025949|Ga0207667_10248095 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300026301|Ga0209238_1189194 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300026330|Ga0209473_1070800 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300026335|Ga0209804_1228329 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300026361|Ga0257176_1063797 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026527|Ga0209059_1246588 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300026530|Ga0209807_1297115 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300026548|Ga0209161_10238895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300026557|Ga0179587_10031930 | All Organisms → cellular organisms → Bacteria | 2932 | Open in IMG/M |
| 3300026557|Ga0179587_11078772 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300026869|Ga0207821_1028734 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027497|Ga0208199_1023883 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300027575|Ga0209525_1096165 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300027629|Ga0209422_1084801 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300027767|Ga0209655_10070158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1166 | Open in IMG/M |
| 3300027846|Ga0209180_10098192 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300027869|Ga0209579_10284935 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300027879|Ga0209169_10438803 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027884|Ga0209275_10745772 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300027894|Ga0209068_10446322 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300027895|Ga0209624_10190911 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300027903|Ga0209488_10310332 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300028047|Ga0209526_10456240 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300028552|Ga0302149_1206324 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300028565|Ga0302145_10334981 | Not Available | 500 | Open in IMG/M |
| 3300028780|Ga0302225_10515838 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300028874|Ga0302155_10035597 | Not Available | 2343 | Open in IMG/M |
| 3300029701|Ga0222748_1103626 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300029915|Ga0311358_11109384 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300029953|Ga0311343_11072211 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300030048|Ga0302273_1171975 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300030294|Ga0311349_10051974 | All Organisms → cellular organisms → Bacteria | 3758 | Open in IMG/M |
| 3300030509|Ga0302183_10297528 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300030618|Ga0311354_11194385 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300030659|Ga0316363_10395732 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300030706|Ga0310039_10150747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 940 | Open in IMG/M |
| 3300030706|Ga0310039_10291453 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300030943|Ga0311366_10668172 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031231|Ga0170824_101313987 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031231|Ga0170824_126542643 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300031446|Ga0170820_11742024 | Not Available | 553 | Open in IMG/M |
| 3300031446|Ga0170820_13320624 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031469|Ga0170819_17096207 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031525|Ga0302326_13168545 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031525|Ga0302326_13442353 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031543|Ga0318516_10602234 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031708|Ga0310686_103300617 | Not Available | 533 | Open in IMG/M |
| 3300031720|Ga0307469_10492484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1072 | Open in IMG/M |
| 3300031753|Ga0307477_10836929 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031754|Ga0307475_10749306 | Not Available | 777 | Open in IMG/M |
| 3300031820|Ga0307473_10325285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
| 3300031845|Ga0318511_10467051 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031945|Ga0310913_10245079 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300031962|Ga0307479_11159923 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031962|Ga0307479_12010136 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300032180|Ga0307471_100062913 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
| 3300032180|Ga0307471_100191388 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300032782|Ga0335082_10567222 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300032783|Ga0335079_11624625 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032805|Ga0335078_10104252 | All Organisms → cellular organisms → Bacteria | 4089 | Open in IMG/M |
| 3300032828|Ga0335080_10301944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1738 | Open in IMG/M |
| 3300033158|Ga0335077_10231193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2059 | Open in IMG/M |
| 3300033158|Ga0335077_10766550 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300033561|Ga0371490_1008179 | All Organisms → cellular organisms → Bacteria | 3994 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.91% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.43% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.46% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.97% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.97% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.49% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.49% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.49% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.49% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.49% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105771102 | 3300001593 | Forest Soil | ALKFYLKNVIPSQHLIRREVMDAFEQSVAANRDLLDRLAK* |
| JGIcombinedJ26739_1001821901 | 3300002245 | Forest Soil | YLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0062387_1016047591 | 3300004091 | Bog Forest Soil | AVAKRNGQSQRHVLEQALTFYLRNVVPSQQLVRPEVMDAFDQSVATNRDLLERLAK* |
| Ga0062389_1041314721 | 3300004092 | Bog Forest Soil | EQALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0062388_1000375325 | 3300004635 | Bog Forest Soil | IAKQNGQTKRHVLEQALGFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLERLAK* |
| Ga0062594_1012427451 | 3300005093 | Soil | GQSQRYILEKALEHYLHNVVPSQHLVRPGVMDAFEQSMARNHDLLERLAK* |
| Ga0066677_101079171 | 3300005171 | Soil | HVLEQALRFYLHNVVPSQQLVRREIMDAFEQSVVQNRDLLERLAK* |
| Ga0066684_101049611 | 3300005179 | Soil | LRFYLHNVVPSQQLVRREIMDAFEQSVVQNRDLLERLAK* |
| Ga0066678_107475391 | 3300005181 | Soil | HTQRYVLEEALRYYLHNVGPVQHLVRPEVMDTFEQSVARNRDLLERLAK* |
| Ga0066671_109021141 | 3300005184 | Soil | YDEFVALAEKNGQSKRHVLEQALRFYLHNVVPSQHLVRREIMDAFEQSVVQNRDLLERLAK* |
| Ga0066675_114154441 | 3300005187 | Soil | ALRFYLHNVVPSQHLVRREVMDAFEQSVAQNRELLERLAK* |
| Ga0066388_1024772622 | 3300005332 | Tropical Forest Soil | VLEQALAHYLHNVVPSQHLVRPEVMRAFEQSVERNRELLERLAR* |
| Ga0066388_1056964342 | 3300005332 | Tropical Forest Soil | VLEQALEFYLRNVVPSQHLVRAEVMDAFEQSVARNRDLLQRLAK* |
| Ga0070680_1019886871 | 3300005336 | Corn Rhizosphere | GQSQRYILEKALEHYLHNVVPSQHLVRRGVMDAFEQSAGRNRDLLERLAK* |
| Ga0070687_1012567792 | 3300005343 | Switchgrass Rhizosphere | HILERALEHYLHNVVPSQHVVRRGVMDAFEQSVGRNRDLLDRLAM* |
| Ga0070709_103127521 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EEALKFYLKNVVPSQHLVRREVMDAFEQSVAGNRDLLDRLAK* |
| Ga0070709_110638501 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEQNGQTKRHVLEQALRFYLHNVVPSQHLVRREVMDAFEQSVAQNRDLLERLAK* |
| Ga0070710_100429781 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | HILEEALKFYLTNVVPSQHLVRRGVMDAFEQSVAGNRELLDRLAK* |
| Ga0070708_1009768371 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLEQALTHYLHNVVPSQHLVRPQVMDAFEESVARNRDLLERLAK* |
| Ga0066682_109507301 | 3300005450 | Soil | LRFYLRNVVPSQHLVRPEVMDAFDESVARNRDLLQRLAK* |
| Ga0070662_1014293042 | 3300005457 | Corn Rhizosphere | ALEHYLHNVVPSQHVVRRGVMDAFEQSVGRNRDLLDRLAR* |
| Ga0070735_107239591 | 3300005534 | Surface Soil | EALRFYLRSVVPSQHIVRRAVMDAFDESVARNRELLERLAK* |
| Ga0070697_1014555142 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEQNGQTKRHVLEQALRFYLHNVVPSQHLVRREVMDAFEQSVTRNRDLLQRLAK* |
| Ga0070697_1017336922 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ERNGQTKRHILEQALRFYLHNVVPSQHLVRPEVMDAFEQSAARNRDLLQRLAK* |
| Ga0070732_100427794 | 3300005542 | Surface Soil | GQTKRHVLEEALRFYLHNVVPSQHLVRREVMDAFEQSVARNRELLERLAK* |
| Ga0066661_102191121 | 3300005554 | Soil | QSQRQVLEQALEFYLRNVVPSQHLVRPEVMDAFQQSVARNRDLLERLAK* |
| Ga0066708_100866564 | 3300005576 | Soil | VLEQALRFYLHNVVPSQQLVRREIMDAFEQSVVQNRDLLERLAK* |
| Ga0066691_109475591 | 3300005586 | Soil | DEFVAVAEQNGQTKRHVLEEALRFYLRNVVPSQHLVRPEVMDAFDESVARNRDLLQRLAK |
| Ga0070761_108651572 | 3300005591 | Soil | RHVLEEALKFYLRNVAPAQHLARTEVMKAFEQSMADNRDLLNRLSK* |
| Ga0066706_102498653 | 3300005598 | Soil | QVLEQALEFYLRNVVPSQHLVRPEVMDAFQQSVARNRDLLERLAK* |
| Ga0070762_108071081 | 3300005602 | Soil | KRYVLEQALRFYLHNVVPSQHLVRREVMDTFEDSVARNRELLERLAK* |
| Ga0070764_109432101 | 3300005712 | Soil | VLEQALRFYLQNVVPSQHLVRSDVMDTFEQSLSRNRDLLERLAK* |
| Ga0070766_104794583 | 3300005921 | Soil | YLHNVVPSQHLVRREVMDTFEDSVARNRELLERLAK* |
| Ga0066790_102042143 | 3300005995 | Soil | NGQSQRYILEQALAFYLRNVVPSQHLVRREVMNDFEQSVAANRDLLQRLAK* |
| Ga0070717_120713472 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MARPSGVLEQALRFYLHNVVPSQHLVRREVMDAFEDSVARNRELLERLAK* |
| Ga0066696_100409761 | 3300006032 | Soil | VTTCTTLVPSQHLVRPEVMDTFEQSVARNRDLLERLAK* |
| Ga0075024_1006532161 | 3300006047 | Watersheds | LEQALRFYLHNVVPSQHLVRTEVMDAFEQSVARNQDLLQRLAK* |
| Ga0075028_1000626551 | 3300006050 | Watersheds | FYLHNVVPSQHLVRHEVMDAFEQSVAQNRDLLQRLAK* |
| Ga0075017_1003908801 | 3300006059 | Watersheds | QRHVLEQALEFYLRNVVPSQHLVRREVMEAFEQSVARNRDLLQRLAK* |
| Ga0075015_1003986023 | 3300006102 | Watersheds | LKFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0075014_1008589631 | 3300006174 | Watersheds | FYLHNVVPSQHVVRREVMDAFEQSVARNRELLERLAK* |
| Ga0070765_1007969561 | 3300006176 | Soil | ATAKRNGQSQRYVLEQALAHYLHNVVPLQQVAHRQVMDAFEQSAAANGDLLQRLAK* |
| Ga0075021_103888131 | 3300006354 | Watersheds | VAVAERNGQTKRHVLEQALRFYLHNVVPSQHLVRPEVMEAFEQSVARNRDLLQRLAK* |
| Ga0066665_100856734 | 3300006796 | Soil | LEQAIRFYLKNVVPSQHLVRPQSMDAFEQSVARNRDLLQRIAK* |
| Ga0075435_1003797613 | 3300007076 | Populus Rhizosphere | RFYLHNVVPSQHLVRREVMDAFEQSVTRNRDLLQRLAK* |
| Ga0116230_111580482 | 3300009510 | Host-Associated | FYLHHVVPSQHLVRPEVMDAFEQSVARNHDLLERLAK* |
| Ga0116214_12711351 | 3300009520 | Peatlands Soil | YLQNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0116225_12531173 | 3300009524 | Peatlands Soil | AERNGQTKRHVLEEALRFYLRNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0116136_10531081 | 3300009547 | Peatland | LAHYLHNVVPSQHLVRPEVMGAFEQSVARNRDLLERLAK* |
| Ga0116111_11441011 | 3300009616 | Peatland | KRHVLEQALKFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0116105_10304053 | 3300009624 | Peatland | FYLHNVVPSQHLVRPEVMDPFEQSVARNRDRLQRLAK* |
| Ga0116215_14422212 | 3300009672 | Peatlands Soil | YVLEEALKFYLKNVVPSQHLVRREVMEAFEQSVSANRDLLERLAK* |
| Ga0116217_100292536 | 3300009700 | Peatlands Soil | LEQALAHYLRNVVPSQHLVRPQVMDAFEQSVDRNRDLLERLAK* |
| Ga0116219_104962092 | 3300009824 | Peatlands Soil | GQTKRHVLEEALRFYLRNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0123355_113609522 | 3300009826 | Termite Gut | EQAVAHYLHNVVPSQHLVRPQVMQAFEHSVDRNRELLQRLAS* |
| Ga0116223_100289011 | 3300009839 | Peatlands Soil | QALAHYLHNVVPSQHLVRPQVMDAFEQSVERNRDLLERLAK* |
| Ga0126384_110247582 | 3300010046 | Tropical Forest Soil | LKRLLEQNGQTKRHVLEATLRFYLHNVVPLQHLVRREVMDAFEQSVARNRDLLQRLAR* |
| Ga0126384_115109501 | 3300010046 | Tropical Forest Soil | HYLHNVVPSQHVVRRGVMDAFEQSVTRNKDLLDRLAK* |
| Ga0099796_101080153 | 3300010159 | Vadose Zone Soil | QALAFYLHNVVPSQHLVRREVMEAFEQSVAANRDLLERLAK* |
| Ga0074045_100752901 | 3300010341 | Bog Forest Soil | LGFYLHNVVPSQHLVRTEVMDAFEQSVARNRDLLQRLAK* |
| Ga0126370_107119261 | 3300010358 | Tropical Forest Soil | EKALEHYLHNVVPSQHLVRRGVMDAFEQSVARNRDLLDRLAR* |
| Ga0126370_108310801 | 3300010358 | Tropical Forest Soil | ERNGHTKRHVLEQALRFYLHNVVPSQHLVRQEVMDAFEKSVARNRDLLERLAK* |
| Ga0126372_114127121 | 3300010360 | Tropical Forest Soil | KEMVRVAKQNGQSQRYILEKALEHYLHNVVPSQHVVRRGVMDAFEQSVARNRDLLDRLAK |
| Ga0126381_1005220592 | 3300010376 | Tropical Forest Soil | MTKLLWLLKRRGQTRRHVIEQALAFYLHNIAPSQHVVCTEAMDSFEQSVTRNRDLLQRLAK* |
| Ga0126381_1011434874 | 3300010376 | Tropical Forest Soil | ILERALEHYLHNVVPSQHLVRRGVMDAFEQSVARNRDLLERLAR* |
| Ga0126381_1011467323 | 3300010376 | Tropical Forest Soil | SQRYILEKALEHYLHNVVPSQHLVRRGVMDAFEQSVARNRDLLERLAK* |
| Ga0126381_1027442032 | 3300010376 | Tropical Forest Soil | EKALEHYLHNVVPSQHLVRPRVMDVFEQSVTRNRDLLERLAR* |
| Ga0137391_100031586 | 3300011270 | Vadose Zone Soil | MSSSRVAEQNGQTKRHVLEQALKFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0137393_104930041 | 3300011271 | Vadose Zone Soil | LHNVVPSQHLVRREVMDAFEQSVARNRDLLQRLAK* |
| Ga0137393_113504942 | 3300011271 | Vadose Zone Soil | VLEQALEFYLHHVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0137388_103313574 | 3300012189 | Vadose Zone Soil | KAHAFYLHNVVPSQHLVRPQVMDAFEQTVSRNRDLLQRLAK* |
| Ga0137382_109712952 | 3300012200 | Vadose Zone Soil | TTCTTLVPSQHLVRPEVMDTFEQSVARNRDLLERLAK* |
| Ga0137365_112530831 | 3300012201 | Vadose Zone Soil | AERNGQSKRHVLEQALAFYLHNVVPSQHLVRSEVMDAFEKSVARNRDLLQRLSK* |
| Ga0137399_110612321 | 3300012203 | Vadose Zone Soil | KNGQTKRHVLEQALRFYLDNVVPSQHMVRPDVMDAFEQSMARNRDLLQRLAK* |
| Ga0137362_115515461 | 3300012205 | Vadose Zone Soil | EEALKFYLKNVVPAQHLARTEVMRAFEQSVAGNRDLLERLSKTGASPE* |
| Ga0137381_117907381 | 3300012207 | Vadose Zone Soil | EALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0137378_114992981 | 3300012210 | Vadose Zone Soil | LEQALAFYLHNVVPSQHLVRPEVMDAFEQSVSRNRDLLQRLAK* |
| Ga0137361_111211942 | 3300012362 | Vadose Zone Soil | TVAEQNGQTKRRVLEQALAFYLHNVVPSQHLVRPEVMDAFEQSVSRNRDLLQRLAK* |
| Ga0137361_115119991 | 3300012362 | Vadose Zone Soil | ALRFYLHNVVPSQHLVRSEVMDSFEQSVARNRDLLQRLAK* |
| Ga0137390_1001358910 | 3300012363 | Vadose Zone Soil | YNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK* |
| Ga0137390_107384962 | 3300012363 | Vadose Zone Soil | EEALKFYLKNVVPSQHLVRREVMDVFELSVAGNRDLLERLAK* |
| Ga0150984_1206340293 | 3300012469 | Avena Fatua Rhizosphere | VAEKNGQSKRHVLEQSLRFYLHNVVPSQHLVRREVMDAFEQSVAQNRDLLERLAK* |
| Ga0137398_105920281 | 3300012683 | Vadose Zone Soil | QRHVLEQALAFYLHNVVPSQHLVRREVMEAFEQSVAANRDLLERLAK* |
| Ga0137413_105622082 | 3300012924 | Vadose Zone Soil | LRFYLHNVVPSQHLVRTEVMDPFERSVARNPDLLQRLAQ* |
| Ga0137416_118094302 | 3300012927 | Vadose Zone Soil | LHNVVPSQHLVRTEVMDAFEQSVARNRDLLQRLAK* |
| Ga0137404_105835122 | 3300012929 | Vadose Zone Soil | MGITKWHVLEQALRFYLHNVVPSQHLVRTEVIDAFEQSVARNRNLLECLAQ* |
| Ga0137404_116691451 | 3300012929 | Vadose Zone Soil | QTKRHVLEQALKFYLHNVVPSQHLVRREVMDAFEQSVSRNRDLLQRLAK* |
| Ga0137410_107943092 | 3300012944 | Vadose Zone Soil | GQTKRYVLERALEFYLHNVVPSQHLVRPEVMDAFQQSVARNRDLLERLAK* |
| Ga0120132_10330463 | 3300013832 | Permafrost | LEQALKFYLHNVVPSQHLVRPEVMDAFEKSVARNRDLLERLAK* |
| Ga0181538_105461102 | 3300014162 | Bog | HVLEEALRFYLHNVVPSQHLVRTEVMDAFEQSVARNRDLLQRLAK* |
| Ga0181537_108910861 | 3300014201 | Bog | RHVLEQALEFYLRNVVPSQHLVRSAVMDDFQASVTRNRGLLERLAK* |
| Ga0182016_102115811 | 3300014493 | Bog | EEALKFYLKNVVPSQHLVRPEVMNAFEQSVAGNRDLLDRLAK* |
| Ga0182024_120864473 | 3300014501 | Permafrost | EQALKFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQPLAK* |
| Ga0181536_103546973 | 3300014638 | Bog | NGQTKRHVLEEALRFYLHNVVPSQHLVRREVMDAFEQSVARNRDLLQRLAK* |
| Ga0182034_109533223 | 3300016371 | Soil | IAHYLHNVVPSQHLVRPQVMDAFEESVAHNRDLLERLAK |
| Ga0182037_101698774 | 3300016404 | Soil | PQRYVLEQAIAHYLHNVVPSQHLVRPQVMDAFEESVAHNRDLLERLAK |
| Ga0187856_10041519 | 3300017925 | Peatland | VLEQALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0187825_102410071 | 3300017930 | Freshwater Sediment | RHVLEQALEFYLHNVVPSQHLTRTEVMDAFEQSVARNRELLHRLAK |
| Ga0187801_104212642 | 3300017933 | Freshwater Sediment | EQALKFYLRNVVPSQHLVRPEVMDAFERSVARNRDLLQRLAK |
| Ga0187848_104105532 | 3300017935 | Peatland | DEFVAVAERNGQTKRHVLEEALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0187782_104033763 | 3300017975 | Tropical Peatland | ALAHYLHNVVPSQHLIRPQVMDAFEQSVGRNRDLLERLAK |
| Ga0187782_109531331 | 3300017975 | Tropical Peatland | LHNVVPSQHLVRREVMEAFEESVARNRELLERLAK |
| Ga0187782_115627861 | 3300017975 | Tropical Peatland | DELVAVAEQNGQTRRHVLEQALRFYLHNVVPSQHLVRPEVMDAFGQSVVRNRDLLQRLAK |
| Ga0181520_111007161 | 3300017988 | Bog | NGQSQRYILEQALAFYLHNVVPSQHLVRREVMDAFDQSVAANRDLLQRLAK |
| Ga0187891_10040689 | 3300017996 | Peatland | YVLEQALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0187888_10604811 | 3300018008 | Peatland | LHNVVPSQHLVRPEVMDPFEQSVARNRDRLQRLAK |
| Ga0187885_102453482 | 3300018025 | Peatland | LEQALDHYLHNVVPSQHLVRPQVMDAFEQSVDRNRDLLERLAK |
| Ga0187863_101855082 | 3300018034 | Peatland | ALRPYLHDVVTSQRLVRSEVMDACEQSVDRNRGLLERLANGDWP |
| Ga0187851_100757351 | 3300018046 | Peatland | KNGQTKRHVLEQALKFYLHNVVPSQNLVRPEVMDAFEQSVARNRDLLERLAK |
| Ga0187784_108494543 | 3300018062 | Tropical Peatland | ERNGQTKRHVLEQALRFYLHNVVPSQHIVRREVMDAFEQSVARNRELLERLAK |
| Ga0187770_103949811 | 3300018090 | Tropical Peatland | RFYLENVVPSQHLVRREVMDAFEQSVAANRELLERLAK |
| Ga0187770_112070131 | 3300018090 | Tropical Peatland | RNGQTKRHVLEQALRFYLHNVVPSQHLVRREVMDAFEESVARNRELLERLAK |
| Ga0187770_117799831 | 3300018090 | Tropical Peatland | RNGQTKRHVLEQALRFYLHNVVPSQHLVRREVMDAFEQSVARNRELLERLAK |
| Ga0181510_10339182 | 3300019240 | Peatland | FVAVAKQNGQTKRHVLEQALGFYLHNVVPSQHLVRPAVMDTFEQSVARNRDLLERLAK |
| Ga0182025_13006224 | 3300019786 | Permafrost | SQRHILEEALKFYLKNVVPSQHLVRPEVMDAFEQSVASNRDLLERLAK |
| Ga0182031_13635273 | 3300019787 | Bog | QTKRHVLEEALRFYLHNVVPSQHLVRPEVMEEFEKFAARNHDLLQRLAR |
| Ga0193716_100472710 | 3300020061 | Soil | SPQALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0187768_11631592 | 3300020150 | Tropical Peatland | LHNVVPSQHLVRREVMDAFEESVVRNRELLQRLAK |
| Ga0210407_100058842 | 3300020579 | Soil | VLEEALKFYLKNVVPSQHLVRREVMDALEDSVAGNRELLERPAK |
| Ga0210403_111255332 | 3300020580 | Soil | LRFYLQNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0210388_102672243 | 3300021181 | Soil | AEQNGQTKRHVLEQALAFYLHNVVPSQHLVRPAVMDAFEQSVVRNRDLLQRLAK |
| Ga0210388_111415142 | 3300021181 | Soil | EFVAVAEQNGQTKRHVLEQALAFYLHNVVPSQHLVRPAVMDAFEQSVARNRDLLQRLAK |
| Ga0210388_112532901 | 3300021181 | Soil | NGQTKRHVLEQALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0210393_100913151 | 3300021401 | Soil | LRFYLKNVVPSQHVVRREVMDEFEQSVAKNRDLLQRLAK |
| Ga0210387_101473783 | 3300021405 | Soil | MLEEALKFYLKNVVPSQHLVRREVMDVLEDSVAGNRELLERLAK |
| Ga0210387_111452001 | 3300021405 | Soil | VLEQALAHYLHNVVPSQHLVRREVMSDFEKSVAANRDLLERLAK |
| Ga0210386_115750252 | 3300021406 | Soil | VLEQALRFYLHNVVPSQHLVRREVMDTFEDSVARNRELLERLAK |
| Ga0210391_115239592 | 3300021433 | Soil | LEQALAHYLHNVVPSQHLVRPQVMDAFENSVDRNRDLLERLAK |
| Ga0210402_104450673 | 3300021478 | Soil | EQALAHYLHNVVPSQHLVRPQVMDAFEQSVARNRDLLERLAK |
| Ga0210402_111443142 | 3300021478 | Soil | TKRYVLEQALGFYLHNVVPSQHLVRSEVMDAFEQSVARNRDLLQRLAR |
| Ga0210402_115464562 | 3300021478 | Soil | EKNGQTKRHVLEQALRFYLQNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0210409_113088722 | 3300021559 | Soil | EQALTHYLRNVVPSQHLVRPDVMAAFGRVVDRNRDLLDRLAK |
| Ga0126371_133238391 | 3300021560 | Tropical Forest Soil | TKRHVLEQALKFYLRNVIPSQHLVRPEVMDAFEHSVERNRDLLQRLAK |
| Ga0224550_10399161 | 3300022873 | Soil | VLEEALRFYLQNVVPSQHLVRREVMDAFEQSVARNRDLLERLAK |
| Ga0224557_13049271 | 3300023101 | Soil | RHVLEQALRFYLQNVVPSQHLVRNEVMEEFEQSVARNRDLLDRLAK |
| Ga0224544_10163143 | 3300023250 | Soil | LEEALRFYLQNVVPSQHLVRREVMDAFEQSVARNRDLLERLAK |
| Ga0224572_10452273 | 3300024225 | Rhizosphere | YKEFVAIAKRNGQSQRHVLEEALKFYLKNVVPSQHLVRSEVMNAFEQSVADNRDLLDRLA |
| Ga0209584_101351473 | 3300025878 | Arctic Peat Soil | KFYLHNVVPSQHLVRAEVMDAFQQSVAQNRDLLQRLAK |
| Ga0207692_100521271 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YKEFVADAKRNGQSQRHILEEALKFYLTNVVPSQHLVRRGVMDAFEQSVAGNRELLDRLA |
| Ga0207710_106307382 | 3300025900 | Switchgrass Rhizosphere | SQRYILEKALEHYLHNVVPSQHLVRPGVMDAFEQSMARNHDLLERLAK |
| Ga0207699_110129121 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | HVLEQALRFYLHNVVPSQHLVRREVMDAFEQSVAQNRDLLERLAK |
| Ga0207691_108206723 | 3300025940 | Miscanthus Rhizosphere | YEEMVQVAKQNGQSQRYILEKALEHYLHNVVPSQHLVRPGVMDAFEQSMARNHDLLERLA |
| Ga0207667_102480951 | 3300025949 | Corn Rhizosphere | NGQSQSHILERALEHYLHNVVPSQHVVRRGVMDAFEQSVGRNRDLLDRLAR |
| Ga0209238_11891942 | 3300026301 | Grasslands Soil | KNGQSKRHVLEQALRFYLHNVVPSQQLVRREIMDAFEQSVVQNRDLLERLAK |
| Ga0209473_10708003 | 3300026330 | Soil | LRFYLHNVVPSQQLVRREIMDAFEQSVVQNRDLLERLAK |
| Ga0209804_12283293 | 3300026335 | Soil | FVAVAERNGQTKRHVLEQALRFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0257176_10637971 | 3300026361 | Soil | ALEFYLHNVVPSQHLVRPEVMDAFQQSAARNRELLERLAT |
| Ga0209059_12465882 | 3300026527 | Soil | AVAEQNGQSKRHVLEQALRFYLQNVVPSQHLVRSEIMDAFEQSLARNRDLLQRLAK |
| Ga0209807_12971152 | 3300026530 | Soil | QNRQSQRQVLEQALEFYLRNVVPSQHLVRPEVMDAFQQSVARNRDLLERLAK |
| Ga0209161_102388951 | 3300026548 | Soil | QVLEQALEFYLRNVVPSQHLVRPEVMDAFQQSVARNRDLLERLAK |
| Ga0179587_100319301 | 3300026557 | Vadose Zone Soil | KRHLLEEALRFYLHKVVPSQHLVRPEVMEAFEQSVARNRDLLQRLAE |
| Ga0179587_110787721 | 3300026557 | Vadose Zone Soil | ALRFYLHNVVPSQHLVRTEVMDAFEQSVARNRDLLQRLAK |
| Ga0207821_10287342 | 3300026869 | Tropical Forest Soil | QSQRYLLEQALAHYLHNVVPSQHLVRAEVMRAFEQSAERNRELLERLAR |
| Ga0208199_10238833 | 3300027497 | Peatlands Soil | RYVLEEALKFYLKNVVPSQHLVRREVMEAFEQSVSANRDLLERLAK |
| Ga0209525_10961651 | 3300027575 | Forest Soil | LYDEFVAVAEQNGQTKRHVLEQALGFYLHNVVPSQHLVRPEVLDAFEQSVARNHDLLERLAK |
| Ga0209422_10848011 | 3300027629 | Forest Soil | EEALKFYLKNVVPSQHLVRPDVMNAFEQSVAANRNLLERLAK |
| Ga0209655_100701583 | 3300027767 | Bog Forest Soil | LEQALRFYLHNVVPSQHLVRSEVMDAFEQSVARNRDLLERLAK |
| Ga0209180_100981921 | 3300027846 | Vadose Zone Soil | LEFYLHHVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0209579_102849353 | 3300027869 | Surface Soil | NGQTKRHVLEQALAFYLHNVVPSQHLVRAEVMDAFEQSVARNRDLLQRLAK |
| Ga0209169_104388032 | 3300027879 | Soil | EQALGFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0209275_107457721 | 3300027884 | Soil | ESSLKFYLKNVVPSQHLVRPEVMNDFEQSVARNRDLLDRLAK |
| Ga0209068_104463221 | 3300027894 | Watersheds | VLEQALTHYLRNVVPSQHLVRPDVMAAFGRVVDRNRDLLDRLAK |
| Ga0209624_101909111 | 3300027895 | Forest Soil | VLEQALGFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0209488_103103323 | 3300027903 | Vadose Zone Soil | AVAKQNGQSQRHVLEQALAFYLHNVVPSQHLVRREVMNAFEESVAANRDLLERLAK |
| Ga0209526_104562402 | 3300028047 | Forest Soil | VFYLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0302149_12063242 | 3300028552 | Bog | FYLLNVVPSQHVVRPEVMDAFEQSVDRNRDLLQRLAK |
| Ga0302145_103349811 | 3300028565 | Bog | LEEALKFYLRNVVPAQNLARTEVMKAFEKSVATNRDLLTRLAK |
| Ga0302225_105158381 | 3300028780 | Palsa | HVLEQALRFYLHNVVPSQQLVRREVMEAFEQSVARNRELLERLAK |
| Ga0302155_100355972 | 3300028874 | Bog | ALKFYLRNVVPAQNLARTEVMKAFEKSVATNRDLLTRLAK |
| Ga0222748_11036261 | 3300029701 | Soil | KRNGQSQRHILEEALKFYLKNVVPSQHLVRREVMDAFEQSVSANRDLLERLAK |
| Ga0311358_111093842 | 3300029915 | Bog | NGQSQRHVLEEALKFYLKNVVPSQHLVRPEVMNAFEQSVAVNRDLLERLAK |
| Ga0311343_110722112 | 3300029953 | Bog | LKFYLKNVVPSQHLVRPGVMNAFEQSVAVNRDLLERLAK |
| Ga0302273_11719752 | 3300030048 | Bog | YDEFVAVAERNGQTKRHVLEQALRFYLHNVVPSQHLVRTEVMDAFEQSVARNRDLLQRLA |
| Ga0311349_100519746 | 3300030294 | Fen | YDEFVAVAERNGQTKRHVLEQALRFYLRNVVPSQHLVRAEVMDAFEQSVARNRDLLERLA |
| Ga0302183_102975281 | 3300030509 | Palsa | KRHVLEQALKFYLRNVVPSQHLVRQEVMDAFEQSVAHNRDLLQRLAK |
| Ga0311354_111943853 | 3300030618 | Palsa | TAERNGQTKRHVLEQALRFYLHNVVPSQQLVRREVMEAFEQSVARNRELLERLAK |
| Ga0316363_103957321 | 3300030659 | Peatlands Soil | EEALRFYLRNVVPSQHLVRPEVMEEFEKFAARNHDLLQRLAR |
| Ga0310039_101507473 | 3300030706 | Peatlands Soil | TFYLRNVVPSQHLVRSEVMDAFEQSVARNRDLLRRLAK |
| Ga0310039_102914532 | 3300030706 | Peatlands Soil | GQTKRHVLEEALRFYLRNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0311366_106681722 | 3300030943 | Fen | GQTKRHVLEQALRFYLRNVVPSQHLVRAEVMDAFEQSVARNRDLLERLAK |
| Ga0170824_1013139871 | 3300031231 | Forest Soil | VARQNGQSQRHVLEEALAYYLHNVVPSLHLVRPEVMQVFEESVIRNRELLERLAR |
| Ga0170824_1265426432 | 3300031231 | Forest Soil | FYLDNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0170820_117420242 | 3300031446 | Forest Soil | FYLRNVVPSQHLVRREVMNDFEQSVAANRDLLQRLAK |
| Ga0170820_133206241 | 3300031446 | Forest Soil | RYVLEQALTFYLRNVVPSQHLVRPEVMDAFQQSVARNRDLLQRLAK |
| Ga0170819_170962071 | 3300031469 | Forest Soil | HYLHNVVPSQHLVRPKVMEIFERSAARNRQLLELLAK |
| Ga0302326_131685451 | 3300031525 | Palsa | EFVAVAEQNGQTKRHVLEQALRFYLHNVVPSQHLVRPEVMDAFEESVARNHDLLARLAK |
| Ga0302326_134423531 | 3300031525 | Palsa | DEFVAVAERNGQTKRHVLEQALRFYLHNVVPSQHLVRSEVMDAFEQSVARNRDLLERLAK |
| Ga0318516_106022341 | 3300031543 | Soil | EELTAVAEQNGQTQRHVLEKAIAHYLHNVVPSQHLVRPEVMQAFEDSVRKNSKLLELLAK |
| Ga0310686_1033006172 | 3300031708 | Soil | LTFYLHNVVPAQHLARTEVMKAFEQSVASNRDLLTRLAK |
| Ga0307469_104924843 | 3300031720 | Hardwood Forest Soil | KRHVLEEALKFYLHNVVPSQHLVRSEVMDAFEQSVAHNRDLLQRLAK |
| Ga0307477_108369291 | 3300031753 | Hardwood Forest Soil | HYLHNVVPSQHLVRRGVMDAFEESVARNRDLLDRLAR |
| Ga0307475_107493061 | 3300031754 | Hardwood Forest Soil | QTMGHVLEQALKLYLRNVGPSEDLARREVTDAFDQSVARNRDLLRGLAK |
| Ga0307473_103252851 | 3300031820 | Hardwood Forest Soil | YLHNVVPSQHLVRPEVMDAFEQSVARNRDLLQRLAK |
| Ga0318511_104670511 | 3300031845 | Soil | YLHNVVPSQHLVRPEVMQAFEDSVRKNSKLLELLAK |
| Ga0310913_102450793 | 3300031945 | Soil | IAHDLHNEVPSQHLVRPQVMDAFEESVAHNRDLLERLAK |
| Ga0307479_111599231 | 3300031962 | Hardwood Forest Soil | GQTKRHVLEQALEFYLRNVVPSQHLVRPEVMDAFEESVARNRDLLQRLAK |
| Ga0307479_120101361 | 3300031962 | Hardwood Forest Soil | SQRYVLEQALAHYLHNVVPSQHLVRPQVMDAFEESVERNRDLLERLAK |
| Ga0307471_1000629131 | 3300032180 | Hardwood Forest Soil | TKRYVLERALEFYLHNVVPSQHLVRPEVMDAFQQSVARNRDLLERLAK |
| Ga0307471_1001913881 | 3300032180 | Hardwood Forest Soil | YLHNVVPSQHVVRRGVMDAFEQSVARNRDLLDRLAK |
| Ga0335082_105672223 | 3300032782 | Soil | LEEALRFYLRNVVPSQHIVRAEVMDAFEQSVARNRDLLGRLAK |
| Ga0335079_116246251 | 3300032783 | Soil | AVAEQNGQTKRHVLEQALRFYLHNVVPSQHLVRPEVMDAFEQSIARNRDLLQRLAKQKP |
| Ga0335078_101042525 | 3300032805 | Soil | SQRYILEKALEHYLHNVVPSQHLVRRGVMDAFEQSVARNRDFDRLAK |
| Ga0335080_103019441 | 3300032828 | Soil | GQSQRYILERALEHYLHNVVPSQHLVRRDVMDAFEQSVKRNRDLLERLAR |
| Ga0335077_102311934 | 3300033158 | Soil | FYLHNVVPSQHLVRREVMDAFELSVARNRDLLQRLAK |
| Ga0335077_107665503 | 3300033158 | Soil | QRHVLEEALRFYLRNVVPSQHIVRRAVMDAFDESVARNRELLERLAK |
| Ga0371490_10081791 | 3300033561 | Peat Soil | EFVAVAERNGQTKRHVLEQALGFYLHNVVPSQHLVRSEVMDAFEQSVASNRDLLERLAK |
| ⦗Top⦘ |