| Basic Information | |
|---|---|
| Family ID | F024373 |
| Family Type | Metagenome |
| Number of Sequences | 206 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MMTFTDLASVPSDRLMPFTDQLRLAVAAYLARFKGSSREH |
| Number of Associated Samples | 165 |
| Number of Associated Scaffolds | 206 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.73 % |
| % of genes near scaffold ends (potentially truncated) | 86.41 % |
| % of genes from short scaffolds (< 2000 bps) | 90.78 % |
| Associated GOLD sequencing projects | 158 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.214 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.845 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.864 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 206 Family Scaffolds |
|---|---|---|
| PF09957 | VapB_antitoxin | 7.77 |
| PF07927 | HicA_toxin | 3.88 |
| PF08241 | Methyltransf_11 | 3.40 |
| PF07045 | DUF1330 | 2.43 |
| PF00583 | Acetyltransf_1 | 1.94 |
| PF01850 | PIN | 1.94 |
| PF01152 | Bac_globin | 1.46 |
| PF00589 | Phage_integrase | 1.46 |
| PF08734 | GYD | 1.46 |
| PF11716 | MDMPI_N | 0.97 |
| PF11225 | DUF3024 | 0.97 |
| PF07883 | Cupin_2 | 0.97 |
| PF01548 | DEDD_Tnp_IS110 | 0.97 |
| PF13649 | Methyltransf_25 | 0.97 |
| PF07931 | CPT | 0.97 |
| PF08818 | DUF1801 | 0.97 |
| PF03435 | Sacchrp_dh_NADP | 0.97 |
| PF01966 | HD | 0.97 |
| PF01402 | RHH_1 | 0.97 |
| PF00400 | WD40 | 0.97 |
| PF10861 | DUF2784 | 0.97 |
| PF02776 | TPP_enzyme_N | 0.49 |
| PF13563 | 2_5_RNA_ligase2 | 0.49 |
| PF06475 | Glycolipid_bind | 0.49 |
| PF00701 | DHDPS | 0.49 |
| PF02452 | PemK_toxin | 0.49 |
| PF13683 | rve_3 | 0.49 |
| PF01872 | RibD_C | 0.49 |
| PF00753 | Lactamase_B | 0.49 |
| PF02026 | RyR | 0.49 |
| PF08240 | ADH_N | 0.49 |
| PF03682 | UPF0158 | 0.49 |
| PF00083 | Sugar_tr | 0.49 |
| PF01370 | Epimerase | 0.49 |
| PF13411 | MerR_1 | 0.49 |
| PF13460 | NAD_binding_10 | 0.49 |
| PF12706 | Lactamase_B_2 | 0.49 |
| PF04978 | DUF664 | 0.49 |
| PF14338 | Mrr_N | 0.49 |
| PF13360 | PQQ_2 | 0.49 |
| PF01494 | FAD_binding_3 | 0.49 |
| PF07978 | NIPSNAP | 0.49 |
| PF00805 | Pentapeptide | 0.49 |
| PF12680 | SnoaL_2 | 0.49 |
| PF03483 | B3_4 | 0.49 |
| PF00293 | NUDIX | 0.49 |
| PF06224 | HTH_42 | 0.49 |
| PF04199 | Cyclase | 0.49 |
| PF00196 | GerE | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
|---|---|---|---|
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 3.88 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 2.43 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.46 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 1.46 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.97 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.97 |
| COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.97 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.49 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.49 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.49 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.49 |
| COG3554 | Uncharacterized conserved protein | Function unknown [S] | 0.49 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.49 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.49 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.49 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.49 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.21 % |
| Unclassified | root | N/A | 23.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001449|JGI20208J14878_1015686 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300001593|JGI12635J15846_10366891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
| 3300005178|Ga0066688_10631372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 687 | Open in IMG/M |
| 3300005332|Ga0066388_100561345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1770 | Open in IMG/M |
| 3300005343|Ga0070687_101247463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides gansuensis | 550 | Open in IMG/M |
| 3300005435|Ga0070714_100053462 | All Organisms → cellular organisms → Bacteria | 3447 | Open in IMG/M |
| 3300005435|Ga0070714_100560571 | Not Available | 1094 | Open in IMG/M |
| 3300005436|Ga0070713_101953508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300005437|Ga0070710_10023197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3258 | Open in IMG/M |
| 3300005437|Ga0070710_10813804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300005456|Ga0070678_102319559 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005467|Ga0070706_100429941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1229 | Open in IMG/M |
| 3300005536|Ga0070697_100109024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 2305 | Open in IMG/M |
| 3300005546|Ga0070696_101626775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300005614|Ga0068856_100479057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermostaphylospora → Thermostaphylospora chromogena | 1265 | Open in IMG/M |
| 3300005764|Ga0066903_100796932 | Not Available | 1689 | Open in IMG/M |
| 3300005764|Ga0066903_107473553 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005921|Ga0070766_10321897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 997 | Open in IMG/M |
| 3300006028|Ga0070717_10587797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1010 | Open in IMG/M |
| 3300006175|Ga0070712_100165868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1710 | Open in IMG/M |
| 3300006175|Ga0070712_100180304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1645 | Open in IMG/M |
| 3300006175|Ga0070712_101000130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300006175|Ga0070712_101069478 | Not Available | 699 | Open in IMG/M |
| 3300006175|Ga0070712_101619589 | Not Available | 566 | Open in IMG/M |
| 3300006237|Ga0097621_101129029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300006755|Ga0079222_10047697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1967 | Open in IMG/M |
| 3300006806|Ga0079220_10704023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300006806|Ga0079220_12105366 | Not Available | 505 | Open in IMG/M |
| 3300006893|Ga0073928_10545464 | Not Available | 825 | Open in IMG/M |
| 3300006903|Ga0075426_10743266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300006904|Ga0075424_102755885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300007076|Ga0075435_101369692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300007255|Ga0099791_10248749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 843 | Open in IMG/M |
| 3300009012|Ga0066710_103028851 | Not Available | 653 | Open in IMG/M |
| 3300009089|Ga0099828_11741112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300009090|Ga0099827_10070422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 2697 | Open in IMG/M |
| 3300009090|Ga0099827_11115451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300009174|Ga0105241_11924523 | Not Available | 580 | Open in IMG/M |
| 3300009176|Ga0105242_12657897 | Not Available | 550 | Open in IMG/M |
| 3300009520|Ga0116214_1034848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1817 | Open in IMG/M |
| 3300009698|Ga0116216_10795318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 567 | Open in IMG/M |
| 3300009764|Ga0116134_1254537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300009792|Ga0126374_10728451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
| 3300010043|Ga0126380_10773613 | Not Available | 782 | Open in IMG/M |
| 3300010046|Ga0126384_11198098 | Not Available | 700 | Open in IMG/M |
| 3300010046|Ga0126384_11642410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300010359|Ga0126376_10581018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1055 | Open in IMG/M |
| 3300010360|Ga0126372_10014986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4347 | Open in IMG/M |
| 3300010361|Ga0126378_12577373 | Not Available | 581 | Open in IMG/M |
| 3300010361|Ga0126378_12617274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300010361|Ga0126378_12789423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300010362|Ga0126377_12476881 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010366|Ga0126379_12686626 | Not Available | 595 | Open in IMG/M |
| 3300010373|Ga0134128_10894105 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300010375|Ga0105239_11919381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → unclassified Agromyces → Agromyces sp. Soil535 | 687 | Open in IMG/M |
| 3300010379|Ga0136449_100454070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2247 | Open in IMG/M |
| 3300010379|Ga0136449_102367775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium | 767 | Open in IMG/M |
| 3300010379|Ga0136449_103204434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 632 | Open in IMG/M |
| 3300010396|Ga0134126_10378972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1646 | Open in IMG/M |
| 3300010398|Ga0126383_11299331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 817 | Open in IMG/M |
| 3300012096|Ga0137389_10765496 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012096|Ga0137389_11234842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 640 | Open in IMG/M |
| 3300012200|Ga0137382_10399773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300012200|Ga0137382_10945034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300012201|Ga0137365_11093895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300012206|Ga0137380_10596959 | Not Available | 966 | Open in IMG/M |
| 3300012207|Ga0137381_10550323 | Not Available | 1006 | Open in IMG/M |
| 3300012210|Ga0137378_11141764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 694 | Open in IMG/M |
| 3300012351|Ga0137386_10022352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4285 | Open in IMG/M |
| 3300012353|Ga0137367_10754347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 676 | Open in IMG/M |
| 3300012354|Ga0137366_10380479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300012357|Ga0137384_10154772 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300012960|Ga0164301_10719724 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300012971|Ga0126369_12105835 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012971|Ga0126369_12418728 | Not Available | 611 | Open in IMG/M |
| 3300012989|Ga0164305_11491055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori | 599 | Open in IMG/M |
| 3300013104|Ga0157370_10408345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1250 | Open in IMG/M |
| 3300013105|Ga0157369_10759861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermostaphylospora → Thermostaphylospora chromogena | 997 | Open in IMG/M |
| 3300014968|Ga0157379_10776318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. H30R-01 | 903 | Open in IMG/M |
| 3300015357|Ga0134072_10399353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis anabasis | 541 | Open in IMG/M |
| 3300015372|Ga0132256_102490657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300015374|Ga0132255_102024945 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300015374|Ga0132255_105950539 | Not Available | 516 | Open in IMG/M |
| 3300016270|Ga0182036_10283458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum | 1253 | Open in IMG/M |
| 3300016357|Ga0182032_11240243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300016422|Ga0182039_10265643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1405 | Open in IMG/M |
| 3300017924|Ga0187820_1237744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300017926|Ga0187807_1003521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4798 | Open in IMG/M |
| 3300017928|Ga0187806_1287953 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300017932|Ga0187814_10066398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1323 | Open in IMG/M |
| 3300017943|Ga0187819_10417381 | Not Available | 770 | Open in IMG/M |
| 3300017943|Ga0187819_10782681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 536 | Open in IMG/M |
| 3300017959|Ga0187779_10889765 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300017972|Ga0187781_10266518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
| 3300018007|Ga0187805_10307923 | Not Available | 729 | Open in IMG/M |
| 3300018013|Ga0187873_1117838 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300018037|Ga0187883_10120201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1359 | Open in IMG/M |
| 3300018085|Ga0187772_10393384 | Not Available | 964 | Open in IMG/M |
| 3300018085|Ga0187772_10403655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 952 | Open in IMG/M |
| 3300018085|Ga0187772_11372886 | Not Available | 524 | Open in IMG/M |
| 3300018085|Ga0187772_11418952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea indica | 516 | Open in IMG/M |
| 3300018086|Ga0187769_11336225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 542 | Open in IMG/M |
| 3300020582|Ga0210395_10562962 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300021171|Ga0210405_10905772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300021374|Ga0213881_10051408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1745 | Open in IMG/M |
| 3300021404|Ga0210389_10485043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300021405|Ga0210387_11480493 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021406|Ga0210386_10714955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
| 3300021407|Ga0210383_11579347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300021432|Ga0210384_10497623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
| 3300021433|Ga0210391_10582829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
| 3300021474|Ga0210390_10889194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 733 | Open in IMG/M |
| 3300021479|Ga0210410_11428634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 585 | Open in IMG/M |
| 3300022557|Ga0212123_10103382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 2319 | Open in IMG/M |
| 3300025906|Ga0207699_10797945 | Not Available | 694 | Open in IMG/M |
| 3300025912|Ga0207707_11413505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300025922|Ga0207646_11594518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 563 | Open in IMG/M |
| 3300025922|Ga0207646_11930696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 503 | Open in IMG/M |
| 3300025928|Ga0207700_10441834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1145 | Open in IMG/M |
| 3300025928|Ga0207700_11295766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium ochraceum | 649 | Open in IMG/M |
| 3300025929|Ga0207664_10193239 | Not Available | 1753 | Open in IMG/M |
| 3300025939|Ga0207665_10335660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. H30R-01 | 1138 | Open in IMG/M |
| 3300025939|Ga0207665_11264342 | Not Available | 589 | Open in IMG/M |
| 3300025945|Ga0207679_11184977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 701 | Open in IMG/M |
| 3300026489|Ga0257160_1105119 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300026551|Ga0209648_10512004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300027030|Ga0208240_1010823 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300027652|Ga0209007_1189480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 505 | Open in IMG/M |
| 3300027655|Ga0209388_1144268 | Not Available | 674 | Open in IMG/M |
| 3300027725|Ga0209178_1218943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300027874|Ga0209465_10140049 | Not Available | 1199 | Open in IMG/M |
| 3300027882|Ga0209590_10146728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1459 | Open in IMG/M |
| 3300028072|Ga0247675_1033827 | Not Available | 748 | Open in IMG/M |
| 3300028780|Ga0302225_10229937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 887 | Open in IMG/M |
| 3300028824|Ga0307310_10284334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300029943|Ga0311340_10805690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae | 791 | Open in IMG/M |
| 3300030056|Ga0302181_10310143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 698 | Open in IMG/M |
| 3300030056|Ga0302181_10345091 | Not Available | 652 | Open in IMG/M |
| 3300030058|Ga0302179_10437298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300030618|Ga0311354_10727544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 946 | Open in IMG/M |
| 3300030706|Ga0310039_10354831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300031525|Ga0302326_13619359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 511 | Open in IMG/M |
| 3300031549|Ga0318571_10240553 | Not Available | 662 | Open in IMG/M |
| 3300031549|Ga0318571_10263604 | Not Available | 637 | Open in IMG/M |
| 3300031561|Ga0318528_10169293 | Not Available | 1166 | Open in IMG/M |
| 3300031561|Ga0318528_10506062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 649 | Open in IMG/M |
| 3300031561|Ga0318528_10793689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300031573|Ga0310915_11172622 | Not Available | 532 | Open in IMG/M |
| 3300031708|Ga0310686_104913562 | Not Available | 656 | Open in IMG/M |
| 3300031715|Ga0307476_11028747 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031718|Ga0307474_10804109 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300031724|Ga0318500_10663411 | Not Available | 530 | Open in IMG/M |
| 3300031747|Ga0318502_10167731 | Not Available | 1259 | Open in IMG/M |
| 3300031748|Ga0318492_10355655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300031770|Ga0318521_10822039 | Not Available | 567 | Open in IMG/M |
| 3300031771|Ga0318546_10957826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium mesophilum | 602 | Open in IMG/M |
| 3300031771|Ga0318546_11100292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300031778|Ga0318498_10128269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
| 3300031797|Ga0318550_10495468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 590 | Open in IMG/M |
| 3300031819|Ga0318568_10157118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1392 | Open in IMG/M |
| 3300031819|Ga0318568_10683366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium persicum | 638 | Open in IMG/M |
| 3300031819|Ga0318568_10834068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300031832|Ga0318499_10290821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300031833|Ga0310917_10552448 | Not Available | 783 | Open in IMG/M |
| 3300031846|Ga0318512_10384247 | Not Available | 705 | Open in IMG/M |
| 3300031880|Ga0318544_10032321 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300031890|Ga0306925_11273758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 732 | Open in IMG/M |
| 3300031893|Ga0318536_10318743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 788 | Open in IMG/M |
| 3300031896|Ga0318551_10134602 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300031910|Ga0306923_10982798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
| 3300031942|Ga0310916_11287755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300031942|Ga0310916_11454941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum | 560 | Open in IMG/M |
| 3300031981|Ga0318531_10436500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300032001|Ga0306922_11789521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300032025|Ga0318507_10491394 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032039|Ga0318559_10144728 | Not Available | 1077 | Open in IMG/M |
| 3300032043|Ga0318556_10062499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1826 | Open in IMG/M |
| 3300032043|Ga0318556_10747907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300032055|Ga0318575_10455363 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300032059|Ga0318533_11143106 | Not Available | 570 | Open in IMG/M |
| 3300032076|Ga0306924_10659784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
| 3300032076|Ga0306924_11755838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300032160|Ga0311301_10851779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1239 | Open in IMG/M |
| 3300032160|Ga0311301_11166230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 992 | Open in IMG/M |
| 3300032160|Ga0311301_11944391 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300032261|Ga0306920_100043629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6493 | Open in IMG/M |
| 3300032782|Ga0335082_11474133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 551 | Open in IMG/M |
| 3300032805|Ga0335078_10324458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2057 | Open in IMG/M |
| 3300032805|Ga0335078_10559657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1453 | Open in IMG/M |
| 3300032828|Ga0335080_10920492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PKU-MA01144 | 895 | Open in IMG/M |
| 3300032828|Ga0335080_11347186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300032892|Ga0335081_11629798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300032892|Ga0335081_12157603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300032898|Ga0335072_10625610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1075 | Open in IMG/M |
| 3300032898|Ga0335072_10817698 | Not Available | 888 | Open in IMG/M |
| 3300032954|Ga0335083_10099432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2871 | Open in IMG/M |
| 3300032955|Ga0335076_10535565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → unclassified Actinomycetales → Actinomycetales bacterium | 1054 | Open in IMG/M |
| 3300033158|Ga0335077_11627927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300033289|Ga0310914_10881243 | Not Available | 794 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.40% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.49% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.49% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.49% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.49% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001449 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20208J14878_10156861 | 3300001449 | Arctic Peat Soil | AFVSSDSPVPRADPLRLAVAAYLARFTGSSREHTESE* |
| JGI12635J15846_103668911 | 3300001593 | Forest Soil | MMTFTELAPAPSDPPEPFTDRLRLAVAAYLARFKGSSREHTE |
| Ga0066688_106313721 | 3300005178 | Soil | MSFTELAPVPSDPAALFTDRLRLAVAAYLARFKGSSREHTE |
| Ga0066388_1005613451 | 3300005332 | Tropical Forest Soil | MMNFTELASVPSDPLVPLTDRLRLAVAGNLARFKGSSRYHTESDL |
| Ga0070687_1012474632 | 3300005343 | Switchgrass Rhizosphere | MMNFPNPASLPSDRPPTFTDQLRLAVAAYLARFKGSSREHTASDLR |
| Ga0070714_1000534621 | 3300005435 | Agricultural Soil | MMTFSELPPVPSDHLVLLSDQLRLAVAAYLARFKGASRYHT |
| Ga0070714_1005605713 | 3300005435 | Agricultural Soil | MTTFTQATLTSSDLPEPFTNRLRLGVAAYLARFKGPSRERTCPISSSAGAG |
| Ga0070713_1019535081 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGHDDFTELASASSDRLVPFTDQLRLAVAAYLTRFKGSSREHT |
| Ga0070710_100231973 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSFADLPSVPSDDLAPFTDQLRLAVAAYLARFKGASRYHT |
| Ga0070710_108138041 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRFTDLASVPTGLPEPFTDRMRLAVAAYLARFKGSSREHTESD |
| Ga0070678_1023195592 | 3300005456 | Miscanthus Rhizosphere | MTNFTELPSVPSDHLVPFTDQLRLAVTAYLAAKGSSREHTE |
| Ga0070706_1004299411 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTFTELPSVPSDSLVPFTGQLRLAVAAYLARFKGSSRYHTESDLRC |
| Ga0070697_1001090242 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTFIERASAPSHPPAPFTDQLRLAVAAYLARFKGSSREH |
| Ga0070696_1016267751 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNFTELPSVPSDHLVPFTDQLRLAVTAYLALKGSSREHTESDLRCYLA |
| Ga0068856_1004790573 | 3300005614 | Corn Rhizosphere | MTTFTPLAPVPSDPPGPFIDQLRLAVAAYLARFKG |
| Ga0066903_1007969321 | 3300005764 | Tropical Forest Soil | MMSFTDLTSVPTDHPAPFTDQLRLAVAAYLARFASSSRQHT |
| Ga0066903_1074735532 | 3300005764 | Tropical Forest Soil | MMTFTGPPSVPSDSLVPFTDQLRLAVAAYLSRFAGPSREHTEI* |
| Ga0070766_103218971 | 3300005921 | Soil | MMTFSDLASVPRDPLAPFTASCAWQQPAYLARFKGSSRAHTE |
| Ga0070717_105877973 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTFSDLASVPCDPLVPFTDQLLTDQLRLAVAAR* |
| Ga0075432_101850072 | 3300006058 | Populus Rhizosphere | MLAQCLGMRNFTELPSVPSGHPVPVTDPLRLAVAAYLARFK |
| Ga0070712_1001658681 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTFTQLTSASSHPSEPFTDQLRLAVAAYLARFKGS |
| Ga0070712_1001803042 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSSTPLVPASSDPPEPFTGQLRLAVAAYLARFTGSSREHTESDLR* |
| Ga0070712_1010001301 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MATFTELAFASSDPPEPFTDRLRLAVAAYLARFKGSS |
| Ga0070712_1010694783 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFTELASAPSPPLAPFTDRLRLAVAAYLARFKGS |
| Ga0070712_1016195892 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPFTQMTLTSSGPPEPFTDRLRLAVAAYLARFKGSS |
| Ga0097621_1011290291 | 3300006237 | Miscanthus Rhizosphere | MMTFTELAQAPSDPPEPFTDRLRLAVAAYLARFKGSS |
| Ga0079222_100476971 | 3300006755 | Agricultural Soil | MMNSTGLTPNPSDYLVPLTDQLRLAVAAYLARFQGSSRDHTE |
| Ga0079220_107040231 | 3300006806 | Agricultural Soil | MMTFTQLALTSSGPAEPFTERLRLAVAAYLAGFKGSSREHIESD |
| Ga0079220_121053661 | 3300006806 | Agricultural Soil | MQTQCLGMRNFTELPSVPSNHLVAFTDQLRLAVAAYLARFK |
| Ga0073928_105454642 | 3300006893 | Iron-Sulfur Acid Spring | MMTSRGLASVPADAPAPFTDRLWLVVAACLARFKGSSRERAD |
| Ga0075426_107432663 | 3300006903 | Populus Rhizosphere | MTSSPPALASSDPPGPFTDQLRLAVAAYLARFKGSSREH |
| Ga0075424_1027558851 | 3300006904 | Populus Rhizosphere | MMNFTELPPVPSDRLVPVTDQLRLAVAAYLARFKGSSREHT |
| Ga0075435_1013696921 | 3300007076 | Populus Rhizosphere | MKNLTTLGSAVSDPPVPFTDQLRLAVAAYLARFKGS |
| Ga0099791_102487493 | 3300007255 | Vadose Zone Soil | MMNFPAPAPATFDRSACADPLRLAVAAYLARFKGSSREHTES |
| Ga0066710_1030288511 | 3300009012 | Grasslands Soil | MTTFTQLTSASSHPAEPFTDQLQRAVAAYLARFKG |
| Ga0099828_117411121 | 3300009089 | Vadose Zone Soil | MMNFTELASVPSDRPVPLTDQLRLAVAAYLAAGPD |
| Ga0099827_100704223 | 3300009090 | Vadose Zone Soil | MTNFTEPAPIPSDRPVPFIDRLRLAMAACLARFTGSSREHTESDLR* |
| Ga0099827_111154511 | 3300009090 | Vadose Zone Soil | MKNFTDLPSVPSDHLVPSTDQLRLAVAAYLARFKGASRYHTESDL |
| Ga0105241_119245231 | 3300009174 | Corn Rhizosphere | MMSSTDLTFVPADQPAPFTDQLRLAVAAYLARFTGPSRQHTE |
| Ga0105242_126578971 | 3300009176 | Miscanthus Rhizosphere | MTTFTELASVPSDPMAPFTDQLRLAVAAYLARFKGIS |
| Ga0116214_10348484 | 3300009520 | Peatlands Soil | MMNLTDLAPEPSDPLAPYTDRLRLAVSAYLARFQGSS |
| Ga0116216_107953182 | 3300009698 | Peatlands Soil | MMTFTELASVPSGPLALFTDRLRLAVAACLARFKGSSRAHTDR |
| Ga0116134_12545372 | 3300009764 | Peatland | MTNFTDLVSVPSDPPVPFTDQLRLAVAAYLARFKGASRDHI |
| Ga0126374_107284512 | 3300009792 | Tropical Forest Soil | MMSFTDLASVPADHPEPFPDQLRLAVAAYLARFTALREPA* |
| Ga0126380_107736133 | 3300010043 | Tropical Forest Soil | MTNSTKLTSAPSNRPVPFADQLRLAVAAYLARFKGSSRSHTE |
| Ga0126384_111980982 | 3300010046 | Tropical Forest Soil | MMNLTEPPSVPSGCVVPFTGQLPLAVAACLARFKGCSCEHTESDLGCYLA* |
| Ga0126384_116424102 | 3300010046 | Tropical Forest Soil | MMSFIDLSSNPSDHLLPRTDQLRLAVAAYLARFKGSSR |
| Ga0126376_105810181 | 3300010359 | Tropical Forest Soil | MTTFTQLTPASSDPPEPFTDPLRLAVAAYLAPFKGSSREHTE |
| Ga0126372_100149864 | 3300010360 | Tropical Forest Soil | MMSFTDLTSVPADHPAPLTDQLRLAVAAYLARFTGPTRGHTESDLRC* |
| Ga0126378_125773731 | 3300010361 | Tropical Forest Soil | MLNLTDLAPVSSDPLAPFTDRLRLAVAAYLTRFKGT |
| Ga0126378_126172741 | 3300010361 | Tropical Forest Soil | MMNFTDLPSVPSDDLVPFTDQLRLAVAAYLARFKSSSR* |
| Ga0126378_127894231 | 3300010361 | Tropical Forest Soil | MMTFADQPSPVPSDHLVLLPDQLRLAVAAYLARFTGTSRYH |
| Ga0126377_124768812 | 3300010362 | Tropical Forest Soil | MMTFTDLASVPSNPLAPFTDRLRLAVAAYLARFKGSSRE |
| Ga0126379_126866261 | 3300010366 | Tropical Forest Soil | MMSFTDLTSVPTDHPAPFTDQLCLAVAAYLARFASSSRQHTESD |
| Ga0134128_108941052 | 3300010373 | Terrestrial Soil | MTNFTELPSVPSDHLVPFIDQLRLAVAAYLARFKGSSRYHTESDL |
| Ga0105239_119193812 | 3300010375 | Corn Rhizosphere | MMTFTELASVPSDPMAPFTDRLRLAVAAYLARFKGISRNRT |
| Ga0126381_1013399501 | 3300010376 | Tropical Forest Soil | MLNLTDLASAPSDPVVPCTDRLRLAVAAYLARFPGISRNRTESDLRCYLASRAERGPGSACR |
| Ga0136449_1004540703 | 3300010379 | Peatlands Soil | MMTFTELVPSAGDPPPEPFTDRLRLAVAAYLARFKG |
| Ga0136449_1023677751 | 3300010379 | Peatlands Soil | MMSFTDLASVPGNSPEPFDDRLRLAVAAYLARFKGSSPRAH* |
| Ga0136449_1032044342 | 3300010379 | Peatlands Soil | MTTFTQLTPAPSDPPEPFTDRLRLAVAAYLARFKGSS |
| Ga0134126_103789721 | 3300010396 | Terrestrial Soil | MTTFSVLASVPSDPLVPFTDQLRLAMAAHLARFKGSSREHTESDLRC* |
| Ga0126383_112993311 | 3300010398 | Tropical Forest Soil | MVNFPDRPSVPADHPALVTDQLRLASAAHLARFTRVLSADTESDLRCHLSWCA |
| Ga0137389_107654961 | 3300012096 | Vadose Zone Soil | MANFTELTPVPSDRPVPAADPLRLAVAAYLARFKDSSREHTESDLR |
| Ga0137389_112348421 | 3300012096 | Vadose Zone Soil | MMAFSDLASVPSDPLPPFTDRLRPAPAAYLARFKGS |
| Ga0137382_103997732 | 3300012200 | Vadose Zone Soil | MMNFTDLASVPSHPLAPFTDRLRLAVAAYLARFKG |
| Ga0137382_109450341 | 3300012200 | Vadose Zone Soil | MMTFSDLASVPSDPPAPFTDQLRLAVAAYLARFKGSSRE |
| Ga0137365_110938951 | 3300012201 | Vadose Zone Soil | MMTSTPLAPTLSNPPEPFTDQLRLAAAAYLARFKGSSREHTESDLR |
| Ga0137380_105969591 | 3300012206 | Vadose Zone Soil | MTNFTELTSVPSDCLEPPLDKLRLAMAAYLARFKGS |
| Ga0137381_105503231 | 3300012207 | Vadose Zone Soil | MTNFTELASVPSDRPVPHADQLRLAVAAYLARFTGSSREHTESDLRC |
| Ga0137378_111417643 | 3300012210 | Vadose Zone Soil | MMAFSDLASVPSDPLAPFTDRLRLAAAAYLARFKGSSREHTESD |
| Ga0137386_100223521 | 3300012351 | Vadose Zone Soil | MTNFTELPSVPSDHLVPFTDQLRLAVAAYLARFKGSSREHT |
| Ga0137367_107543471 | 3300012353 | Vadose Zone Soil | MLNFTDLASVPSHPLAPFTDRLRLAVAAYLARFSEL |
| Ga0137366_103804793 | 3300012354 | Vadose Zone Soil | MMTFTDLASVPSDPPAPFTDQLQLAVAAYLASFKGSSREHTESDLRC |
| Ga0137384_101547723 | 3300012357 | Vadose Zone Soil | MMSFPELPSAPPDHLVPVTDQLRLAVAAYLARFKGSSR |
| Ga0164301_107197241 | 3300012960 | Soil | MTSTPLVPASSDPPEPFTGQLRLAVAAYLARFTGSSREHTESDLR* |
| Ga0126369_121058352 | 3300012971 | Tropical Forest Soil | MMNFAELPSVPSDYRVPFTDQLRLRVAAYLARFKGSSRYHTASDLRCYL |
| Ga0126369_124187282 | 3300012971 | Tropical Forest Soil | MMTFTELAFAPSGLPTPFTGRLRLAVAAYLARFTGPPATAPDAV* |
| Ga0164305_114910551 | 3300012989 | Soil | MSSTPLVPASSDPPEPFTGQLRLAVAAYLARFTGSSREHTESDLR* |
| Ga0157370_104083453 | 3300013104 | Corn Rhizosphere | MMTFTELASVPSDPMAPFTDQLRLAVAAYLARFKG |
| Ga0157369_107598612 | 3300013105 | Corn Rhizosphere | MTTFTPLAPVPSDPPRPFTDQLRLAVAAYLARFKGASREHIESDLR |
| Ga0157379_107763182 | 3300014968 | Switchgrass Rhizosphere | MMTFTELASAPSDLPVPFTDQLRLAVAAYLGRFKGSSREHTASDM |
| Ga0134072_103993531 | 3300015357 | Grasslands Soil | GMMTSTSLAPTLFNPPEPFTDQLRPAAAYLARKD* |
| Ga0132256_1024906571 | 3300015372 | Arabidopsis Rhizosphere | MRAQCLGMMTSKELASAPSDRPMVFTEQLRLAVAAYLARFKGSSRE |
| Ga0132255_1020249451 | 3300015374 | Arabidopsis Rhizosphere | MMNSTDLSSGPSDYLVPRPDQLRLAVVAYLARFQGSSRDHTESDL |
| Ga0132255_1059505391 | 3300015374 | Arabidopsis Rhizosphere | MMNFTDIASVPSHPLAPFTDRLRLAVAAYLARFKGTSR |
| Ga0182036_102834582 | 3300016270 | Soil | MMTFTDLASVPSDPAAPSTDRLRLAVAAYLARFKGSSREHTE |
| Ga0182032_112402431 | 3300016357 | Soil | MLTVSDLALVPSDPPAPVTDQLRLAAAACLARFKGS |
| Ga0182039_102656433 | 3300016422 | Soil | MMNSRNLSSDPSDRLAPLTDQLRLAVAAYLARFQGSSRDHT |
| Ga0187820_12377442 | 3300017924 | Freshwater Sediment | MTTFTELACAPSDPAVPFTDRLRLAVAAYLARFTGSSCEHTESDLRCYLAT |
| Ga0187807_10035218 | 3300017926 | Freshwater Sediment | MTTFTQLVPAPSDPPEPFTDRLRLAVAAYLARFKG |
| Ga0187806_12879532 | 3300017928 | Freshwater Sediment | MMTFTELAPAASDPPEPFTDRLRLAVAAYLARFKGSSREHTG |
| Ga0187814_100663981 | 3300017932 | Freshwater Sediment | FTDLASVPTDPSEPFTDRLRLAVAAYLARFKGFSRQCTESDLRC |
| Ga0187819_104173812 | 3300017943 | Freshwater Sediment | MSFTDLASVPTDPSEPFTDRLRLAVAAYLARFKGFSRQCTESDLRC |
| Ga0187819_107826812 | 3300017943 | Freshwater Sediment | MMNSTELASVPSDRPAPFTDQLRLAVAAYLARFKG |
| Ga0187779_108897652 | 3300017959 | Tropical Peatland | MTNLTTPGPALSSPPVPFTDQLRLAVAAYLARFTGS |
| Ga0187781_102665183 | 3300017972 | Tropical Peatland | MTTFTQLTSTPSCPPEPFTDQLRLAVAAYLARFKG |
| Ga0187805_103079231 | 3300018007 | Freshwater Sediment | LASLSPDPAAPFTDRLRLAVAAYLARFKGSSRERRF |
| Ga0187873_11178381 | 3300018013 | Peatland | MQTQRQFMMNSPDLVSTSSNRLGPFTDQLRLAVAAYLARFRGSSREHTE |
| Ga0187883_101202011 | 3300018037 | Peatland | MTTFTQLALTSSDPPEPFTDRLRLAVAAYLARFKGAS |
| Ga0187772_103933842 | 3300018085 | Tropical Peatland | MVNLTDLASAPSDHLAPFTDRLRLAVAAYLARFKGSS |
| Ga0187772_104036551 | 3300018085 | Tropical Peatland | MHSQDMMTFTELASVPSDPLAPFTDQLRLAVAAYLARF |
| Ga0187772_113728861 | 3300018085 | Tropical Peatland | MTFSDLASVPPDPPAPFTDRLRLAVAAYLARFKGSSCEHTESD |
| Ga0187772_114189522 | 3300018085 | Tropical Peatland | MPNFTDLASVPPHPQAPFTDRLRLAVAAHLARFTGSFRRCTESDLRSYL |
| Ga0187769_113362252 | 3300018086 | Tropical Peatland | MHSQDMMTFTELASVPSDPLAPFTDQLRLAVAAYLARFSELELLPGI |
| Ga0210395_105629621 | 3300020582 | Soil | MTFTELATVASDPPEPFTDRLRLAVAAYLARFKGSSR |
| Ga0210405_109057721 | 3300021171 | Soil | MTFSDLASVPSDPLAPFTDQLRLAAVAYLARFKGSSASTPNLTSA |
| Ga0213881_100514082 | 3300021374 | Exposed Rock | GSQSMMIFSDLASVPCDPLATFTDRLRLAVAAYLARFKGSSRQHAEKWS |
| Ga0213875_104678792 | 3300021388 | Plant Roots | MRAQCLGMRTTFTDLPSLPSHSLAPFTDQLRLAVAAYLARFHGS |
| Ga0210389_104850432 | 3300021404 | Soil | MTNFTELASISSGRPGPSADQLRLAVAAYLARFKGSSREHTEPDLRC |
| Ga0210387_114804931 | 3300021405 | Soil | MTFTELAPAASDPPEPFTDRLRLAVAACQARFKRS |
| Ga0210386_107149551 | 3300021406 | Soil | MKTFTELTSAPSDLPAPFTDQLRLAVAAYLARFKGSSREHNESEL |
| Ga0210383_115793472 | 3300021407 | Soil | MTTFTQLTSASSHPPEPFTDQLRLAVGAYLARFKGSSREHTES |
| Ga0210384_104976231 | 3300021432 | Soil | MMTFSDLASVPCDPLAPFTDQLRLAVAAYLARFKGSSRE |
| Ga0210391_105828293 | 3300021433 | Soil | MMNFAEPPPTPSDRLVPHGDPLQLAVAAYLARFKGSSRYHTA |
| Ga0210390_108891942 | 3300021474 | Soil | FTELASISSGRPGPSADQLRLAVAAYLARFKGSSREHTEPDLRC |
| Ga0210392_107088252 | 3300021475 | Soil | GMLAQRLGMRNFTELPSVPSDHLVAVTEPLRLAVAAYLARFKGVLPRAHRL |
| Ga0210410_114286341 | 3300021479 | Soil | MSSTPLVPASSDPPEPFTGQLRLAVAAYLARFTGSSREHTESDLR |
| Ga0212123_101033821 | 3300022557 | Iron-Sulfur Acid Spring | MNRAQCLGMMNFTDLPSVPSDHPAPSTDQLRLAAAAYLTRFTGPSR |
| Ga0207699_107979451 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAQCLGMMTSTALASVPSEGLAPFTNQLQLAVAAYLARFKGSSREHT |
| Ga0207707_114135052 | 3300025912 | Corn Rhizosphere | MEVAQCLGMMNFTELPPVPSDRLVPVTDQLRLAVAAYLARFKGSSREH |
| Ga0207646_115945182 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MMNFPDRASIPSDYPAPWTDRLRLAVAAHLARFTG |
| Ga0207646_119306962 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTFTDLASIPSDPLTPFTDQLRLAVAAYLARFKG |
| Ga0207700_104418342 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNLTDLVPAPSDPLAPFTDRLWLAVAAYLARFTGTSRNRTE |
| Ga0207700_112957662 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTPLVPASSDPPEPFTDQLRLAVAAYLARFKGSSREHT |
| Ga0207664_101932394 | 3300025929 | Agricultural Soil | MMTFSDLASVPSDPLVPFTDQLRLAVAAYLARFKGSSR |
| Ga0207665_103356601 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTPLAPALSNPPEPFTDQLRLAVAAYLARFKGSSREHTES |
| Ga0207665_112643421 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFPDLASLPSDRPATFTDQLRLAMAAYLARFKGSSRYHT |
| Ga0207679_111849772 | 3300025945 | Corn Rhizosphere | MTSSPLALASSDPPEPFTDQLRLAVAAYLARFKGSS |
| Ga0257160_11051192 | 3300026489 | Soil | MRNLTDLASVPSGSLAPFTDRLRLAVAAYLARFKGISRNRTESDLR |
| Ga0209648_105120041 | 3300026551 | Grasslands Soil | MTPFTGLAPAPSDPPEPFADQLRLAVTSCLARFKGSSREHTESDLRCHPSW |
| Ga0208240_10108232 | 3300027030 | Forest Soil | MMTFTELAPAASDPPEPFTDRLRLAVAAYLACFKGSS |
| Ga0209007_11894802 | 3300027652 | Forest Soil | MITFTDLASVPSHPSEPFTDRLRLAVAAYLARFKGS |
| Ga0209388_11442682 | 3300027655 | Vadose Zone Soil | MKSFIDLSSVPSDHLVPSTDQLRLAVAAYLARFKGAS |
| Ga0209178_12189431 | 3300027725 | Agricultural Soil | MMNFTELASASSDRLVPFTDQLRLAVAAYLTRFKGSSREHTESDLR |
| Ga0209465_101400491 | 3300027874 | Tropical Forest Soil | MMTFTDLASIPSNDPAPFIDQPRLAVAAYLARFTGSSREHTESD |
| Ga0209590_101467282 | 3300027882 | Vadose Zone Soil | MTNFTEPAPIPSDRPVPFIDRLRLAMAACLARFTGSSREHTESDLR |
| Ga0247675_10338271 | 3300028072 | Soil | MEVAQCLGMMNFTELPPVPSDRLVPVTDQLRLAVAAYLARFKGSS |
| Ga0302225_102299373 | 3300028780 | Palsa | MKTFTELTSAPSDLPAPFTDQLRLAVAAYLARFKGSSREH |
| Ga0307310_102843343 | 3300028824 | Soil | MTTFSDLASVPSDPLVPFTGQLRLAVAAYLARFKGCS |
| Ga0311340_108056901 | 3300029943 | Palsa | MTSFTDLASVPGNSPEPFDDRLRLAVAAYLARFKGSSFEHTASDLRCYLA |
| Ga0302181_103101432 | 3300030056 | Palsa | MMNFTELAPVPHDPLMPFTDQLQLAVAAYLARFKGSSRDHTE |
| Ga0302181_103450911 | 3300030056 | Palsa | MKHYSELASIPSSNPVPHADPLRLAVAAYLARFKGASRDHTHSDLRC |
| Ga0302179_104372982 | 3300030058 | Palsa | MMTFSELASAASDLPEPFTDRLRLAVAAYLARFKGSSRAHTE |
| Ga0311354_107275441 | 3300030618 | Palsa | MMTFSELASAASDLPEPFTDRLRLAVAAYLARFKGSCRAH |
| Ga0310039_103548311 | 3300030706 | Peatlands Soil | MMDFTELAFAPSPPLAPFTDQLRLAVAAYLARFKGSSREHTES |
| Ga0302326_136193592 | 3300031525 | Palsa | MNYAELASIPSDHPGPFTDQLRLAVAAYLARFKSTS |
| Ga0318571_102405532 | 3300031549 | Soil | MMTFTELPSVPSDHLVPFTDQLRLAVAAYLARFTGSSRE |
| Ga0318571_102636041 | 3300031549 | Soil | MMTFTDLASVPSDRLMPFTDQLRLAVAAYLARFKGSSREH |
| Ga0318528_101692931 | 3300031561 | Soil | MMSFTDLTSVPADHPAPFTDQLRLAVAAYLARFTGSSRGHT |
| Ga0318528_105060622 | 3300031561 | Soil | MRNLPELPSAPSDRQVPFTDQLQLVAAAYLGRFNGSSRYHTASDLR |
| Ga0318528_107936892 | 3300031561 | Soil | MNFPDLVSVPPDHPAPFADQLRLAMSAYLARFTGSSREHTEYD |
| Ga0310915_111726221 | 3300031573 | Soil | MTTFTQLTSAPSHPPEPFTDQLRLAVAAYLARFKDSSREHTES |
| Ga0310686_1049135622 | 3300031708 | Soil | MPNFTDLASVSSHPLAPFTDRLQPAVAAYLARCKGAHRRCTESDLRCYLTA |
| Ga0307476_110287472 | 3300031715 | Hardwood Forest Soil | MVVSRRNLKGMMTFTELTPAASDLPEPFTDRLRLAVAACLARFKGSSRAHTESTSCVGSLVQ |
| Ga0307474_108041092 | 3300031718 | Hardwood Forest Soil | MVVSRRNLKGMMTFTELTPAASDLPEPFTDRLRLAVAACLARFKGSSRAH |
| Ga0318500_106634113 | 3300031724 | Soil | MPSIPLVPVSSDPPEPFTGQLRLAAAAYLARFTGSS |
| Ga0318502_101677311 | 3300031747 | Soil | MMSFTDLTSVPADHPAPFTDQLRLAVAAYLARFTGSSRGHTESDLR |
| Ga0318492_103556551 | 3300031748 | Soil | MRNFTELACVRSDQPAPCTDQLRLAVAAYLARFQGSSREHTES |
| Ga0318521_108220392 | 3300031770 | Soil | MMTFTELPSVPSDHLVPFTDQLRLAVAAYLARFTGSSREHPESDLR |
| Ga0318546_109578262 | 3300031771 | Soil | MTNLTDLPSLPSGRLVPVTDQLRLAVAAYLALEAEHES |
| Ga0318546_111002922 | 3300031771 | Soil | MMTFTDLASAPSGPVAPFTDRLRLAVSAYLARFKGSSREH |
| Ga0318498_101282691 | 3300031778 | Soil | MMNSRNLSSDPSDRLAPLTDQLRLAVAAYLARFQGSSRDH |
| Ga0318550_104954681 | 3300031797 | Soil | MINLTDLASVPSDPLAPFTDRLRLAVAAYLVRFTGSSRRCTES |
| Ga0318523_105007182 | 3300031798 | Soil | MLNLTDLASVPSAHLAPFTDQLRLAVAAYLTRFTGTSRRCTESDLRCYLA |
| Ga0318568_101571181 | 3300031819 | Soil | MITFTGLPSVPSDPLVPFTDQLRLAVAAYLSRFTGSSREHTESDLRC |
| Ga0318568_106833662 | 3300031819 | Soil | MMNFAEQAAVSSDRLVPLTDQLRLAVAAYLARFTGSS |
| Ga0318568_108340682 | 3300031819 | Soil | MNFPDLVSVPPDHRAPFTDQLRLAMSAYLARFTGS |
| Ga0318499_102908213 | 3300031832 | Soil | MNFTDLASVPSHALAPFTDRLRLAVAAYLARFSELGRCAR |
| Ga0310917_105524482 | 3300031833 | Soil | MSFTDLTSVPADHPAPFTDQLRLAVAAYLARFTGSSRGHTESDL |
| Ga0318512_103842471 | 3300031846 | Soil | MMTFTELPSVPSDHLVPFTDQLRLAVAAYLARFTGSSREHTE |
| Ga0318495_101133021 | 3300031860 | Soil | MLNLTDLASVPSDSLAPFTDRLRLAVAAYLARFKRISRKSALNSPG |
| Ga0318544_100323214 | 3300031880 | Soil | MITFTERAPAASDPPEPFTGRLRLAIAAHLARFKGFSR |
| Ga0306925_112737582 | 3300031890 | Soil | MINLTDLASVPSDPLAPFTDRLRLAVAAYLVRFTGSSRRCTESDLRCYL |
| Ga0318536_103187431 | 3300031893 | Soil | MMTFTGLPSVPSDDLVPFTAQLRLAVAAYLARFKGSSRQHSESDLRCCLA |
| Ga0318551_101346021 | 3300031896 | Soil | MTNFTELVPAPSDPAALFTDRLRLAVTAYLARFKGASRQR |
| Ga0318520_103148223 | 3300031897 | Soil | MLNLTDLASVPSDSLAPFTDRLRLAVAAYLARFKRISRKSALN |
| Ga0306923_109827981 | 3300031910 | Soil | MNFPDLVSVPPDHPAPFADQLRLAMSAYLARFTGSSRQHTESD |
| Ga0310916_112877551 | 3300031942 | Soil | MMNLTTLGSAPADPVLFTDRLRLAVAAYLARFKGSSREHTGSDLRC |
| Ga0310916_114549412 | 3300031942 | Soil | MMTFTDLASVPSDPAAPSTDRLRLAVAAYLARFKG |
| Ga0318531_104365002 | 3300031981 | Soil | MLNLTDLASVPSAHLAPFTDQLRLAAAAYLTRFTGTSRRC |
| Ga0306922_117895212 | 3300032001 | Soil | MTFNDLVSAPSGPLAPCTDRLRLAAAAYLARFKGSS |
| Ga0318507_104913942 | 3300032025 | Soil | RKLAQCLGMMNFPELPSAPPDHPAPFTDQLRLAVAAYLARF |
| Ga0318559_101447281 | 3300032039 | Soil | MSFTDLTSVPADHPAPFTDQLRLAVAAYLARFTGSSRGHTESDLRC |
| Ga0318556_100624992 | 3300032043 | Soil | MRNLPELPSAPSDRQVPFTDQLQLVAAAYLGRFNGSSRYHTASDLRCYLADDLGMRPVPE |
| Ga0318556_107479071 | 3300032043 | Soil | MMTFTELASVPSDPAAPSTDRLRLAVAAYLARFKGS |
| Ga0318575_104553631 | 3300032055 | Soil | VPGHANLTGLAFVLSDPLAPFTDRLRLAAAACLARFTGIFRHRTESWPPT |
| Ga0318533_111431063 | 3300032059 | Soil | MMTFTELATVPSDPLAPFTGQLRLAMAAYLVRFMGSSRAHTES |
| Ga0306924_106597842 | 3300032076 | Soil | MMNSRNLSSDPSDRLAPLTDQLRLAVAAYLARFQGSSRD |
| Ga0306924_117558381 | 3300032076 | Soil | MNFTDLASVPSHPPAPFTDRLRLAVAAYLARFTGISRNRTESDL |
| Ga0311301_108517791 | 3300032160 | Peatlands Soil | MQTQRQFMMNSPDLVSTSSDRLGPFTDQLRLAVAAYLARFRGSSRE |
| Ga0311301_111662301 | 3300032160 | Peatlands Soil | MMNLTDLAPEPSDPLAPYTDRLRLAVSAYLARFQGSSRQRTESDLRCC |
| Ga0311301_119443912 | 3300032160 | Peatlands Soil | MTTFTQLAPAPSDPPEPFTDRLRLAVAAYLARFKG |
| Ga0306920_1000436297 | 3300032261 | Soil | MMSFTELPSVPSDDLVPFTAQLRLAVAAYLARFKGSSR |
| Ga0335082_114741332 | 3300032782 | Soil | MMTFTDLASVPPHPLAPFTDRLRLAVAAYLARFKGSSHEHTQ |
| Ga0335078_103244584 | 3300032805 | Soil | MKNLTTLGSAPSDPPVPFTDQLRLAVAAYLARFKGS |
| Ga0335078_105596574 | 3300032805 | Soil | MMTFSDLASVPSDPLVPFTDQLRLAVAAYLALLTELCLEFQQFSG |
| Ga0335080_109204922 | 3300032828 | Soil | MKNFTGLPAVPSGHLVPSTDRLRLAVAAYLARFKGASR |
| Ga0335080_113471863 | 3300032828 | Soil | MMTFSDLAAVPPDPPAPFTDQLRLAAAAYLARFKGSSREHTESD |
| Ga0335081_116297982 | 3300032892 | Soil | MMTFTELAPAASDPSEPFTDRLRLAVAAYLARFKGSSREHTESH |
| Ga0335081_121576031 | 3300032892 | Soil | MMDFAELASMAADPPTPFTDRLRLPVAAYLARFKGSS |
| Ga0335072_106256102 | 3300032898 | Soil | MRNFTDLASVPSHHLAPFTDRLRLAVAAYLARFKGSSRL |
| Ga0335072_108176981 | 3300032898 | Soil | MTSTQLIRTPSDPPEPFTDQLRLAVAAYLARFKGSSREH |
| Ga0335083_100994325 | 3300032954 | Soil | MITFTDLASVPSHPSEPFTNRLRLAVAAYLARFKG |
| Ga0335076_105355652 | 3300032955 | Soil | MKNLTTLGSAPSDPPVPFTDQLRLAVAAYLARFKG |
| Ga0335077_116279271 | 3300033158 | Soil | MRNFTDLASVPSHHLAPFTDRLRLAVAAYLARFKGSS |
| Ga0310914_108812432 | 3300033289 | Soil | MMTFTDLASVPSDRLMPFTDQLRLAVAAYLARFKGS |
| ⦗Top⦘ |