Basic Information | |
---|---|
Family ID | F024371 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 206 |
Average Sequence Length | 40 residues |
Representative Sequence | MKWRSLEESSPGTDLRPLREIFAERKELIAKYVPAETQA |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 206 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 45.85 % |
% of genes near scaffold ends (potentially truncated) | 98.06 % |
% of genes from short scaffolds (< 2000 bps) | 90.29 % |
Associated GOLD sequencing projects | 164 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.243 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.165 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.214 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.602 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 206 Family Scaffolds |
---|---|---|
PF02978 | SRP_SPB | 64.56 |
PF14534 | DUF4440 | 5.83 |
PF00850 | Hist_deacetyl | 2.43 |
PF00072 | Response_reg | 1.94 |
PF12867 | DinB_2 | 1.94 |
PF12158 | DUF3592 | 1.46 |
PF09969 | DUF2203 | 1.46 |
PF02272 | DHHA1 | 0.97 |
PF00111 | Fer2 | 0.97 |
PF12686 | DUF3800 | 0.97 |
PF14103 | DUF4276 | 0.49 |
PF07883 | Cupin_2 | 0.49 |
PF05187 | ETF_QO | 0.49 |
PF01613 | Flavin_Reduct | 0.49 |
PF13520 | AA_permease_2 | 0.49 |
PF00082 | Peptidase_S8 | 0.49 |
PF07676 | PD40 | 0.49 |
PF07279 | DUF1442 | 0.49 |
PF13175 | AAA_15 | 0.49 |
PF05163 | DinB | 0.49 |
PF01156 | IU_nuc_hydro | 0.49 |
PF00578 | AhpC-TSA | 0.49 |
PF13578 | Methyltransf_24 | 0.49 |
PF13426 | PAS_9 | 0.49 |
PF14885 | GHL15 | 0.49 |
PF00989 | PAS | 0.49 |
COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
---|---|---|---|
COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 64.56 |
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.85 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.49 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.49 |
COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.49 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
COG2440 | Ferredoxin-like protein FixX | Energy production and conversion [C] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.24 % |
Unclassified | root | N/A | 24.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908043|A2_c1_ConsensusfromContig13562 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100070910 | All Organisms → cellular organisms → Bacteria | 3213 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100286635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1532 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101661891 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300003218|JGI26339J46600_10042829 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300004101|Ga0058896_1373797 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300004152|Ga0062386_100695910 | Not Available | 834 | Open in IMG/M |
3300005186|Ga0066676_10418670 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300005353|Ga0070669_101205440 | Not Available | 654 | Open in IMG/M |
3300005435|Ga0070714_100049572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3574 | Open in IMG/M |
3300005435|Ga0070714_102293036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 525 | Open in IMG/M |
3300005440|Ga0070705_100423233 | Not Available | 992 | Open in IMG/M |
3300005561|Ga0066699_10918104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300005569|Ga0066705_10036523 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
3300005569|Ga0066705_10890841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300005598|Ga0066706_10273530 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
3300005764|Ga0066903_108681199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300005842|Ga0068858_101399007 | Not Available | 689 | Open in IMG/M |
3300005921|Ga0070766_10766477 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300005950|Ga0066787_10090051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300006052|Ga0075029_100477330 | Not Available | 820 | Open in IMG/M |
3300006052|Ga0075029_100958821 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300006059|Ga0075017_100147602 | Not Available | 1672 | Open in IMG/M |
3300006059|Ga0075017_100546785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 882 | Open in IMG/M |
3300006059|Ga0075017_101143884 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300006059|Ga0075017_101303324 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300006102|Ga0075015_100806075 | Not Available | 564 | Open in IMG/M |
3300006162|Ga0075030_101158415 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300006175|Ga0070712_100254440 | Not Available | 1405 | Open in IMG/M |
3300006176|Ga0070765_100903299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 835 | Open in IMG/M |
3300006176|Ga0070765_102268902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300006358|Ga0068871_101049816 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300006800|Ga0066660_10969601 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300006800|Ga0066660_11291531 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300006852|Ga0075433_10187292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1841 | Open in IMG/M |
3300006854|Ga0075425_102634188 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300006871|Ga0075434_101911652 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300006893|Ga0073928_10832729 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300009090|Ga0099827_10873008 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300009093|Ga0105240_11648340 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300009137|Ga0066709_100279786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2253 | Open in IMG/M |
3300009162|Ga0075423_11105267 | Not Available | 844 | Open in IMG/M |
3300009162|Ga0075423_11941874 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300009628|Ga0116125_1097009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 785 | Open in IMG/M |
3300009644|Ga0116121_1236663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 583 | Open in IMG/M |
3300009700|Ga0116217_10929285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300010301|Ga0134070_10089268 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300010358|Ga0126370_10220626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1448 | Open in IMG/M |
3300010358|Ga0126370_12290658 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010360|Ga0126372_11378909 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300010360|Ga0126372_13110771 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300010361|Ga0126378_11033832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
3300010361|Ga0126378_12102891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300010366|Ga0126379_10319407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1569 | Open in IMG/M |
3300010379|Ga0136449_100104516 | All Organisms → cellular organisms → Bacteria | 5791 | Open in IMG/M |
3300010379|Ga0136449_102250013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
3300010398|Ga0126383_11413341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
3300010398|Ga0126383_12555698 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300010937|Ga0137776_1032430 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300011270|Ga0137391_11208249 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300011270|Ga0137391_11274132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300011411|Ga0153933_1077099 | Not Available | 708 | Open in IMG/M |
3300012096|Ga0137389_11313787 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012189|Ga0137388_10824728 | Not Available | 859 | Open in IMG/M |
3300012199|Ga0137383_11189266 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012209|Ga0137379_11746768 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300012357|Ga0137384_11585686 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300012361|Ga0137360_11426813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300012363|Ga0137390_10655153 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300012918|Ga0137396_10564347 | Not Available | 843 | Open in IMG/M |
3300012918|Ga0137396_10793786 | Not Available | 696 | Open in IMG/M |
3300012923|Ga0137359_10193470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1817 | Open in IMG/M |
3300012929|Ga0137404_10834752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group | 838 | Open in IMG/M |
3300012930|Ga0137407_10679089 | Not Available | 969 | Open in IMG/M |
3300012930|Ga0137407_10946842 | Not Available | 815 | Open in IMG/M |
3300012944|Ga0137410_11923598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli → Fimbriimonas ginsengisoli Gsoil 348 | 524 | Open in IMG/M |
3300012971|Ga0126369_11995339 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300012984|Ga0164309_11076056 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300013104|Ga0157370_10607938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1001 | Open in IMG/M |
3300013296|Ga0157374_11038430 | Not Available | 839 | Open in IMG/M |
3300013308|Ga0157375_13107978 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300014168|Ga0181534_10395772 | Not Available | 763 | Open in IMG/M |
3300015054|Ga0137420_1280232 | Not Available | 1365 | Open in IMG/M |
3300015264|Ga0137403_10078560 | Not Available | 3336 | Open in IMG/M |
3300015373|Ga0132257_103640222 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300016702|Ga0181511_1206054 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
3300016750|Ga0181505_10697342 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300017924|Ga0187820_1073024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
3300017932|Ga0187814_10425560 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300017933|Ga0187801_10070580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas oleovorans/pseudoalcaligenes group → Pseudomonas oleovorans | 1293 | Open in IMG/M |
3300017943|Ga0187819_10407234 | Not Available | 781 | Open in IMG/M |
3300017943|Ga0187819_10433825 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300017946|Ga0187879_10096349 | Not Available | 1698 | Open in IMG/M |
3300017961|Ga0187778_11050010 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300017972|Ga0187781_10027861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3903 | Open in IMG/M |
3300017974|Ga0187777_10920884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300017975|Ga0187782_10603437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
3300017995|Ga0187816_10020247 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
3300017995|Ga0187816_10209308 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300018007|Ga0187805_10542597 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300018033|Ga0187867_10463299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
3300018037|Ga0187883_10157793 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300018044|Ga0187890_10417431 | Not Available | 753 | Open in IMG/M |
3300018062|Ga0187784_11514348 | Not Available | 531 | Open in IMG/M |
3300018085|Ga0187772_11000430 | Not Available | 611 | Open in IMG/M |
3300019787|Ga0182031_1302144 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300019879|Ga0193723_1106756 | Not Available | 786 | Open in IMG/M |
3300019890|Ga0193728_1187639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
3300020001|Ga0193731_1015811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1956 | Open in IMG/M |
3300020006|Ga0193735_1078253 | Not Available | 947 | Open in IMG/M |
3300020580|Ga0210403_10107902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2260 | Open in IMG/M |
3300020580|Ga0210403_10581498 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300020581|Ga0210399_10242615 | Not Available | 1501 | Open in IMG/M |
3300020581|Ga0210399_10857017 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300020581|Ga0210399_11569740 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300021088|Ga0210404_10034651 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
3300021170|Ga0210400_10250126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1450 | Open in IMG/M |
3300021181|Ga0210388_10500510 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300021181|Ga0210388_10615201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin510 | 949 | Open in IMG/M |
3300021181|Ga0210388_11287137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300021401|Ga0210393_11000907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300021432|Ga0210384_11141114 | Not Available | 683 | Open in IMG/M |
3300021559|Ga0210409_10500301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
3300021560|Ga0126371_12649820 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 607 | Open in IMG/M |
3300022531|Ga0242660_1040856 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300022713|Ga0242677_1036522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300022872|Ga0224526_1020754 | Not Available | 1501 | Open in IMG/M |
3300023255|Ga0224547_1033871 | Not Available | 659 | Open in IMG/M |
3300024176|Ga0224565_1034163 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300024288|Ga0179589_10425389 | Not Available | 611 | Open in IMG/M |
3300025427|Ga0208077_1037885 | Not Available | 682 | Open in IMG/M |
3300025527|Ga0208714_1060351 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300025906|Ga0207699_11359811 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300025910|Ga0207684_11684729 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300025915|Ga0207693_10085507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2470 | Open in IMG/M |
3300025915|Ga0207693_11005237 | Not Available | 636 | Open in IMG/M |
3300025917|Ga0207660_10478799 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300025924|Ga0207694_10271812 | Not Available | 1390 | Open in IMG/M |
3300025927|Ga0207687_11334130 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300025939|Ga0207665_10501506 | Not Available | 938 | Open in IMG/M |
3300025942|Ga0207689_10662084 | Not Available | 880 | Open in IMG/M |
3300025945|Ga0207679_11000532 | Not Available | 766 | Open in IMG/M |
3300026035|Ga0207703_11396660 | Not Available | 673 | Open in IMG/M |
3300026041|Ga0207639_11689623 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300026322|Ga0209687_1189628 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300026528|Ga0209378_1153720 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300026538|Ga0209056_10034973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4683 | Open in IMG/M |
3300027076|Ga0208860_1028285 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300027172|Ga0208098_1015555 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300027383|Ga0209213_1024257 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300027603|Ga0209331_1148772 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300027641|Ga0208827_1009831 | All Organisms → cellular organisms → Bacteria | 3667 | Open in IMG/M |
3300027645|Ga0209117_1052082 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300027737|Ga0209038_10076934 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300027738|Ga0208989_10067860 | Not Available | 1224 | Open in IMG/M |
3300027767|Ga0209655_10158046 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300027795|Ga0209139_10075890 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300027812|Ga0209656_10217847 | Not Available | 917 | Open in IMG/M |
3300027846|Ga0209180_10116452 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300027854|Ga0209517_10401562 | Not Available | 770 | Open in IMG/M |
3300027855|Ga0209693_10159455 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300027874|Ga0209465_10534853 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300027879|Ga0209169_10365985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300027882|Ga0209590_10880985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300027889|Ga0209380_10187885 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300027889|Ga0209380_10351427 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300027889|Ga0209380_10852442 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300027895|Ga0209624_10583722 | Not Available | 742 | Open in IMG/M |
3300027905|Ga0209415_10765257 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300028381|Ga0268264_10458109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1237 | Open in IMG/M |
3300028574|Ga0302153_10195671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300028639|Ga0302168_1023888 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300028740|Ga0302294_10011281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2106 | Open in IMG/M |
3300028857|Ga0302289_1147563 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300028873|Ga0302197_10339248 | Not Available | 672 | Open in IMG/M |
3300030053|Ga0302177_10585718 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300030677|Ga0302317_10342137 | Not Available | 665 | Open in IMG/M |
3300031057|Ga0170834_107161228 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300031231|Ga0170824_100323709 | Not Available | 771 | Open in IMG/M |
3300031241|Ga0265325_10315226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 696 | Open in IMG/M |
3300031446|Ga0170820_12920643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300031521|Ga0311364_11652514 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300031718|Ga0307474_11212019 | Not Available | 597 | Open in IMG/M |
3300031718|Ga0307474_11659807 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031720|Ga0307469_11935044 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300031823|Ga0307478_11501075 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300031912|Ga0306921_10461577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1479 | Open in IMG/M |
3300031954|Ga0306926_10129069 | All Organisms → cellular organisms → Bacteria | 3123 | Open in IMG/M |
3300031954|Ga0306926_10359412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1800 | Open in IMG/M |
3300031962|Ga0307479_10812555 | Not Available | 910 | Open in IMG/M |
3300031962|Ga0307479_11641528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
3300032160|Ga0311301_10187265 | All Organisms → cellular organisms → Bacteria | 3594 | Open in IMG/M |
3300032174|Ga0307470_10003177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6274 | Open in IMG/M |
3300032174|Ga0307470_10311472 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300032174|Ga0307470_10750449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300032180|Ga0307471_100781121 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300032205|Ga0307472_100708375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
3300032261|Ga0306920_100583519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1655 | Open in IMG/M |
3300032770|Ga0335085_12293583 | Not Available | 540 | Open in IMG/M |
3300032782|Ga0335082_10122179 | Not Available | 2554 | Open in IMG/M |
3300032783|Ga0335079_11608168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300032805|Ga0335078_12379321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli → Fimbriimonas ginsengisoli Gsoil 348 | 551 | Open in IMG/M |
3300032898|Ga0335072_11618962 | Not Available | 545 | Open in IMG/M |
3300032955|Ga0335076_10999220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
3300033289|Ga0310914_10478665 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.34% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.34% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.88% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.40% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.91% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.91% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.94% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.46% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.97% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.97% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.97% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.97% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.49% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.49% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.49% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.49% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.49% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.49% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300004101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022872 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25 | Environmental | Open in IMG/M |
3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
3300028639 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_2 | Environmental | Open in IMG/M |
3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
3300028857 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_2 | Environmental | Open in IMG/M |
3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A2_c1_00684410 | 2124908043 | Soil | VKWRALEESAQNTDTRALREIFAERKALIDRYVPEET |
JGIcombinedJ26739_1000709101 | 3300002245 | Forest Soil | MKWRSLEESVSESDLRPLRDIFAERKELIAKYVPAETQAIQARAV |
JGIcombinedJ26739_1002866352 | 3300002245 | Forest Soil | MMKWRSVEESALGADTRPLRDIFAQRKELIAKYVPPET |
JGIcombinedJ26739_1016618912 | 3300002245 | Forest Soil | MKWRSLEESAPTTDIRSLRQIFAERKELIAKYVPP |
JGI26339J46600_100428291 | 3300003218 | Bog Forest Soil | MKWRWHEESGLSLDRRPLREIFAERKELIAKYVPPETEAI |
Ga0058896_13737972 | 3300004101 | Forest Soil | MKWRSLEESSPDTDTRLLREIYVERKELIAKYVPAETQAV |
Ga0062386_1006959102 | 3300004152 | Bog Forest Soil | MKWRSLQESDSFSDLRPLREILAERKELIAKYVPADVQAVHARAIA |
Ga0066676_104186701 | 3300005186 | Soil | MKWRSLEESGPSQDMRPLREQFAERKALIAKYVPPETQAI |
Ga0070669_1012054401 | 3300005353 | Switchgrass Rhizosphere | MKWRSLEESAENTDLRSLREIYAERKLLIDRYVPDEVRGIHARVVG |
Ga0070714_1000495725 | 3300005435 | Agricultural Soil | MKWRSLEESHPSSDVRPLREIFAERKELIAKYVPAETQAIHAQ |
Ga0070714_1022930361 | 3300005435 | Agricultural Soil | MKWRSLEEKDSGLDFRPLREIYAERKELIAKYVPAEAQAVHAAAV |
Ga0070705_1004232331 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPPDIQGVHARVI |
Ga0066699_109181042 | 3300005561 | Soil | MKWRSLEETSAVPETRSLREVLAERKELIAKYVPAEIQAVHAR |
Ga0066705_100365235 | 3300005569 | Soil | MKWRSLEESTTGADTRTLGEVFAERKELIAKYVPAE |
Ga0066705_108908412 | 3300005569 | Soil | MKWRSLEETSAVPETRSLREVLAERKELIAKYVPAE |
Ga0066706_102735301 | 3300005598 | Soil | MKWRSLEESGPSQDMRPLREQFAERKALIAKYVPPETQAIH |
Ga0066903_1086811991 | 3300005764 | Tropical Forest Soil | MKWRSLEESSTGVDTRSLREQFAERKALIARYVLPEVEA |
Ga0068858_1013990072 | 3300005842 | Switchgrass Rhizosphere | MKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPPDIQ |
Ga0070766_107664772 | 3300005921 | Soil | MKWRSLEKSTPGTDTRSLRDILSERKELIVRYVPPDIQAVHARVI |
Ga0066787_100900512 | 3300005950 | Soil | MKWRSLEESGPSTDIRPLREIFAERKGLIAKYVPPDTQAIH |
Ga0075029_1004773302 | 3300006052 | Watersheds | MKWRSLQESGSSTDTRSLREIFAERKELIAKYVPADVQAV |
Ga0075029_1009588212 | 3300006052 | Watersheds | MKWRSLDESDATADTRPLREIFAERKELIAKYVPAETQA |
Ga0075017_1001476022 | 3300006059 | Watersheds | MKWRSLQESGSSTDTRSLREIFAERKELIAKYVPADVQ |
Ga0075017_1005467852 | 3300006059 | Watersheds | MKWRSLQESGSYDDTRPLRQIFAERKELIAKYVPADVQAIH |
Ga0075017_1011438842 | 3300006059 | Watersheds | MKWRSLEESGPATDFRLLREIYAERKELIAKYVPAETQAVHAQAV |
Ga0075017_1013033241 | 3300006059 | Watersheds | MKWRSLAESTPGTDARSLRDIYAERKELIARYVPRET |
Ga0075015_1008060752 | 3300006102 | Watersheds | MKWRSLDEAVPPEDTRSLHDQFAERKAVIAKYVLPE |
Ga0075030_1011584151 | 3300006162 | Watersheds | MKWRSLEESGPATDVRPLREIYAARKELIAKYVPAETQNIHAQ |
Ga0070712_1002544402 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWRSLEDSTPGTDTRSLQDIFAEREALVAKYVPPDIQGVHAR |
Ga0070765_1009032992 | 3300006176 | Soil | MKWRSLEESTARADVRPLREIYAERKELIAKYVPAETQAVHA |
Ga0070765_1022689021 | 3300006176 | Soil | MKWRSLEEASPDTDIRPLRDIFAERKELIAKYVPAE |
Ga0068871_1010498162 | 3300006358 | Miscanthus Rhizosphere | MKWRSLEESTAEADLRPLKEIFAERKELIAKYVPAETQAI |
Ga0066660_109696011 | 3300006800 | Soil | MMKWRSREESSTRTDTRSLREQFAERKALISQYVPSETQAVHERV |
Ga0066660_112915312 | 3300006800 | Soil | MKWRSLEESTFAAETRSLSEIFVERKQLIAQYVPAE |
Ga0075433_101872924 | 3300006852 | Populus Rhizosphere | MKWRSLEESAWQPQSRTLREVYDERKQLIAQYVPAEIQAV |
Ga0075425_1026341881 | 3300006854 | Populus Rhizosphere | MKWRSLEESAVAADNRPLRDQLAERKQLIEKYVPEA |
Ga0075434_1019116521 | 3300006871 | Populus Rhizosphere | MKWRSLEESSQEETRTLRQIYAERKELIAKYVPADIQAIHARVV |
Ga0073928_108327293 | 3300006893 | Iron-Sulfur Acid Spring | MKWRSLGDSNPGLDSRPLHAILTERKELIAKYVPR |
Ga0099827_108730082 | 3300009090 | Vadose Zone Soil | MKWRSLEESTPGADLRPLREQFAERKDLIAKYVPPE |
Ga0105240_116483402 | 3300009093 | Corn Rhizosphere | MKWRSLEESTPGTDTRSLRDIYAERKELIARYVPSETQAVH |
Ga0066709_1002797863 | 3300009137 | Grasslands Soil | MRWRSLDETTLAVDTRSLRDQFAERKELVAKYVPAEI |
Ga0099792_104048982 | 3300009143 | Vadose Zone Soil | MKWRSLAEAGSYTDERPLAEVFAERKDLIAKYVPADVQAVHARTVA |
Ga0075423_111052672 | 3300009162 | Populus Rhizosphere | MKWRSLDEASQSSDLRPLLDIFAERKELIAKYVPQ |
Ga0075423_119418741 | 3300009162 | Populus Rhizosphere | MKWRSLEESGEYSDTRPLREIFAERKALIAQYVPPATQAIHEKVVS |
Ga0116125_10970093 | 3300009628 | Peatland | MKWRSLQESKPLSETRPLREIFAQRRESIAQYVPAE |
Ga0116121_12366631 | 3300009644 | Peatland | MKWRSLEESSPETDIRPLREIFAERKEMIAKYVPAETQAI |
Ga0116217_109292852 | 3300009700 | Peatlands Soil | MKWRSLEESGPTTDLRPLREIYAERKELIAKYVPAET |
Ga0134070_100892681 | 3300010301 | Grasslands Soil | MKWRSLEESNPGIDTRTLREQLAERKELIAKYVPLDAQAVHV |
Ga0126370_102206263 | 3300010358 | Tropical Forest Soil | VKWRSLEEPAVGIDTRPLRDQFAERKQLIAKYVPAEVQAIH |
Ga0126370_122906581 | 3300010358 | Tropical Forest Soil | MKWRSLQESGPYSDTRPLKQIFAERQQTIVRYVPAD |
Ga0126372_113789093 | 3300010360 | Tropical Forest Soil | MTWRSLEESAVAADNRPLRDQLAERKQLIEKYVPEPVR |
Ga0126372_131107711 | 3300010360 | Tropical Forest Soil | MKWRSLEESPIQLETRTLREIYAERKELIAKYVPAEIQAV |
Ga0126378_110338321 | 3300010361 | Tropical Forest Soil | MKWRSLDEETAGQATRSLREIYAERKELIAKYVPPGVLSVHRGVV |
Ga0126378_121028911 | 3300010361 | Tropical Forest Soil | MTMKWRSLEESAPATDIRPLRDIYAERKELIAKYVPAETQ |
Ga0126379_103194073 | 3300010366 | Tropical Forest Soil | MKWRSLEESAPGADARSLREQFAERKELIARYVPRETQTVHER |
Ga0136449_1001045168 | 3300010379 | Peatlands Soil | VKWRSLDEAAPVEDTRSLHEQFAERKELIGKYVPPETQAI |
Ga0136449_1022500133 | 3300010379 | Peatlands Soil | MKWRSLEEQSPETDVRALREIFAERTELIAKYVAAET |
Ga0126383_114133411 | 3300010398 | Tropical Forest Soil | MKWRSLEESSPATDIRPLHEIYAERKESIAKYAPAATQKVHAQAVA |
Ga0126383_125556982 | 3300010398 | Tropical Forest Soil | MKWRSIEESSPPTDLRPLREIYAERKELIAKYVPPDTQAVHAHAVA |
Ga0137776_10324301 | 3300010937 | Sediment | MKWRSLSESNPSVDFRPLREIYAERKELIAKYVPAETQA* |
Ga0137391_112082491 | 3300011270 | Vadose Zone Soil | MKWPSLEESTPGTETRSLHEIFAERKELIAKYVPPETQ |
Ga0137391_112741322 | 3300011270 | Vadose Zone Soil | MKWRSLEEHAPAQDTRTLREQFAERKALIAKYVPPETQA |
Ga0153933_10770991 | 3300011411 | Attine Ant Fungus Gardens | MKWRSLEESDPETEARPLREIFAERKELIAKYVPAETQVI |
Ga0137389_113137871 | 3300012096 | Vadose Zone Soil | MKWRSLQESAGATDVRPLREVFAERKGLIARYVPPDVQA |
Ga0137388_108247281 | 3300012189 | Vadose Zone Soil | MKWRSLEESTAPTDLRSLRDILAERKELIAKYVPTET |
Ga0137383_111892662 | 3300012199 | Vadose Zone Soil | MKWRSLEESDSQQESRSLQDILAERKALIAKYVPAEIQDVHS |
Ga0137379_117467682 | 3300012209 | Vadose Zone Soil | MKWRSLEESGSYSDTRPLRQIFAERKETIARYVPADVRAIH |
Ga0137384_115856862 | 3300012357 | Vadose Zone Soil | MKWRSLDESAAQTETRPLCEIYAERKELIAKYVPA |
Ga0137360_114268131 | 3300012361 | Vadose Zone Soil | MKWRSLEESSPGIDTRSLREIYAERKVLIAKYVPAETQA |
Ga0137390_106551533 | 3300012363 | Vadose Zone Soil | MKWRSLEEHAPAQDTRTLREQFAERKALIAKYVPSET |
Ga0137396_105643471 | 3300012918 | Vadose Zone Soil | MKWHSLEESSQETDTRSLREIFAERKGLIAKYVPPET |
Ga0137396_107937861 | 3300012918 | Vadose Zone Soil | MKWRSLEESSPRTDTRSLREVFAERKKLIARYVSP |
Ga0137359_101934701 | 3300012923 | Vadose Zone Soil | MKWRSLAETESQTDQRPLREIFAGRKELIAKYVPADVQAVHEGTVATL |
Ga0137404_108347522 | 3300012929 | Vadose Zone Soil | MKWRSLQESGVSTDIRPLREIFNERKDLIAKYVPPEAQAI |
Ga0137407_106790891 | 3300012930 | Vadose Zone Soil | MKWRSLEESTPRADTRSLQEIFAERQELIAKYVPADIQAVHAR |
Ga0137407_109468422 | 3300012930 | Vadose Zone Soil | MKWRSLAESDSQTDQRPLREIFAGRKELIAKYVPADVQAVHE |
Ga0137410_119235981 | 3300012944 | Vadose Zone Soil | MKWRSLETNDTDLRPLREIYAERKGLIEKYVPQEIRDVHARVVV |
Ga0126369_119953391 | 3300012971 | Tropical Forest Soil | MKWRSLQESQSTSDLRPLRQIFAERKDTIAKYVPPDVQAVHA |
Ga0164309_110760563 | 3300012984 | Soil | MKWRSLEESGPSTDLRPLRDIYAERKGLIARYLPA |
Ga0157370_106079382 | 3300013104 | Corn Rhizosphere | MKWRSLEESAPGTDARLLRDIYAERKELIARYVPPETQAVHAG |
Ga0157374_110384302 | 3300013296 | Miscanthus Rhizosphere | MKWRSLDEASQSSDLRPLLDIFAERKELIAKYVPQETRDIHARVVA |
Ga0157375_131079781 | 3300013308 | Miscanthus Rhizosphere | MKWRSLEESGEYNDTRPLREIFAERKKLIAQYVPPATQAIHERVV |
Ga0181534_103957721 | 3300014168 | Bog | MKWRSLEESGSYDDTRPLRQIFAERKATIAKYVPADV |
Ga0137420_12802322 | 3300015054 | Vadose Zone Soil | MMKWRSVEESALGTDSRPLRDILAQRKELIAKYVPPET |
Ga0137403_100785602 | 3300015264 | Vadose Zone Soil | MKWRSLSKSTPGLDTRPLQEIFAQKKERIAQYVQPETQAGTDEPA* |
Ga0132257_1036402222 | 3300015373 | Arabidopsis Rhizosphere | MKWRSLEESAPGTEARPLRDIYAERKELIARYVPPETQAVHA |
Ga0181511_12060543 | 3300016702 | Peatland | MKWRSLQESGSYSDLRPLREIFAERKDAIAKYVPADVQAVHA |
Ga0181505_106973421 | 3300016750 | Peatland | MKWRSLEESGPATDLRPLREIFTERKELIAKYVPPET |
Ga0187820_10730242 | 3300017924 | Freshwater Sediment | MKWRSLEESVPATDQRPLREVFAERRDLIAKYVPPETQ |
Ga0187814_104255602 | 3300017932 | Freshwater Sediment | MKWRWHEESGSSLDRRALHDIYAERKELAAKYVPA |
Ga0187801_100705802 | 3300017933 | Freshwater Sediment | MKWRSLEESGSYDDSRPLRQIFAERKELIAKYVPADVQAIH |
Ga0187819_104072341 | 3300017943 | Freshwater Sediment | MKFRSLEEAAPRTDKRPLREILAERKQLMAKYVPPETL |
Ga0187819_104338251 | 3300017943 | Freshwater Sediment | MKWRSLEESNDVDVRPLREIFAERRELIAKYVPAATQAVH |
Ga0187879_100963492 | 3300017946 | Peatland | MKWRSLEESSPETDTRALREIFAERKELIAKYVPVETQA |
Ga0187778_110500101 | 3300017961 | Tropical Peatland | MKWRSLDEAGPATDTRRLHDIYAERKELIAKYVPAETQ |
Ga0187781_100278614 | 3300017972 | Tropical Peatland | MKWRSLNESSAGVDPRTLREQFAERKALIAKYVTPETQAVHARAIRE |
Ga0187777_109208842 | 3300017974 | Tropical Peatland | MKWRSLDESNTAVDPRTLREQFAERKALIAQYVLPEVQAVHARVIRE |
Ga0187782_106034371 | 3300017975 | Tropical Peatland | MKWRSLDESSRGPDPRPLREQFSERKALVAKYVPPEVQAVH |
Ga0187816_100202473 | 3300017995 | Freshwater Sediment | MKWRSLEESGPATDLRPLREIYAERKDLIAKYVPAETQAVHA |
Ga0187816_102093081 | 3300017995 | Freshwater Sediment | MKWRSLQESGSYSDVRPLREIFAERKELIAKYVPADV |
Ga0187805_105425972 | 3300018007 | Freshwater Sediment | MKWRSLDESDATADTRPLREVFAERRELIAKYVPAET |
Ga0187867_104632991 | 3300018033 | Peatland | MKWRSLQESGSYSDMRPLREIFAERKELIAKYVPAD |
Ga0187883_101577931 | 3300018037 | Peatland | MKWRSLRESGCYNDFRPLREIFAERKDAIAKYVPAD |
Ga0187890_104174312 | 3300018044 | Peatland | MKWRSLEESSPETDIRPLREIFAERKEMIAKYVPAETQAIH |
Ga0187784_115143481 | 3300018062 | Tropical Peatland | MKWRWHENSDVILDRRPLREIYAERKEMIARYVPAETLAVHAQAI |
Ga0187772_110004301 | 3300018085 | Tropical Peatland | MKWRSLEESALGLDTRPLREILAERKETIAKYVPAETQ |
Ga0182031_13021442 | 3300019787 | Bog | MKWRSLSESGSYSDMRPLREIFAERKEAVAKYVPVDVQAVHVRAVAGL |
Ga0193723_11067562 | 3300019879 | Soil | MKWRSLEESTPGTDSRSLGEIFAERKELIAKYVPR |
Ga0193728_11876392 | 3300019890 | Soil | MKWRSLEETGRGTDSRSLRELYAERRHLIAKYVPAEIQAIHARAV |
Ga0193731_10158111 | 3300020001 | Soil | MKWRSLDETTLAADNRSLREQFAERKELIAKYVPE |
Ga0193735_10782532 | 3300020006 | Soil | MMKWRSVEESALGTDTRPLRDVLAQRKELIAKYVP |
Ga0210403_101079022 | 3300020580 | Soil | MKWRSLEESSPALDTRPLRQIFAERKELIAKYVPPETQAIHAR |
Ga0210403_105814982 | 3300020580 | Soil | MKWRSLDESVATEDTRSLHQQFAERKELIAKYVLPETQ |
Ga0210399_102426152 | 3300020581 | Soil | MKWRSLEESTPGTDTRTLREIFAARKELIAKYVPAEAQTVH |
Ga0210399_108570172 | 3300020581 | Soil | MKWRSLEESAHGTDTRPLREIFAERKKKIAEYVPAE |
Ga0210399_115697401 | 3300020581 | Soil | MKWRSLEESTPETDIRRLSEILAERKELIAKYVPSETQAV |
Ga0210404_100346511 | 3300021088 | Soil | MKWRSLEESSPGIDTRPLREIYAERKELIAKYVPAETQAVHAQAV |
Ga0210400_102501262 | 3300021170 | Soil | MWHDMSTMKWRSLEESGPTTDTRSLREIFAERKELIAKYVP |
Ga0210388_105005101 | 3300021181 | Soil | MKWRSLEESAPTTDIRPLHEIFAERKELIAKYVRPETQ |
Ga0210388_106152011 | 3300021181 | Soil | MKWRSLEESTPDTLERPLREIFAERKQLIAKYVPAEAQAI |
Ga0210388_112871373 | 3300021181 | Soil | MKWRSLQESDESTDARPLHEIYAERKELIDKYVPA |
Ga0210393_110009071 | 3300021401 | Soil | MKWRSLDESAPSTDTRPLREIFAERKELIAQYVPAAAREVHAR |
Ga0210384_111411142 | 3300021432 | Soil | MKWRSLDESAAQVDLRTLREQFAERKRLIAKYALPETQ |
Ga0210409_105003011 | 3300021559 | Soil | MKWRSLEESATGSEVRPLREILAERKELIAKYVPV |
Ga0126371_126498201 | 3300021560 | Tropical Forest Soil | MKWRSLDEQTSGQTTRSLRQIYAERKELIAKYVLPELQSVHAGVVSELKRS |
Ga0242660_10408561 | 3300022531 | Soil | MKWRSLEESGPASDVRPLRDIYAERKELIAKYVPAETQ |
Ga0242677_10365222 | 3300022713 | Soil | MKWRSLEESAPSLDTRPLREIFAERKELIAKYVRPET |
Ga0224526_10207542 | 3300022872 | Soil | MKWRSLSESGSYSDMRPLREIFAERKEAVAKYVPVDVQAVHVRAV |
Ga0224547_10338711 | 3300023255 | Soil | MKWRSLQEAGENTDLRPLREILAERKDAITKYVPAE |
Ga0224565_10341631 | 3300024176 | Plant Litter | MKWRSLEESGPDTDARPLREIFTERKGLIAKYVPLE |
Ga0179589_104253891 | 3300024288 | Vadose Zone Soil | MKWRSLAKSTPGLDTRPLQEIFAQKKERIAQYVQPET |
Ga0208077_10378851 | 3300025427 | Arctic Peat Soil | MKWRSLQESGAYSDMRPLREIFAERKEAIAKYVPADVQAVHARAVD |
Ga0208714_10603511 | 3300025527 | Arctic Peat Soil | MKWRSLPESGSYSDMRPLREIFAERKDLIAKYVPADVQAVHARAV |
Ga0207699_113598112 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWRSLEESSSETDARPLLEIFAERKELIAKYVPAEAQAIHAQ |
Ga0207684_116847291 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWRSLEEQAPAQDARTLREQFAERKALVAKYVPPET |
Ga0207693_100855071 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWRSLEDSTPGTDTRSLQDIFAEREALVAKYVPPDIQGVHARVIAELKEK |
Ga0207693_110052371 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWRSLEESFPGTDTRRLREIYVERKELIAKYVPAET |
Ga0207660_104787991 | 3300025917 | Corn Rhizosphere | MKWRSLEESGPSSDVRPLREIFAERKELIAKYVPA |
Ga0207694_102718122 | 3300025924 | Corn Rhizosphere | MKWRSLQESVPGEDLRPLREQFAERKELIDKYVPEEA |
Ga0207687_113341302 | 3300025927 | Miscanthus Rhizosphere | MKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPPDI |
Ga0207665_105015062 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWRSLEESFPGTDTRRLREIYVERKELIAKYVPAETQ |
Ga0207689_106620841 | 3300025942 | Miscanthus Rhizosphere | MKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPP |
Ga0207679_110005322 | 3300025945 | Corn Rhizosphere | MKWRSLQESVPGEDLRPLREQFAERKELIDKYVPEEAR |
Ga0207703_113966602 | 3300026035 | Switchgrass Rhizosphere | MKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPPDIQGVHARVIAELKE |
Ga0207639_116896232 | 3300026041 | Corn Rhizosphere | MKWRSLEESAPGTDARPLRDIYAERKELVARYVPP |
Ga0209687_11896282 | 3300026322 | Soil | MMKWRSREESSTRTDTRSLREQFAERKALISQYVPSETQAV |
Ga0209378_11537201 | 3300026528 | Soil | MKWRSLEESNPGIDTRTLREQLAERKELIAKYVPLDAQA |
Ga0209056_100349736 | 3300026538 | Soil | MKWRSLEESGPSQDTRPLREQFAERKALIAKYVPPETQAIHAQ |
Ga0208860_10282851 | 3300027076 | Forest Soil | MKWRSLEESAPGLNTRPLREILAERKELIAKYVPAE |
Ga0208098_10155551 | 3300027172 | Forest Soil | MKWRSPEEPAAGPDVRPLREIFAECKDLIAKYVPAEIQAVH |
Ga0209213_10242571 | 3300027383 | Forest Soil | MKWRSLDESRPETDVRPLRDIFAERKGLIAKYVPAETQAIHTRAV |
Ga0209331_11487721 | 3300027603 | Forest Soil | MKWRSLEESTPGTDTRSLRDILSERKELIVRYVPPDIQAVHARVIR |
Ga0208827_10098311 | 3300027641 | Peatlands Soil | MKWRSLEESSPGTDLRPLREIFAERKELIAKYVPAETQA |
Ga0209117_10520822 | 3300027645 | Forest Soil | MKWRSLEESTPGSDTRSLQDIFAERKALIAKYVPPDIQSVHA |
Ga0209038_100769342 | 3300027737 | Bog Forest Soil | MKWRSLEEANPETDVRPLREIFAERKALITKYVPAETQ |
Ga0208989_100678602 | 3300027738 | Forest Soil | MKWRSLEESSAATDIRPLREIFAERKGLIAKHPPAET |
Ga0209655_101580463 | 3300027767 | Bog Forest Soil | MKWRSLTESRPPADVRPLREIFLERKELIDKYVPA |
Ga0209139_100758901 | 3300027795 | Bog Forest Soil | MKWRSLDESSPATDIRPLAEIFVERKALIAKYVPAELQVVHAGV |
Ga0209656_102178472 | 3300027812 | Bog Forest Soil | MKWRSLEESFPRTEQRALREIYAERKELITKYVPAEI |
Ga0209180_101164523 | 3300027846 | Vadose Zone Soil | MKWRSLEESGPSQDMRPLREQFAERKALVAKYVPPETQAIHAQ |
Ga0209517_104015621 | 3300027854 | Peatlands Soil | MKWRSLAESGSYSDMRPLREIFAERKDAIAKYVPA |
Ga0209693_101594552 | 3300027855 | Soil | MKWRSLTELHPVTEARPLREIFAERKELIANYVPAD |
Ga0209465_105348531 | 3300027874 | Tropical Forest Soil | MKWRSLEESGLSTDLRPLREIYAERKELIAKYVPQETQKIHTQ |
Ga0209169_103659851 | 3300027879 | Soil | MKWRSLEESTPGTDTRPLGEIFAERKALIAQYVPQEIQAIHE |
Ga0209590_108809851 | 3300027882 | Vadose Zone Soil | MKWRSLEESGPSQDMRPLREQFAERKALIAKYAPPETQ |
Ga0209380_101878852 | 3300027889 | Soil | MKWRSLEESNPETEIRPLQDIFAERKELIAKYVPAETQVIH |
Ga0209380_103514271 | 3300027889 | Soil | MKWRSLEESAPSADIRPLREIFAEREELIAKYVPAETRAV |
Ga0209380_108524421 | 3300027889 | Soil | MKWRSLQESDSTIGTRPLREIFAERKESIARYVPADVQ |
Ga0209624_105837221 | 3300027895 | Forest Soil | MKWRSLEESIPETETRPLREIFAERKEAIGKYVPAETQA |
Ga0209415_107652572 | 3300027905 | Peatlands Soil | MKWRSLEESAPGLDARPLREIFAERKELIAKYVPAETQAIHA |
Ga0268264_104581091 | 3300028381 | Switchgrass Rhizosphere | MPMKWRSLEESDPGTVIRSLHEIFAERKQLIARYVPPET |
Ga0302153_101956711 | 3300028574 | Bog | MKWRSLQEAGENTDIRPLRDIFAERKELIAKYVPPETQAVTR |
Ga0302168_10238882 | 3300028639 | Fen | MKWRSLQESGAYSDTRPLRQILAERKELIAEYVPADVQD |
Ga0302294_100112813 | 3300028740 | Fen | MKWRSLQESGAYSDTRPLRQILAERKELIAEYVPADVQAVHARAV |
Ga0302289_11475632 | 3300028857 | Fen | MKWRSLQESGAYSDTRPLRQIFAERKELIAEYVPADVQA |
Ga0302197_103392481 | 3300028873 | Bog | MKWRSLSESGAYSDMRPLREIFAERKEAIAKYVPHDVQAVHTRAVA |
Ga0302177_105857181 | 3300030053 | Palsa | MKWRSLEESRSEIDLRPLREIFAGRKDLIAKYVPAETQAVHAR |
Ga0302317_103421371 | 3300030677 | Palsa | MKWRSLEESAPETEIRPLREIFAERKELIAKYVPAE |
Ga0170834_1071612281 | 3300031057 | Forest Soil | MKWRSLQESDSYRDVRSLREIFSERKELIARYVPADVQAVHAHAVA |
Ga0170824_1003237091 | 3300031231 | Forest Soil | MKWRSLQESDSYRDVRSLREIFSERKELIARYVPADVQAVH |
Ga0265325_103152262 | 3300031241 | Rhizosphere | MSSWADMKWRSLEESSPGLDARPLREIYAERRELIAKY |
Ga0170820_129206431 | 3300031446 | Forest Soil | MKWRSLEETSAGPDARPLREIFAERKELISKYVPAETQ |
Ga0311364_116525141 | 3300031521 | Fen | MKWRSLQESGSYSDMRPLREIFAERKELIAKYVPADVQAVHGRAIAD |
Ga0307474_112120191 | 3300031718 | Hardwood Forest Soil | MKWRSLEESTPGTDTRSLREQFAERGELIAQYVPPEIQ |
Ga0307474_116598071 | 3300031718 | Hardwood Forest Soil | MKWRSLEESVAGTDMRSLREIFAERKALIAQYVPQE |
Ga0307469_119350442 | 3300031720 | Hardwood Forest Soil | MKWRSLEESTTGADTRTLGEVFAERKELIAKYVPAETQA |
Ga0307478_115010751 | 3300031823 | Hardwood Forest Soil | MKWRSLQAPAAGPDVRPLREIFSECKDLIAKYVPAEIQA |
Ga0306921_104615771 | 3300031912 | Soil | MKWRSLEESGLSTDLRPLREIYAERKELIAKYVPQE |
Ga0306926_101290691 | 3300031954 | Soil | MKWRSLEESGLSTDLRPLQEIYAERKELIAKYVPQETQ |
Ga0306926_103594121 | 3300031954 | Soil | MKWRSLEESTCANDVRPLREIFAERKELIARYVPAETQAVHE |
Ga0307479_108125552 | 3300031962 | Hardwood Forest Soil | MKWRSLQESDSYGDVRSLREIFSERKELIAKYVPADV |
Ga0307479_116415282 | 3300031962 | Hardwood Forest Soil | MKWRSLEESTPGTDARSLREIFAERKELIAKYVPPETQAV |
Ga0311301_101872651 | 3300032160 | Peatlands Soil | MKWRSLEESSPGLDARPLREIFAERKELIAKYVPP |
Ga0307470_100031771 | 3300032174 | Hardwood Forest Soil | MKWRSLEESSPGTDMRPLREIFAERKAKIAQYVPAATQ |
Ga0307470_103114722 | 3300032174 | Hardwood Forest Soil | MRWRSLEESARGTDARSLREIFAERKAKIAQYVPAETLAVHAGVT |
Ga0307470_107504491 | 3300032174 | Hardwood Forest Soil | MKWRSLAESGTNSDVRTLRELYAERKELIAKYVPTDIQTIHERTV |
Ga0307471_1007811211 | 3300032180 | Hardwood Forest Soil | MKWRSLEESSPETDLRPLRDIFAERKELLAKYVLAETQ |
Ga0307472_1007083752 | 3300032205 | Hardwood Forest Soil | MKWRSLEESTPGTDIRSLQDILSERKALIARYVPPDIQGVHTRVIG |
Ga0306920_1005835192 | 3300032261 | Soil | MKWRSLEESTPGADTRSLREIFAERKQKIAQYAPADTQAVHQ |
Ga0335085_122935831 | 3300032770 | Soil | MKWRSLDESTSGADLRPLQEIFAGRKELIAKYVPPETQAVHQR |
Ga0335082_101221794 | 3300032782 | Soil | MKWRSLDESTSGADLRPLQEIFAGRKELIAKYVPPETQAVHQRA |
Ga0335079_116081681 | 3300032783 | Soil | MKWRSLEESGPSSDLRSLREIYAERKELIAKYVPAET |
Ga0335078_123793212 | 3300032805 | Soil | MKWRSLQEAAPSADFRPLREIYAERKELIAKYVPAETQV |
Ga0335072_116189622 | 3300032898 | Soil | MKWRSLEESSRDLDLRPLREIFAERKEPIAKYVPAETQAIHAEA |
Ga0335076_109992202 | 3300032955 | Soil | MKWRSLEESAPGTDLRSLREIFAERKALIAQYVPEAARTVHA |
Ga0310914_104786652 | 3300033289 | Soil | MKWRSLDESRPEAGVRSLREIYAERKQLIAKYVPAEIQ |
⦗Top⦘ |