| Basic Information | |
|---|---|
| Family ID | F024318 |
| Family Type | Metagenome |
| Number of Sequences | 206 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSNYTYLGKFIQRPADLAPKGVKSTYQTEKLPFNETFERLWKLKK |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 206 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.32 % |
| % of genes near scaffold ends (potentially truncated) | 23.30 % |
| % of genes from short scaffolds (< 2000 bps) | 59.71 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.816 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (23.786 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.971 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (41.262 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 8.22% Coil/Unstructured: 65.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 206 Family Scaffolds |
|---|---|---|
| PF05565 | Sipho_Gp157 | 46.60 |
| PF04404 | ERF | 11.17 |
| PF14090 | HTH_39 | 10.68 |
| PF01381 | HTH_3 | 2.43 |
| PF08291 | Peptidase_M15_3 | 2.43 |
| PF14297 | DUF4373 | 1.94 |
| PF06056 | Terminase_5 | 1.94 |
| PF06199 | Phage_tail_2 | 0.49 |
| PF04466 | Terminase_3 | 0.49 |
| PF01844 | HNH | 0.49 |
| PF01510 | Amidase_2 | 0.49 |
| PF13384 | HTH_23 | 0.49 |
| PF05272 | VirE | 0.49 |
| PF13692 | Glyco_trans_1_4 | 0.49 |
| PF02195 | ParBc | 0.49 |
| PF00145 | DNA_methylase | 0.49 |
| PF12651 | RHH_3 | 0.49 |
| PF05521 | Phage_H_T_join | 0.49 |
| PF05866 | RusA | 0.49 |
| PF00149 | Metallophos | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.49 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.49 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.49 |
| COG5545 | Predicted P-loop ATPase and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.82 % |
| All Organisms | root | All Organisms | 27.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 23.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.65% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.28% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.40% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.43% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.46% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.46% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.97% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.97% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.97% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.49% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.49% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.49% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.49% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.49% |
| Mine Pit Pond | Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond | 0.49% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.49% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300002387 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300011921 | Mine pit pond microbial communities from Vermont, USA - 2M | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY92_100022613 | 3300000947 | Macroalgal Surface | MKPYLYLGKFIQCPGDLAPKGVRSTYDKEKLSFNETFDRLWKLMRQ* |
| B570J29608_100003720 | 3300002387 | Freshwater | MRNYLYLGKFIQRPGDLAPRGVASTYNEEKLPFNETFERLWNLMKS* |
| B570J40625_1013499522 | 3300002835 | Freshwater | MSNYLYLGKFIQRPGDLAPKGVRSTYQTEKLPFNETFERIWHLASTKA* |
| JGI25909J50240_10563572 | 3300003393 | Freshwater Lake | MKPYLYLGKFIQRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLASMKA* |
| JGI25920J50251_101184312 | 3300003404 | Freshwater Lake | MSYYIYMGKFIERPGDLAPKGVASTYQVQKLSFNATFKRLWRLAR* |
| JGI25914J50564_101751422 | 3300003429 | Freshwater Lake | TNQMSNYLYMGKFIDRPGDLAPKGVASTYQVQKLSFNATFKRLWRLAR* |
| Ga0007787_101231954 | 3300004240 | Freshwater Lake | MKYIGKEIQRPGDLSPKGVKSTYQTEKLPFNETFERLWLL |
| Ga0007787_102786782 | 3300004240 | Freshwater Lake | MKYLGKEIQRPGDLAPKGVRSTYQTEKLPFNETFERLWQLANTKP* |
| Ga0069718_120172251 | 3300004481 | Sediment | MRYLGKEIQRPKDLAPKGVRSTYQKEKLPFNETFVLIWEQISLIR* |
| Ga0070374_102255643 | 3300005517 | Freshwater Lake | LYLGKFIQRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLASMKA* |
| Ga0068876_100329877 | 3300005527 | Freshwater Lake | MSHYLYLGKFIKRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKH* |
| Ga0068876_100703247 | 3300005527 | Freshwater Lake | MSNYTYLGKFIKRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK* |
| Ga0068876_105439502 | 3300005527 | Freshwater Lake | MSNYLYLGKFIKRPGDLAPKGVKSTYQNEKLPFNETFERLWQLANTKA* |
| Ga0079957_101474212 | 3300005805 | Lake | MSHYLYLGKFIKRPGDLAPKGVKSTCQEERLPFNETFERIWHLISSKK* |
| Ga0075470_100083853 | 3300006030 | Aqueous | MKYLGKEIQRPGDLAPKGVKSTYQTERLPFNETFERIWLLANTKA* |
| Ga0070744_1000116810 | 3300006484 | Estuarine | MSNYLYLGKFIKRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKP* |
| Ga0070749_101301846 | 3300006802 | Aqueous | NEMKYLGKEIQRPFDLAPKGIRSTYQTEKLPFNETFERLWQLTNTKNLTK* |
| Ga0070749_101555052 | 3300006802 | Aqueous | MKHYLYLGKFIQCPADLAPKGIRSTYNKEKLPFNETFERLWKMMRQ* |
| Ga0070749_102471451 | 3300006802 | Aqueous | *EMKKHTYLNQPIERPGDLAPRGIKSTYQTEKLSFNETFERLWKLKK* |
| Ga0075473_101919953 | 3300006875 | Aqueous | MRYLGKQIERPGDLAPKGVKSTYQTEKLPFNETFERIWLLANTKA* |
| Ga0070748_10663861 | 3300006920 | Aqueous | MKHYLYLGKFIQCPADLAPKGIRSTYDKEKLPFNETF |
| Ga0070748_11220564 | 3300006920 | Aqueous | MKHYLYLGKFIQCPADLAPKGIRSTYDKEKLPFNET |
| Ga0070748_11270742 | 3300006920 | Aqueous | MSNYTYLGKFIQRPGDLAPKGVKSTYQTEKLSFNETFERLWKLKK* |
| Ga0070748_11610091 | 3300006920 | Aqueous | TDKMKPRLYLGKFIKTPGDLAPKGVKSTYQTEKLPFNETFERIWQLVSMKN* |
| Ga0099847_10553902 | 3300007540 | Aqueous | MKPYLYLGKFIQCPGDLAPKGVRSTYDKEKLPFNETFERLWKLMR* |
| Ga0099847_11158913 | 3300007540 | Aqueous | QMKHYLYLGKFIQCPADLAPKGIRSTYDKEKIPFNETFERLWKLMR* |
| Ga0099847_11271743 | 3300007540 | Aqueous | MTKPTDKMKPRLYLGKFIKTPGDLAPKGVKSTYQTEKLPFNETFERIW |
| Ga0099846_10298684 | 3300007542 | Aqueous | MKPHLYLGKFIQRPADLAPKGVASTYDKEKLPFNETWERLWKLAR* |
| Ga0099846_12613983 | 3300007542 | Aqueous | MKYHLYLGKFIKTPGDLAPKGVKSTCKSERLPFNETFER |
| Ga0114340_11594693 | 3300008107 | Freshwater, Plankton | MSNYLYLGKFIQRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKH* |
| Ga0114346_100312117 | 3300008113 | Freshwater, Plankton | MRYLGNEIKRPGDLAPKGVKSTYQTEKLSFNETFERLWLLANMKA* |
| Ga0114347_10273407 | 3300008114 | Freshwater, Plankton | MKYLGKEIQRPNDLAPKGVRSTYQTEKLTFNETFERLWLLRNLKK* |
| Ga0114350_10215701 | 3300008116 | Freshwater, Plankton | MKYLGKEIQRPGDLTPKGIRSTYQTEKLPFNETFERLWQLSNTKN* |
| Ga0114355_10594231 | 3300008120 | Freshwater, Plankton | MSNYTYLGKFIQRPADLAPKGVKSTYQTEKLPFNETFERLWKLKK* |
| Ga0114355_10674942 | 3300008120 | Freshwater, Plankton | MSHYTYLGKFIQRPGDLAPKGVASTFNEEKLPFNETFERLWNLMK* |
| Ga0114841_11597181 | 3300008259 | Freshwater, Plankton | MKTYSYLNKQIKRPNDLAPLGVRSTYDKEKLPFNETYQRLWLLI |
| Ga0114336_11234703 | 3300008261 | Freshwater, Plankton | MRYLGKQIERPGDLAPKGIRSTYQTERLPFNETFERIWLLANTKA* |
| Ga0114337_10623985 | 3300008262 | Freshwater, Plankton | MKPYLYLGKFIQRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKH* |
| Ga0114363_10572914 | 3300008266 | Freshwater, Plankton | MKYLGKEIQRPGDLAPKGVKSTYQIEKLPFNETFERIWLLANMKA* |
| Ga0114363_10668804 | 3300008266 | Freshwater, Plankton | MSNYTYLGKFIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK* |
| Ga0114363_12161402 | 3300008266 | Freshwater, Plankton | MKYLGKEIQRPNDLAPKGVRSTYQTEKLPFNETFERLWQLTNTKNLTK* |
| Ga0114876_100387712 | 3300008448 | Freshwater Lake | MRKYTYLGKEIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKR* |
| Ga0114876_12394823 | 3300008448 | Freshwater Lake | MKYLGKEIQRPGDLAPKGVKSTYQNEKLPFNETFERLWQLANTKA |
| Ga0114880_100885412 | 3300008450 | Freshwater Lake | MNYLYLGKFIKRPGDLAPKGIRSTCQTEKLPFNETFERIWQLASMKK* |
| Ga0105098_101089412 | 3300009081 | Freshwater Sediment | MKTYTYLGKFIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK* |
| Ga0105099_107495801 | 3300009082 | Freshwater Sediment | MTNHVYINIQIQRPGDLAPKGIKSTYQTEKLPFNETFERLWKLAK* |
| Ga0105099_110952011 | 3300009082 | Freshwater Sediment | DKMKYLGTKIQTPGDLKPKGIRSTYQTERLPFNQTFERLWKLAR* |
| Ga0105103_106622423 | 3300009085 | Freshwater Sediment | MRKHNYLNKEIERPGDLAPKGIKSTYQTEKLPFNETFERLWKLAK* |
| Ga0114978_103538482 | 3300009159 | Freshwater Lake | MRNYLYLGKFIQRPGDLAPKGVASTYNEEKLPFNETFKRLWNLMK* |
| Ga0114970_100044268 | 3300009163 | Freshwater Lake | MRNYLYLGKFIQRPGDLAPKGVASTYNKEKLPFNETFERLWNLMR* |
| Ga0114975_100013942 | 3300009164 | Freshwater Lake | MSHYLYLGKFIQRPGDLAPKGVRSTYQTEKLPFNETFERLWQLASTKA* |
| Ga0105102_100179634 | 3300009165 | Freshwater Sediment | MDGLNKIKMIKYTYLNKSIERPGDLAPKGIRSTYQKEKLPFNQTFERLWKLRK* |
| Ga0105102_101019112 | 3300009165 | Freshwater Sediment | MKKHTYLNQQIERPGDLAPKGIKSTYQTEKLPFNETFERLWKLAK* |
| Ga0105102_101583984 | 3300009165 | Freshwater Sediment | MKTYTYLGKTIQRPADLAPTGVKSTYQTEKLPFNETFERLWKLKK* |
| Ga0105102_104398572 | 3300009165 | Freshwater Sediment | MTNHVYINTQIQRPGDLAPKGIKSTYQTEKLPFNETFERLWKLAK* |
| Ga0105102_105471272 | 3300009165 | Freshwater Sediment | MDGLNKTKMIKYTYLNKSIERPGDLAPKGIRSTYQKEKLPFNQTFERLWKLRK* |
| Ga0105096_106822641 | 3300009170 | Freshwater Sediment | MKTYTYLGKTIQRPADLAPTGVKSTYQTEKLPFNETFE |
| Ga0126448_10054726 | 3300009466 | Meromictic Pond | MKYYLYLGKFIKTPGDLTPKGVRSTYQNEKLPFNETFERLWKLMR* |
| Ga0127401_11086892 | 3300009469 | Meromictic Pond | MKYYLYLGKFIKTPGDLAPKGVRSTYQNEKLPFNETFERLWKLMR* |
| Ga0136655_11366593 | 3300010316 | Freshwater To Marine Saline Gradient | MKPHLYLGKFIQRPADLAPKGVASTYDKEKLPFNETFERLWKL |
| Ga0129333_105974902 | 3300010354 | Freshwater To Marine Saline Gradient | MKKYFYLGKEIQRPGDLAPKGVKSTYQTEKLPINETFERIWQLASMKP* |
| Ga0129333_114928281 | 3300010354 | Freshwater To Marine Saline Gradient | NSRKLQPTDKMKPRLYLGKFIKTPGDLAPKGVRSTYQTEKLPFNETFERIWQLVSMKH* |
| Ga0116237_104989271 | 3300010356 | Anaerobic Digestor Sludge | YLGKEIARPGDLAPKGVRSTYQTEKLPFNETFERLWQLTNTKK* |
| Ga0129324_100043765 | 3300010368 | Freshwater To Marine Saline Gradient | MKPNLYLGKFIQRPADLAPKGVASTYDKEKLPFNETFERLWKLAR* |
| Ga0129324_1001152711 | 3300010368 | Freshwater To Marine Saline Gradient | MNYLYLGKFIKRPGDLAPKGVRSTCQNEKLPFNETFERIWQLASTKN* |
| Ga0133913_120758222 | 3300010885 | Freshwater Lake | MRNYLYLGKFIQRPGDLAPKGVASTYNEEKLSFNETFERLWNLMK* |
| Ga0153703_118516 | 3300011336 | Freshwater | MKPQLYLGKFIQRPADLAPKGVASTYDKEKLPFNETFERLWKLAR* |
| Ga0153703_13083 | 3300011336 | Freshwater | MKPHLYLGKFIQRPADLAPKGIASTYDKEKLPFNETWLRLWKLAR* |
| Ga0120089_1096351 | 3300011921 | Mine Pit Pond | MIPYLYLGKFIKRPGDLAPKGVKSTCQTEKLPFNETFEKIWQLVSMKA* |
| Ga0157140_100025974 | 3300012348 | Freshwater | MKKHTYLNQPIERPGDLAPKGIKSTYQTEKLSFNETFERLWKLKK* |
| Ga0164293_1001318211 | 3300013004 | Freshwater | MSNYLYLGKFIKRPGDLAPKGVASTYDKEKISFNLTFERLWNLMR* |
| Ga0164293_100739025 | 3300013004 | Freshwater | MSNYIYLGKFIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKR* |
| Ga0164293_100968185 | 3300013004 | Freshwater | MSKYTYLGKEIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKR* |
| Ga0164293_100979408 | 3300013004 | Freshwater | MSNYLYLGKFIKRPGDLAPKGVKSTCQTEKLPFNETFERIWQLASMKA* |
| Ga0164293_101310148 | 3300013004 | Freshwater | PYLYLGKFIKRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLVSMKA* |
| Ga0164293_101798255 | 3300013004 | Freshwater | MIPYLYLGKFIKRPGDLAPKGVKSTCQNEKLPFNETFEK |
| Ga0164293_105101122 | 3300013004 | Freshwater | MKPYLYLGKFIQRPGDLAPKGVMSTCQTEKLPFNETFERIWQLASTKA* |
| Ga0164293_106590902 | 3300013004 | Freshwater | MRKYTYLGKEIQRPADLAPRGVKSTYQTEKLPFNETFERIWKLKK* |
| Ga0164292_100926452 | 3300013005 | Freshwater | MIPYLYLGKFIKRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLVSMKA* |
| (restricted) Ga0172367_101696384 | 3300013126 | Freshwater | MKYLGKEIQRPGDLYPKGVRSTYQKEKIPFNETFERLWQLINTKI* |
| (restricted) Ga0172372_108956353 | 3300013132 | Freshwater | MKYLGKEIQRPGDLYPKGVRSTYQKEKLPFNETFERLWQLINTKI* |
| Ga0181363_10038812 | 3300017707 | Freshwater Lake | MKYIGKEIQRPGDLSPKGVKSTYQTEKLPFNETFERLWLLQNSKN |
| Ga0181363_10827861 | 3300017707 | Freshwater Lake | IYLGKFIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0181347_10865681 | 3300017722 | Freshwater Lake | YLYLGKFIQRPGDLAPKGVASTYNEEKLSFNETFERLWKIAR |
| Ga0181362_10056756 | 3300017723 | Freshwater Lake | MKNYLYLGKFIQRPGDLAPKGVASTYNEEKLSFNETFERLWKIAR |
| Ga0181344_100118212 | 3300017754 | Freshwater Lake | MRKHTYLNKEIERPGDLAPKGIKSTYQTEKLPFNETFERLWKLAK |
| Ga0181356_12266992 | 3300017761 | Freshwater Lake | PNKMSYYIYMGKFIERPGDLAPKGVASTYQVQKLSFNATFKRLWRLAR |
| Ga0181343_10077511 | 3300017766 | Freshwater Lake | MRYLGNEIKRPGDLAPKGVKSTYQTEKLPFNETFERLWQIVNTKA |
| Ga0181343_10296763 | 3300017766 | Freshwater Lake | MKYLGKEIQRPGDLAPKGIRSTYQTEKLPFNETFERLWLLANMKA |
| Ga0181343_10341585 | 3300017766 | Freshwater Lake | MIYLGNEINRPGDLAPKGVKSTYQTERLPLNETFERIWLLANMKA |
| Ga0181346_12214142 | 3300017780 | Freshwater Lake | MIPYLYLGKFIKRPGDLAPKGVKSTCKNEKLPFNETFEKIWQLASMKA |
| Ga0181348_10322355 | 3300017784 | Freshwater Lake | MSYYIYMGKFIERPGDLAPKGVASTYQIHKLSFNATFKRLWRLAR |
| Ga0181355_12847492 | 3300017785 | Freshwater Lake | MSNYLYLGKFIQRPGDLAPKGVKSTYQNEKLPFNETFERIWQLASMKH |
| Ga0169931_101202753 | 3300017788 | Freshwater | MKYLGKEIQRPGDLYPKGVRSTYQKEKLPFNETFERLWQLINTKI |
| Ga0181563_101762943 | 3300018420 | Salt Marsh | MRPYLYLGKFIQCPGDLAPKGVRSTYDKEKLPFNETFERLWKLMR |
| Ga0181359_100162313 | 3300019784 | Freshwater Lake | MIPYLYLGKFIKRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLVSMKA |
| Ga0181359_10032206 | 3300019784 | Freshwater Lake | MSNYLYLGKFIKRPGDLAPKGVASTYNKEKISFNLTFERLWNLMR |
| Ga0181359_10326333 | 3300019784 | Freshwater Lake | MKPYLYLGKFIQRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLASMKA |
| Ga0181359_11711693 | 3300019784 | Freshwater Lake | MIPYLYLGKFIKRPGDLAPKGVKSTCQNEKLPFNETF |
| Ga0207193_100298833 | 3300020048 | Freshwater Lake Sediment | MRNYLYLGKFIQRPGDLAPRGVASTYNEEKLPFNETFERLWNLMK |
| Ga0194112_105031282 | 3300020109 | Freshwater Lake | MKYTYLNKEINRPNDLAPKGIRSTYQTEKLTFNDTFERLWRLTNILK |
| Ga0211736_108434295 | 3300020151 | Freshwater | MTYIGNEIKRPGDLAPKGVKSTYQTEKLSFNETFERLWLLTNSKR |
| Ga0211735_103268771 | 3300020162 | Freshwater | MSKYTYLGKPINRPGDLAPRGVRSTYQTEKLSFNETF |
| Ga0194134_100914224 | 3300020179 | Freshwater Lake | MKYTYLNKEINRPNDLAPKGIRSTYQTEKLTFNDTFERLWRLTNILN |
| Ga0194123_105560231 | 3300021093 | Freshwater Lake | MKYTYLNNEINRPKDLAPKGIRSTYQTEKLTFNDTFERLWRLTNIL |
| Ga0222714_100292283 | 3300021961 | Estuarine Water | MKPHLYLGKFIQRPGDLAPKGVASTYDKEKLPFNETWLRLWKLAR |
| Ga0222714_101934153 | 3300021961 | Estuarine Water | MKHYLYLGKFIQCPGDLTPKGVRSTYDKEKLSFNETFERLWKLMR |
| Ga0222714_102013414 | 3300021961 | Estuarine Water | MKYLGKEIQRPGDLAPKGIRSTYQTEKLPFNETFE |
| Ga0222713_101639053 | 3300021962 | Estuarine Water | MKYLGKEIQRPGDLAPKGVKSTYQTERLPFNETFKRIWLLANTKA |
| Ga0181354_10388911 | 3300022190 | Freshwater Lake | MKPYLYLGKFIQRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLASM |
| Ga0181354_11626631 | 3300022190 | Freshwater Lake | MKYLGKEIQRPGDLAPKGIRSTYQTEKLPFNETFER |
| Ga0181354_12257372 | 3300022190 | Freshwater Lake | MSYYIYMGKFIERPGDLAPKGVASTYQVQKLSFNATFKRLWRLAR |
| Ga0196901_100132321 | 3300022200 | Aqueous | MKKELIRPADLAPKGVRSTYQKEKLSFNETYKRIWTQLK |
| Ga0196901_100153521 | 3300022200 | Aqueous | MNNYLYLGRFIKRPGDLAPKGVASTYDKEKLPFNETFERLWKLAR |
| Ga0196901_10620152 | 3300022200 | Aqueous | MSHYLYLGKFIKRPGDLAPKGVKSTCQTEVLPFNETFERLWQVISSKK |
| Ga0196901_11296033 | 3300022200 | Aqueous | NSRKLQPTDKMKPKLYLGKFIKTPGDLAPKGVKSTYQTEKLPFNETFERIWQLVSMKH |
| Ga0181351_12326861 | 3300022407 | Freshwater Lake | MKPYLYLGKFIQRPGDLAPKGVKSTCQNEKLPFNE |
| Ga0210003_10470193 | 3300024262 | Deep Subsurface | MSNYTYLGKFIKTPGDLAPKGVRSTYQNEKLSFNETFEKIWKQINIKK |
| Ga0244775_1000059644 | 3300024346 | Estuarine | MSNYLYLGKFIKRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKP |
| Ga0255141_10012602 | 3300024351 | Freshwater | MKYLGKKIERPGDLAPKGVKSTYQTEKLPFNETFERLWQLTNSKQ |
| Ga0255151_10007785 | 3300024496 | Freshwater | MKTYTYLNKQIKRPGDLAPLGVKSTYQTERLPFNETYQRLWLLISTLK |
| Ga0208546_10494902 | 3300025585 | Aqueous | MKYLGKEIQRPGDLAPKGVKSTYQTERLPFNETFERIWLLANTKA |
| Ga0208160_10085749 | 3300025647 | Aqueous | MNYLYLGKFIKRPGDLAPKGVKSTCQTEVLPFNETFERLWQVISSKK |
| Ga0208795_100059414 | 3300025655 | Aqueous | MNYLYLGKFIKRPGDLAPKGVRSTCQNEKLPFNETFERIWQLASTKN |
| Ga0209704_10016544 | 3300027693 | Freshwater Sediment | MSKYTYLGKEIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKR |
| Ga0209704_10271733 | 3300027693 | Freshwater Sediment | MDGLNKIKMIKYTYLNKSIERPGDLAPKGIRSTYQKEKLPFNQTFERLWKLRK |
| Ga0209704_10770983 | 3300027693 | Freshwater Sediment | MTNHVYINTQIQRPGDLAPKGIKSTYQTEKLPFNETFERLWKLAK |
| Ga0209296_13717001 | 3300027759 | Freshwater Lake | MKPYLYLGKFIQRPGDLAPKGVRSTHQTEKLSFNETFERIWQLASMKA |
| Ga0209134_100300684 | 3300027764 | Freshwater Lake | MKSYLYLGKFIQRPGDLSPRGVASTYNEEKLPFNETFERLWNLMKS |
| Ga0209246_100822632 | 3300027785 | Freshwater Lake | MSYYIYMGKFIERPGDLAPKGVASTYQMHKLSFNATFKRLWRLAR |
| Ga0209353_100080711 | 3300027798 | Freshwater Lake | YLYLGKFIQRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLASMKA |
| Ga0209990_100747866 | 3300027816 | Freshwater Lake | MSNYTYLGKFIKRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0209820_12003301 | 3300027956 | Freshwater Sediment | TYTYLGKFIQRPADLAPTGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0209191_10078223 | 3300027969 | Freshwater Lake | MSHYLYLGKFIQRPGDLAPKGVRSTYQTEKLPFNETFERLWQLASTKA |
| Ga0209079_100488894 | 3300027972 | Freshwater Sediment | MSNYTYLGKFIQRPADLAPTGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0209298_100139972 | 3300027973 | Freshwater Lake | MRNYLYLGKFIQRPGDLAPKGVASTYNEEKLPFNETFKRLWNLMK |
| Ga0247723_100034145 | 3300028025 | Deep Subsurface Sediment | MKPYLYLGKFIQRPGDLAPKGVRSTYQTEKLPFNETFERIWQIVNTKA |
| Ga0247723_10003765 | 3300028025 | Deep Subsurface Sediment | MKYLGKEIARPGDLAPKGVRSTYQTEKLPFNETFERLWQLTNSKK |
| Ga0247723_10171812 | 3300028025 | Deep Subsurface Sediment | MSNYTYLGKFIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0255172_100136613 | 3300028103 | Freshwater | MKTYTYLNNEINRPGDLAPKGVRSTYQTEKLTFNETFERLWQLTNTLN |
| Ga0307380_107203872 | 3300031539 | Soil | MESTKRNNQMKYHLYLKKFIKTPGDLAPKGVRSTYENEKLSFNETFEKIWEQINIKK |
| Ga0307378_112919171 | 3300031566 | Soil | STKRNNQMKYHLYLKKFIKTPGDLAPKGVRSTYENEKLSFNETFEKIWEQINIKK |
| Ga0315907_1000145319 | 3300031758 | Freshwater | MKYLGKEIQRPGDLTPKGIRSTYQTEKLPFNETFERLWQLSNTKN |
| Ga0315907_1001330916 | 3300031758 | Freshwater | MKYLGKEIQRPNDLAPKGVRSTYQTEKLTFNETFERLWLLRNLKK |
| Ga0315907_100715756 | 3300031758 | Freshwater | MKAYTYLNNEINRPGDLAPKGVRSTYQTEKLTFNETFERLWQLTNTLN |
| Ga0315907_101044105 | 3300031758 | Freshwater | MSHYLYLGKFIKRPGDLAPKGVKSTCQDERLPFNETFERIWHLISSKK |
| Ga0315907_103905623 | 3300031758 | Freshwater | MSNYLYLGKFIKRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKH |
| Ga0315907_104177994 | 3300031758 | Freshwater | MKYLGKEIQRPGDLAPKGIRSTYQTEKLPFNETFERIWLLANTKA |
| Ga0315907_110909701 | 3300031758 | Freshwater | MKTYTYLNNEINRPGDLAPKGVRSTYQTEKLTFNETFE |
| Ga0315907_110911033 | 3300031758 | Freshwater | MSHYLYLGKFIKRPGDLAPKGVKSTCQDERLPFNETFERIWHLIS |
| Ga0315288_110113811 | 3300031772 | Sediment | MSNYIYMGKFIDRPGDLAPKGVASTYQVQKLSFNATFKRL |
| Ga0315899_102447052 | 3300031784 | Freshwater | MSHYTYLGKFIQRPGDLAPKGVASTFNEEKLPFNETFERLWNLMR |
| Ga0315900_103754472 | 3300031787 | Freshwater | MSNYTYLGKFIQRPGDLAPKGVKSTCQNEKLPFNETFERLWQLANTKA |
| Ga0315909_1001270521 | 3300031857 | Freshwater | MNYLYLGKFIKRPGDLAPKGIRSTCQTEKLPFNETFERIWQLASMKK |
| Ga0315909_1001406810 | 3300031857 | Freshwater | MRYLGKQIQRPGDLAPKGVRSTYQTEKLPFNETFERLWLLTNSKK |
| Ga0315909_1001740711 | 3300031857 | Freshwater | MKYLGKEIQRPNDLAPKGVRSTYQTEKLPFNETFERLWQLTNTKNLTK |
| Ga0315909_1004547410 | 3300031857 | Freshwater | MSNYLYLGKFIKRPGDLAPKGVKSTYQNEKLPFNETFERLWQLANTKA |
| Ga0315909_100975265 | 3300031857 | Freshwater | MKKYTYLGKEIQRTGDLAPKGVKSTCQNEKLPFNETFQRLWQLANTKA |
| Ga0315909_101177814 | 3300031857 | Freshwater | MSNYTYLGKFIQRPADLAPKGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0315909_105367363 | 3300031857 | Freshwater | FIKTPGDLAPKGVRSTYQTEKLTFEETFKRIWELVNTNR |
| Ga0315901_107388643 | 3300031963 | Freshwater | MKYLGKEIQRPGDLAPKGIRSTYQTEKLPFNETFERI |
| Ga0315901_107404302 | 3300031963 | Freshwater | MRNYLYLGKFIQRPGDLAPKGVRSTYQSEKLPFNETFERIWQLANMKH |
| Ga0315906_105572843 | 3300032050 | Freshwater | MKSYLYLGKFIQRPGDLAPRGVASTYNEEKLPFNETFERLWNLMK |
| Ga0315905_1000852614 | 3300032092 | Freshwater | MKHYLYLGKFIKTPGDLAPKGVRSTYQTEKLTFEETFKRIWELVNTNR |
| Ga0315905_1002577113 | 3300032092 | Freshwater | MKHYLYLGKFIKTPGDLAPKGVKSTYQTEKLTFEETFKRIWELANMKA |
| Ga0315902_101343274 | 3300032093 | Freshwater | MKYLGKEIQRPGDLAPKGVKSTYQIEKLPFNETFERIWLLANMKA |
| Ga0315902_107191283 | 3300032093 | Freshwater | NQMRNYLYLGKFIQRPGDLAPKGVRSTYQSEKLPFNETFERIWQLANMKH |
| Ga0315287_119819311 | 3300032397 | Sediment | MSYYIYMGKFIERPGDLAPKGVASTYQVQKLSFNATFKRL |
| Ga0315273_104207374 | 3300032516 | Sediment | MIPYLYLGKFIKRPGDLAPKGVKSTCQNEKLPFNETFERIWHLVSTNP |
| Ga0334981_0108353_1153_1290 | 3300033980 | Freshwater | MRKHTYLNKEIERPGDLAPKGIKSTYQTEKLPFNETFERLWKLKK |
| Ga0334982_0438555_110_247 | 3300033981 | Freshwater | MSNYLYLGKFIKRPGDLAPKGVASTYDKEKISFNLTFERLWSLMK |
| Ga0334992_0000548_26180_26317 | 3300033992 | Freshwater | MSNYTYLGKFIKRPGDLAPKGVASTYDKEKLPFNETFERLWKLAR |
| Ga0335003_0105463_559_696 | 3300033995 | Freshwater | MSNYLYLGKFIKRPGDLAPKGVASTYDKEKISFNLTFERLWNLMR |
| Ga0334979_0000348_13276_13413 | 3300033996 | Freshwater | MSNYIYLGKFIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKR |
| Ga0334979_0717924_324_470 | 3300033996 | Freshwater | MKPYLYLGKFIQRPGDLAPKGVKSTCQNEKLPFNETFEKIWQLVSMKA |
| Ga0334986_0005016_8420_8557 | 3300034012 | Freshwater | MNKYTYLGREIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKR |
| Ga0335005_0021259_209_346 | 3300034022 | Freshwater | MRNYLYLGKFIQRPGDLAPKGVASTYNEEKLPFNETFERLWNLMK |
| Ga0334987_0014509_1598_1735 | 3300034061 | Freshwater | MSKYTYLGKEIKRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0334995_0133907_25_198 | 3300034062 | Freshwater | MSNYLYLGKFIQRPGDLAPRGVASTYNEEKLPFNETFERLWNLMKSWLKLKRFTWKV |
| Ga0334995_0147678_1139_1276 | 3300034062 | Freshwater | MKTYTYLGKEIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0334995_0385741_774_881 | 3300034062 | Freshwater | MRKYTYLGKEIQRPADLAPRGVKSTYQTEKLPFNET |
| Ga0335019_0185748_505_651 | 3300034066 | Freshwater | MSNYTYLGKFIQRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKP |
| Ga0335019_0426160_256_393 | 3300034066 | Freshwater | MKKHTYLNKAIERPGDLAPKGIRSTYQKEKLPFNQTFERLWKLRK |
| Ga0335029_0459855_316_477 | 3300034102 | Freshwater | MDGLNKTKMIKYTYLNKAIERPGDLAPKGIRSTYQKEKLPFNETFERLWKLKK |
| Ga0335031_0001386_3663_3800 | 3300034104 | Freshwater | MKTYTYLGKFIQRPADLAPRGVKSTYQNEKLPFNETFERLWKLKK |
| Ga0335031_0001877_2841_3002 | 3300034104 | Freshwater | VDGLNKTKMIKYTYLNKSIERPGDLAPKGIRSTYQKEKLPFNQTFERLWKLRK |
| Ga0335031_0041218_618_764 | 3300034104 | Freshwater | MSHYTYLGKLIQRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKP |
| Ga0335031_0112935_441_614 | 3300034104 | Freshwater | MKSYLYLGKFIQRPGDLAPRGVASTYNEEKLPFNETFERLWNLMKSWLKLKRFTWKV |
| Ga0335031_0640848_56_202 | 3300034104 | Freshwater | MSHYTYLGKFIQRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKP |
| Ga0335031_0789319_375_533 | 3300034104 | Freshwater | TYLKITKMSNYTYLGKFIQRPADLAPKGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0335035_0075754_437_574 | 3300034105 | Freshwater | MSNYLYLGKFIKRPGDLAPKGVASTYDKEKISFNETFERLWNLMR |
| Ga0335036_0000943_18486_18626 | 3300034106 | Freshwater | MRNYLYLGKFIKRPGDLAPRGVASTYNEEKLPFNETFERLWNLMKS |
| Ga0335036_0006108_4181_4327 | 3300034106 | Freshwater | MKPYLYLGKFIQRPGDLAPKGVRSTCQTEKLPFNETFERIWQLASTKA |
| Ga0335036_0061574_247_384 | 3300034106 | Freshwater | MSKYTYLGKEIQRPADLAPKGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0335036_0148199_1466_1639 | 3300034106 | Freshwater | MQKLYKHQPPNQMSKYTYLGKEIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKR |
| Ga0335066_0409747_598_738 | 3300034112 | Freshwater | HYTYLGKFIKRPGDLAPKGVRSTYQTEKLPFNETFERLWQLASMKH |
| Ga0335056_0077503_1536_1676 | 3300034120 | Freshwater | MKSYLYLGKFIQRPGDLAPRGVASTFNEEKLPFNETFERLWNLMKS |
| Ga0335060_0002589_642_779 | 3300034122 | Freshwater | MRKYTYLGKEIQRPADLAPRGIKSTYQTEKLPFNETFERLWKLKR |
| Ga0335060_0083258_105_242 | 3300034122 | Freshwater | MKTYTYLGKFIQRPADLAPRGIKSTYQTEKLPFNETFERLWKLKK |
| Ga0335016_0336976_243_380 | 3300034166 | Freshwater | MKNYIYLGKFIQRPGDLAPRGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0335016_0650597_2_145 | 3300034166 | Freshwater | MDGLNKTKMIKYTYLNKAIERPGDLAPKGIRSTYQKEKLPFNETFERL |
| Ga0335065_0000336_26459_26605 | 3300034200 | Freshwater | MKPYLYLGKFIQRPGDLAPKGVKSTYQTEKLPFNETFERIWQLASMKP |
| Ga0335049_0568513_605_709 | 3300034272 | Freshwater | MKKHTYLNKAIERPGDLAPKGIRSTYQKEKLPFNQ |
| Ga0335013_0292999_917_1039 | 3300034284 | Freshwater | YLGKEIQRPADLAPRGVKSTYQTEKLPFNETFERLWKLKK |
| Ga0335048_0015167_4033_4170 | 3300034356 | Freshwater | MRNYLYLGKFIQRPGDLAPKGVASTFNEEKLPFNETFERLWNLMK |
| Ga0335048_0179669_1061_1183 | 3300034356 | Freshwater | MIPYLYLGKFIKRPGDLAPKGVKSTCQNEKLPFNETFEKIW |
| ⦗Top⦘ |