Basic Information | |
---|---|
Family ID | F024261 |
Family Type | Metagenome |
Number of Sequences | 206 |
Average Sequence Length | 42 residues |
Representative Sequence | MPHYVSLMRWTSQGVAGLPAWRDRVEEGERIISEAGGSLVGV |
Number of Associated Samples | 171 |
Number of Associated Scaffolds | 206 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 40.78 % |
% of genes near scaffold ends (potentially truncated) | 98.06 % |
% of genes from short scaffolds (< 2000 bps) | 91.75 % |
Associated GOLD sequencing projects | 163 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.544 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.816 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.184 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.825 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.71% β-sheet: 0.00% Coil/Unstructured: 74.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 206 Family Scaffolds |
---|---|---|
PF01479 | S4 | 74.76 |
PF08734 | GYD | 7.77 |
PF13561 | adh_short_C2 | 1.94 |
PF02872 | 5_nucleotid_C | 0.97 |
PF01636 | APH | 0.97 |
PF13417 | GST_N_3 | 0.49 |
PF00579 | tRNA-synt_1b | 0.49 |
PF00849 | PseudoU_synth_2 | 0.49 |
PF00462 | Glutaredoxin | 0.49 |
PF03773 | ArsP_1 | 0.49 |
PF02634 | FdhD-NarQ | 0.49 |
PF05872 | HerA_C | 0.49 |
PF07479 | NAD_Gly3P_dh_C | 0.49 |
PF08974 | DUF1877 | 0.49 |
PF00484 | Pro_CA | 0.49 |
PF05787 | DUF839 | 0.49 |
COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
---|---|---|---|
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 7.77 |
COG0737 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family | Defense mechanisms [V] | 0.97 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.49 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.49 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.49 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.49 |
COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.49 |
COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.49 |
COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.49 |
COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.49 |
COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 0.49 |
COG3211 | Secreted phosphatase, PhoX family | General function prediction only [R] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.54 % |
Unclassified | root | N/A | 1.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908032|Perma_A_C_ConsensusfromContig211447 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
2199352025|deepsgr__Contig_155579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
3300000956|JGI10216J12902_108411597 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300001535|A3PFW1_10777592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
3300002568|C688J35102_118156235 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300004156|Ga0062589_100924608 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300004479|Ga0062595_101852270 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300004479|Ga0062595_101997552 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300004480|Ga0062592_100228270 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300004480|Ga0062592_101896886 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005093|Ga0062594_102754442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
3300005167|Ga0066672_10816640 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300005168|Ga0066809_10173812 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005179|Ga0066684_11008771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300005187|Ga0066675_10353765 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300005328|Ga0070676_10706212 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300005332|Ga0066388_100138667 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
3300005344|Ga0070661_101806414 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005406|Ga0070703_10507412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300005435|Ga0070714_102056453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300005437|Ga0070710_10312246 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300005439|Ga0070711_100672945 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300005445|Ga0070708_100184105 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
3300005446|Ga0066686_10961728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300005446|Ga0066686_10979877 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005450|Ga0066682_10701900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
3300005450|Ga0066682_10773126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300005454|Ga0066687_10823304 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005458|Ga0070681_10434094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
3300005467|Ga0070706_100128164 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
3300005524|Ga0070737_10066000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1838 | Open in IMG/M |
3300005542|Ga0070732_10274001 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300005543|Ga0070672_101044004 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300005546|Ga0070696_100905628 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300005546|Ga0070696_101718440 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005553|Ga0066695_10825111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300005558|Ga0066698_10199096 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300005558|Ga0066698_10492952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
3300005561|Ga0066699_10340389 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300005566|Ga0066693_10394208 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005568|Ga0066703_10115715 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
3300005578|Ga0068854_101156796 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300005587|Ga0066654_10317775 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300005587|Ga0066654_10796845 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005598|Ga0066706_10698501 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300005719|Ga0068861_100108709 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
3300005874|Ga0075288_1086676 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005893|Ga0075278_1048607 | Not Available | 635 | Open in IMG/M |
3300006046|Ga0066652_100931814 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300006844|Ga0075428_102550347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300006847|Ga0075431_100219925 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
3300006854|Ga0075425_102789039 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300006871|Ga0075434_100028197 | All Organisms → cellular organisms → Bacteria | 5516 | Open in IMG/M |
3300006914|Ga0075436_100840520 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300006914|Ga0075436_101362475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300006954|Ga0079219_12162568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300006969|Ga0075419_10784033 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300007076|Ga0075435_100805176 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300007076|Ga0075435_101678035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300009090|Ga0099827_10948119 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300009094|Ga0111539_12188859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
3300009094|Ga0111539_13167643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300009098|Ga0105245_10049158 | All Organisms → cellular organisms → Bacteria | 3775 | Open in IMG/M |
3300009137|Ga0066709_100447042 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
3300009137|Ga0066709_100726129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1431 | Open in IMG/M |
3300009137|Ga0066709_104690180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300009143|Ga0099792_11249074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300009147|Ga0114129_10317268 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
3300009811|Ga0105084_1066851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 650 | Open in IMG/M |
3300010044|Ga0126310_11402892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
3300010045|Ga0126311_10771774 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300010047|Ga0126382_11998347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300010159|Ga0099796_10522325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300010303|Ga0134082_10387197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
3300010326|Ga0134065_10181290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 753 | Open in IMG/M |
3300010337|Ga0134062_10467883 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300010361|Ga0126378_12512431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
3300010373|Ga0134128_11607329 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300010373|Ga0134128_12245962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
3300010376|Ga0126381_101178086 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300010376|Ga0126381_104629253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300011119|Ga0105246_10439652 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300012001|Ga0120167_1115548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300012008|Ga0120174_1050004 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300012010|Ga0120118_1178447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300012188|Ga0136618_10505560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300012189|Ga0137388_10375685 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
3300012198|Ga0137364_10649223 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300012200|Ga0137382_11273428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
3300012200|Ga0137382_11308760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300012202|Ga0137363_10997986 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300012204|Ga0137374_10836916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
3300012208|Ga0137376_11732359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300012209|Ga0137379_11618163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300012285|Ga0137370_10034668 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
3300012353|Ga0137367_10687409 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300012355|Ga0137369_10026894 | All Organisms → cellular organisms → Bacteria | 5328 | Open in IMG/M |
3300012360|Ga0137375_10062594 | All Organisms → cellular organisms → Bacteria | 3981 | Open in IMG/M |
3300012512|Ga0157327_1087879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300012532|Ga0137373_10031206 | All Organisms → cellular organisms → Bacteria | 5176 | Open in IMG/M |
3300012532|Ga0137373_10722974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
3300012882|Ga0157304_1111329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
3300012898|Ga0157293_10108924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300012910|Ga0157308_10109775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
3300012917|Ga0137395_10934875 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300012930|Ga0137407_11989400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300012951|Ga0164300_10629584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
3300012958|Ga0164299_11630430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300012961|Ga0164302_11449864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
3300012972|Ga0134077_10402832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300012972|Ga0134077_10473308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300012976|Ga0134076_10378207 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300012986|Ga0164304_11875807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300013102|Ga0157371_10603976 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300013105|Ga0157369_11460898 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300013501|Ga0120154_1113703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300013758|Ga0120147_1005394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2959 | Open in IMG/M |
3300013764|Ga0120111_1109070 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300014325|Ga0163163_13319263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300014497|Ga0182008_10403122 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300014827|Ga0120171_1014996 | All Organisms → cellular organisms → Bacteria | 3270 | Open in IMG/M |
3300015089|Ga0167643_1002721 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
3300015356|Ga0134073_10380330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300015358|Ga0134089_10563310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300015371|Ga0132258_11667763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1608 | Open in IMG/M |
3300015372|Ga0132256_100095079 | All Organisms → cellular organisms → Bacteria | 2890 | Open in IMG/M |
3300017965|Ga0190266_10455096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
3300018032|Ga0187788_10499705 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300018061|Ga0184619_10081399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1438 | Open in IMG/M |
3300018061|Ga0184619_10265415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
3300018061|Ga0184619_10507795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300018064|Ga0187773_10766134 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300018433|Ga0066667_12003670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300018433|Ga0066667_12174376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300018469|Ga0190270_11583595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
3300019361|Ga0173482_10047809 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
3300019362|Ga0173479_10117987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1012 | Open in IMG/M |
3300019362|Ga0173479_10303178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
3300019866|Ga0193756_1032212 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300019890|Ga0193728_1306470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
3300021080|Ga0210382_10076250 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
3300021445|Ga0182009_10487025 | Not Available | 648 | Open in IMG/M |
3300024055|Ga0247794_10137053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 756 | Open in IMG/M |
3300024232|Ga0247664_1118030 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300025921|Ga0207652_11811980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300025922|Ga0207646_10987537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
3300025922|Ga0207646_11750280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300025923|Ga0207681_11506560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300025927|Ga0207687_10261576 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300025929|Ga0207664_10402508 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300025938|Ga0207704_10649677 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300025940|Ga0207691_10414479 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300025944|Ga0207661_10001847 | All Organisms → cellular organisms → Bacteria | 14490 | Open in IMG/M |
3300026008|Ga0208529_1020083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
3300026078|Ga0207702_12241754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300026078|Ga0207702_12336645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300026523|Ga0209808_1137603 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300026547|Ga0209156_10372025 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300026548|Ga0209161_10571443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300027650|Ga0256866_1213514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300027869|Ga0209579_10675210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
3300027886|Ga0209486_10956356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300027986|Ga0209168_10451656 | Not Available | 623 | Open in IMG/M |
3300028705|Ga0307276_10064694 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300028710|Ga0307322_10150585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300028711|Ga0307293_10124292 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300028714|Ga0307309_10128894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300028720|Ga0307317_10014829 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
3300028768|Ga0307280_10308944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
3300028782|Ga0307306_10114836 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300028784|Ga0307282_10403108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
3300028787|Ga0307323_10153815 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300028787|Ga0307323_10209317 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300028793|Ga0307299_10092543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1128 | Open in IMG/M |
3300028799|Ga0307284_10407149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300028799|Ga0307284_10421975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300028807|Ga0307305_10094175 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300028811|Ga0307292_10077408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1282 | Open in IMG/M |
3300028814|Ga0307302_10499436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
3300028814|Ga0307302_10536140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
3300028819|Ga0307296_10169491 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300028824|Ga0307310_10038780 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
3300028824|Ga0307310_10137651 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300028828|Ga0307312_10183169 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300028828|Ga0307312_10545040 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300028828|Ga0307312_10612589 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300028828|Ga0307312_10988539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300028875|Ga0307289_10429070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300028878|Ga0307278_10385049 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300028881|Ga0307277_10017942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2755 | Open in IMG/M |
3300028881|Ga0307277_10566478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300028884|Ga0307308_10595186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300028884|Ga0307308_10623218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
3300030006|Ga0299907_10176072 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300031241|Ga0265325_10492873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300031341|Ga0307418_1136972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300031819|Ga0318568_10580563 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300031820|Ga0307473_11308304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300031901|Ga0307406_10241532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1355 | Open in IMG/M |
3300031901|Ga0307406_10468090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1015 | Open in IMG/M |
3300031901|Ga0307406_11683011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300031962|Ga0307479_11402998 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300032828|Ga0335080_10612458 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300032828|Ga0335080_11705852 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300032954|Ga0335083_10778246 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300033412|Ga0310810_10981705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.68% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.22% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.37% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.88% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.46% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.46% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.46% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.46% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.46% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.49% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.49% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.49% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.49% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.49% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026008 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031341 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Perma_A_C_01714690 | 2124908032 | Soil | MPHYITLMRWTSQGFAGLPGWRERVEEGEQIIREAGGTPVGVYVTIGQY |
deepsgr_02568070 | 2199352025 | Soil | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVEEAGGSLVGVYVTLGR |
JGI10216J12902_1084115971 | 3300000956 | Soil | MRWTTQGFAGLPSWRERVEEGEQVIKSAGGTLVGVY |
A3PFW1_107775922 | 3300001535 | Permafrost | VAHYISLMRWSSTGRAGAPAWRDRVEEGERTIAAAGGKLVGVYVTLGRL* |
C688J35102_1181562351 | 3300002568 | Soil | MAHYVTLMRWTTQGYAGLPKWRERIEEGERIIADAGGTLVG |
Ga0062589_1009246082 | 3300004156 | Soil | MRWTSKGVAGLPAWRERVEEGERIVQEAGGELVGVYVTLGRYDVV |
Ga0062595_1018522701 | 3300004479 | Soil | MRWTSQGRMGLPAWRDRVEEGERLITENGGTLVGVYVTLGRYDVVEIF |
Ga0062595_1019975522 | 3300004479 | Soil | VAHYVTLMRWTTQGYAGLPKWRERIEEGERIIDEAGGKMVGVYVTLG |
Ga0062592_1002282701 | 3300004480 | Soil | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVKEAGGELVGVY |
Ga0062592_1018968862 | 3300004480 | Soil | MPHYITLMRWTSQGIAGLPAWRERVEEGERIIEDAGGKLVGVYTTLG |
Ga0062594_1027544421 | 3300005093 | Soil | MRWTTQGYAGLPKWRERIEEGERIIDEAGGKMVGVYVTLG |
Ga0066672_108166402 | 3300005167 | Soil | MPHYVTLMRWTSQGVAGLPAWRERVEDGERIIGEAGGSLVGVY |
Ga0066809_101738122 | 3300005168 | Soil | MRWTSQGVAGLPAWRERVEEGERLIEAAGGKLIGVYVTLGR |
Ga0066684_110087712 | 3300005179 | Soil | VPHYVTLMRWTSQGVAGLPAWRERIEDGERIIAEAGGSLV |
Ga0066675_103537653 | 3300005187 | Soil | VAHYISLMRWTTAGRAGLPAWRDRVEDGERLIEEAGGKLVGVWVT |
Ga0070676_107062121 | 3300005328 | Miscanthus Rhizosphere | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVDEAGGKLVGVYV |
Ga0066388_1001386673 | 3300005332 | Tropical Forest Soil | MRWTSQGVAGLPAWRERVEEGERIISEAGGELIGVYVTLGRYDV |
Ga0070661_1018064142 | 3300005344 | Corn Rhizosphere | VPHYITLMKWTSQGRMGLPAWRDRIEEGERTISASGGTLVGVWVTLGQYD |
Ga0070703_105074121 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VPHYVSLMRWTSKGVAGLPAWRERVAEGERIVEEAGGKLVGV |
Ga0070714_1020564532 | 3300005435 | Agricultural Soil | VPHYVSLMRWTSQGRMGLPAWRDRVEEGERTIEEAGGKLVGVWV |
Ga0070710_103122462 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHYVSLMRWTSQGVAGLPAWRDRVEEGERIIGEAGGSLVGVYVTL |
Ga0070711_1006729451 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVDEAGGKLVGV |
Ga0070708_1001841051 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHYVTLMRWTSQGVAGLPAWRERVEDGERIIGEAGGSLVG |
Ga0066686_109617281 | 3300005446 | Soil | VAHYVTLMRWTTQGFAGLPSWRERVEEGERIITEAGGKMVGVYVT |
Ga0066686_109798771 | 3300005446 | Soil | LSLIPRHYSGAVPHYVTLMRWTSQGVAGLPAWRERVEEGQRVIEDAGGQLIGVY |
Ga0066682_107019002 | 3300005450 | Soil | MAHYVTLMRWTTQGVAGLPKWRERVEEGERIITEAGGSMVGVY |
Ga0066682_107731262 | 3300005450 | Soil | MPHYVSLMRWTSQGVAGLPAWRDRVEEGERIISDAGGSLVGV |
Ga0066687_108233042 | 3300005454 | Soil | MRWTTQGVAGLPAWRERVEEGERTIEEAGGSLIGVYVTLGRYD |
Ga0070681_104340941 | 3300005458 | Corn Rhizosphere | VQQYISLIRWTSQGRMGLPAWRDRIEDGEREIEEAGGRLV |
Ga0070706_1001281641 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHYVTLMRWTTQGVAGLPKWRERVEEGERIIAEAGGSMVGVYVTLGR |
Ga0070737_100660003 | 3300005524 | Surface Soil | VPHYISLMRWTSQGRVGLPAWRDRIEDGEREIEDAGGKLVGVWVTFGRYD |
Ga0070732_102740011 | 3300005542 | Surface Soil | VPHYISLMRWTTQGRAGLPAWRDRVEDGERLIEEAGGKLVGVWVTLG |
Ga0070672_1010440042 | 3300005543 | Miscanthus Rhizosphere | VAHYVTLMRFTTQGFAGLPKWRERIEEGERVITEAGGSMVGV |
Ga0070696_1009056282 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHYVTLMKWTSQGRMGLPAWRDRVEEGERTIEQAGGKLVGVWVTL |
Ga0070696_1017184402 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSYIREMAHYVTLMRWTTQGFAGLPSWRERVEEGERIITEAGG |
Ga0066695_108251111 | 3300005553 | Soil | MRWTSQGIAGLPAWRERVEEGQRIIEDTGGKLVGVYV |
Ga0066698_101990961 | 3300005558 | Soil | VPHYVTLMRWTSKGVAGLPAWRERVEEGERVVEDAGGK |
Ga0066698_104929521 | 3300005558 | Soil | VPHYISLMRWTTQGVAGLPAWRDRVEEGQRVIETA |
Ga0066699_103403891 | 3300005561 | Soil | VPHYISLMRWTTQGRAGLPAWRDRVEDGERLIQESGGKLVGVW |
Ga0066693_103942081 | 3300005566 | Soil | MPHYISLIRWTSQGRMGLPAWRDRIEDGEREIEEAGGKLVGVWVTL |
Ga0066703_101157153 | 3300005568 | Soil | MAHYVTLMRWTTQGFAGLPSWRERVEEGERVITEAGGKMVGVYVTLGR |
Ga0068854_1011567961 | 3300005578 | Corn Rhizosphere | VAHYISLMRWTTAGRAGLPAWRDRVEDGERLIEESGGKL |
Ga0066654_103177751 | 3300005587 | Soil | MPHYVTLMRWTSQGVAGLPAWRERIEDGERVIAEAGGSLVGVYVTLG |
Ga0066654_107968452 | 3300005587 | Soil | MRWTTQGFAGLPSWRERVEEGERVITEAGGKMVGVYV |
Ga0066706_106985012 | 3300005598 | Soil | VAHYVTLMRWTTQGYAGLPKWRERIEEGEQIIADAGGKLVG |
Ga0068861_1001087091 | 3300005719 | Switchgrass Rhizosphere | VPHYVTLMRWTSQGVAGLPAWRERVEEGERIIEEA |
Ga0075288_10866761 | 3300005874 | Rice Paddy Soil | VPHYVSLMRWTSTGRMGLPAWRDRVEEGERTIEDAGGSLVGVWVTLGQYDVVE |
Ga0075278_10486072 | 3300005893 | Rice Paddy Soil | MPHFVSLMRWTTQGRTGLPAWRDRIEEGQRLIEEAGGTLVGVWVTL |
Ga0066652_1009318143 | 3300006046 | Soil | MAHYVTLMRWTTQGYAGLPKWRERVEEGEQIIAEAGGTLV |
Ga0075428_1025503472 | 3300006844 | Populus Rhizosphere | VPHYVTLMRWTTQGIAGLPAWRERVEEGERIIEAAGGKLVGVY |
Ga0075431_1002199253 | 3300006847 | Populus Rhizosphere | MRWTSQGVAGLPAWRERVEDGERTITEAGGKLVGVYVTL |
Ga0075425_1027890392 | 3300006854 | Populus Rhizosphere | MGHYVTLMHWTSQGIAGLPAWRERIEEGERIIEEAGGTLVGAY |
Ga0075434_1000281971 | 3300006871 | Populus Rhizosphere | MAHYVTLMRWTTQGYAGLPKWRERIEEGERIIADAG |
Ga0075436_1008405202 | 3300006914 | Populus Rhizosphere | MGHYVTLMHWTSQGIAGLPAWRERIEEGERIIEEAG |
Ga0075436_1013624751 | 3300006914 | Populus Rhizosphere | VGRSRDNGAVPHYVSLMRWTSQGRMGLPAWRDRVEEGERT |
Ga0079219_121625682 | 3300006954 | Agricultural Soil | VAHYISLMRWTTAGRAGLPAWRDRVEDGERLIEDAGGKLVGV |
Ga0075419_107840332 | 3300006969 | Populus Rhizosphere | LPVYISLMQWTSRGLGGLPAWRDRLEQGEREIEKRG |
Ga0075435_1008051761 | 3300007076 | Populus Rhizosphere | VGRSRDNGAVPHYVSLMRWTSQGRMGLPAWRDRVEEGERTIEEAGGKLVGVWVTLG |
Ga0075435_1016780351 | 3300007076 | Populus Rhizosphere | MPHYVSLMRWTSQGVAGLPAWRDRVEEGERIISEAGGSL |
Ga0099827_109481191 | 3300009090 | Vadose Zone Soil | VPHYISLIRWTSQGRLGLPAWRDRVEDGAREIEEAGGR |
Ga0111539_121888592 | 3300009094 | Populus Rhizosphere | MPHYVSLMRWTSQGVAGLPAWRDRVEEGERIISEAGGSLVGV |
Ga0111539_131676431 | 3300009094 | Populus Rhizosphere | VPHYISLMRWTSQGVAGLPGWRERVEEGERIIEEAGGELIG |
Ga0105245_100491584 | 3300009098 | Miscanthus Rhizosphere | MASYIRSVAHYVTLMRFTTQGFAGLPKWRERIEEGERVITEA |
Ga0066709_1004470421 | 3300009137 | Grasslands Soil | VAHYVTLMRWTTQGFAGLPSWRERVEEGERIITEAGGTMVGVYVTL |
Ga0066709_1007261291 | 3300009137 | Grasslands Soil | VPHYVTLMRWTSQGVAGLPAWRERVEEGERVIDGAGGK |
Ga0066709_1046901802 | 3300009137 | Grasslands Soil | VPHYISLMRWTTQGRAGLPAWRDRVEDGERLIQESGGKRVGVWVTLG |
Ga0099792_112490741 | 3300009143 | Vadose Zone Soil | MPHYVSLMRWTSQGRMGLPAWRDRVEEGERTIEEAGGTLVGVWVTL |
Ga0114129_103172681 | 3300009147 | Populus Rhizosphere | MPHYVSLMRWTSQGVAGLPAWRDRVEEGERIISEA |
Ga0105084_10668512 | 3300009811 | Groundwater Sand | MPHYITLMRWTSQGMAGLPAWRERVEEGERTIEASGGS |
Ga0126310_114028921 | 3300010044 | Serpentine Soil | MRWTSQGLAGLPGWRERVEEGERIVSEAGGRLESVYVTL |
Ga0126311_107717741 | 3300010045 | Serpentine Soil | VAHYVTLMRWTTQGFAGLPKWRERLEEGEQIIADAGGSLV |
Ga0126382_119983472 | 3300010047 | Tropical Forest Soil | MPHYVSLMRWTSKGVAGLPAWRERVEEGERIIEAAGGKLVGVYVTLGR |
Ga0099796_105223252 | 3300010159 | Vadose Zone Soil | MPHYVSLMRWTSQGRMGLPAWRDRVEEGERTIEEAGGKLVGV |
Ga0134082_103871972 | 3300010303 | Grasslands Soil | VPHYVTLMRWTSQGVAGLPAWRERVEDGERIISAAGGNLVGVYVTLGRY |
Ga0134065_101812902 | 3300010326 | Grasslands Soil | VKIRPVPHYITLMKWTSQGRVGLPAWRDRVEEGERMIEEGGGTLVGVYVTLGQYD |
Ga0134062_104678831 | 3300010337 | Grasslands Soil | MASYIRAVAHYVTLMRWTTQGVAGLPKWRERVEEGERIITE |
Ga0126378_125124311 | 3300010361 | Tropical Forest Soil | MPHYVTLMRWTSQGIAGLPAWRERIEEGERIIEEAGGKLVGAFV |
Ga0134128_116073291 | 3300010373 | Terrestrial Soil | MPHYITLMRWTSQGIAGLPAWRERVEDGQRIIEETGGTLVGVYATLGR |
Ga0134128_122459622 | 3300010373 | Terrestrial Soil | LRHYREAVPHYVSLMRWTSKGVAGLPAWRERVEEG |
Ga0126381_1011780863 | 3300010376 | Tropical Forest Soil | VPHYTSLNRWTSQGRMGLPAWRDRVEDGAREIEEAG |
Ga0126381_1046292531 | 3300010376 | Tropical Forest Soil | MRWTSQGRIGLPAWRDRVEDGEREIEDAGGKLVGVWVTLGRYDVVEVF |
Ga0105246_104396523 | 3300011119 | Miscanthus Rhizosphere | MASYIRSVAHYVTLMRFTTQGFAGLPKWRERIEEGERVITEAGGSMVGV |
Ga0120167_11155482 | 3300012001 | Permafrost | MRVPHYISLMRWTSQGRLGLPAWRDRIEDGEREIEEAGGRPVGGGV |
Ga0120174_10500041 | 3300012008 | Permafrost | MRVPHYISLMRWTSQGRLGLPAWRDRIEDGEREIEEAGGRPVGGWGTLGRHDVVEGF |
Ga0120118_11784471 | 3300012010 | Permafrost | MASYIRRVAHYVTLMRWTTQGYAGLPKWRERIEEGERIITEAGGSM |
Ga0136618_105055602 | 3300012188 | Polar Desert Sand | MPHYISLMRWTSQGVAGLPGWRERVEDGERMIEEAGGTLTGVYV |
Ga0137388_103756851 | 3300012189 | Vadose Zone Soil | MPHYVTLMKWTSQGRMGLPAWRDRVEEGERTIEEAGGKLVGVWVT |
Ga0137364_106492231 | 3300012198 | Vadose Zone Soil | VAHYVTLMRWTTQGVAGLPKWRERVEEGERIITEAGGSMVGVYVTLGR |
Ga0137382_112734281 | 3300012200 | Vadose Zone Soil | MRWTSQGVAGLPAWRERVEDGERIIGEAGGSLVGV |
Ga0137382_113087602 | 3300012200 | Vadose Zone Soil | MPHFISLMRWTSTGRAGLPAWRDRVEEGERMIEEA |
Ga0137363_109979862 | 3300012202 | Vadose Zone Soil | VPHYISLMRWTTAGRAGLPAWRDRVEDGERLIEEAGGKLVGVWVTL |
Ga0137374_108369161 | 3300012204 | Vadose Zone Soil | MPHYVSLMRWTSQGVSGLPGWRERVEEGERIIEEAGGKLIGV |
Ga0137376_117323591 | 3300012208 | Vadose Zone Soil | MAHYVTLMRWTTQGVAGLPKWRERVEEGERIITEA |
Ga0137379_116181632 | 3300012209 | Vadose Zone Soil | VGHYVTLMRWTTQGYAGLPKWRERIEEGARIIAEAGGTMVGVYV |
Ga0137370_100346683 | 3300012285 | Vadose Zone Soil | MPHYVTLMRWTSQGVAGLPAWRERVEDGERIIAEAGGSLVGVYVTLGRY |
Ga0137367_106874091 | 3300012353 | Vadose Zone Soil | VPHYITLMRWTTQGYAGLPKWRERLEEGERIITDAGGSLVGVYVTLGRY |
Ga0137369_100268941 | 3300012355 | Vadose Zone Soil | MRWPTPGYAGLPKWRERVEEGEQIIKDAGGTLVGVYVTLGRYDVVE |
Ga0137375_100625941 | 3300012360 | Vadose Zone Soil | MAHYVTLMRWTTQGYAGLPKWRERLEEGERIIAEAGGSIVGVYVTL |
Ga0157327_10878791 | 3300012512 | Arabidopsis Rhizosphere | MPHYVTLMRWTSQGVAGLPAWRERVEEGERVIAEAGGELIGVYV |
Ga0137373_100312064 | 3300012532 | Vadose Zone Soil | VPHYITLMRWTTQGYAGLPKWRERLEEGERIITDAGGSLVGVYVTLGR* |
Ga0137373_107229741 | 3300012532 | Vadose Zone Soil | LPHYITLMRWTSQGVAGLPGWRERVEEGERIIEEAGGKLI |
Ga0157304_11113291 | 3300012882 | Soil | MPHYVSLMRWTSQGVAGLPAWRDRVEEGERIISEAGGSLVGVYVTL |
Ga0157293_101089241 | 3300012898 | Soil | VHDCVVPHYVTLMRWTSQGVAGLPAWRDRVEDGERIIAEA |
Ga0157308_101097751 | 3300012910 | Soil | MPHYISLMRWTSQGMAGLPAWRERVEEGERIIEEAGGSLIGVY |
Ga0137395_109348751 | 3300012917 | Vadose Zone Soil | MPHYVSLMRWTSTGRMGLPAWRDRVEEGERTIEEAGGQLVGV |
Ga0137407_119894002 | 3300012930 | Vadose Zone Soil | MPHYVSLMRWTSTGRMGLPAWRDRVEEGEQMIEDAGGKLV |
Ga0164300_106295842 | 3300012951 | Soil | VAHYVTLMRFTTQGFAGLPKWRERIEEGERIITEAGGSMVGVYV |
Ga0164299_116304301 | 3300012958 | Soil | MPHYVSLMRWTTQGIAGLPAWRERVEEGQRYIEEAGGTLV |
Ga0164302_114498642 | 3300012961 | Soil | MPHYVSLMRWTSKGVAGLPAWRERVDEGERIVEEAGGKLVGV* |
Ga0134077_104028321 | 3300012972 | Grasslands Soil | VPHYVTLMRWTSQGVAGLPAWRERVEEGQRVIEDAGGQLIGVYVTLG |
Ga0134077_104733081 | 3300012972 | Grasslands Soil | MASYIRGVAHYVTLMRWTTQGVAGLPKWRERVEEGQRVIEDAGGQLIGVYVTLG |
Ga0134076_103782072 | 3300012976 | Grasslands Soil | VAHYVTLMRWTTQGYAGLPGWRERIEEGERIITDAGGSLVGG* |
Ga0164304_118758071 | 3300012986 | Soil | VPHYISLIRWTSQGRMGLPAWRDRVEDGEREIEEAGGKLVGV |
Ga0157371_106039762 | 3300013102 | Corn Rhizosphere | MAHYVTLMRWTTQGFAGLPKWRERIEEGEQIIAECGGTL |
Ga0157369_114608982 | 3300013105 | Corn Rhizosphere | MAHYVTLMRWTTQGFAGLPKWRERIEEGEQIIAECGGTLV |
Ga0120154_11137031 | 3300013501 | Permafrost | MRVPHYISLMRWTSQGRLGLPAWRDRIEDGEREIEEAGGGLVGGRGTAG |
Ga0120147_10053941 | 3300013758 | Permafrost | MRWTSQGLAGLPAWRERVEDGERTITEAGGTLVGVYVTLGRYD |
Ga0120111_11090701 | 3300013764 | Permafrost | MASYIRRVAHYVTLMRWTTQGYAGLPKWRGGIEEGGAGIPE |
Ga0163163_133192631 | 3300014325 | Switchgrass Rhizosphere | VPHYISLIRWTSQRRIGLPAWRDRIEDGEREIEEA |
Ga0182008_104031221 | 3300014497 | Rhizosphere | VPHYITLMRWTTQGYAGLPKWRERVEEGEQIIADAGGTLVGVYVTLG |
Ga0120171_10149961 | 3300014827 | Permafrost | MRWTSQGLAGLPAWRERVEDGERTITEAGGTLVGVYVTLGRYDVV |
Ga0167643_10027214 | 3300015089 | Glacier Forefield Soil | MPHYVSLIRWTSQGRLGLPAWRDRIEDGEREIEEAGGKLVGV |
Ga0134073_103803301 | 3300015356 | Grasslands Soil | MPHYVSLMRWTSTGRMGLPAWRDRVEEGEQMIEDAGGKLVGVWVTLGQY |
Ga0134089_105633102 | 3300015358 | Grasslands Soil | VAHYVTLMRWTTQGFAGLPSWRERVEEGERVITEAGGTMV |
Ga0132258_116677633 | 3300015371 | Arabidopsis Rhizosphere | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVKEAGGELVGV |
Ga0132256_1000950793 | 3300015372 | Arabidopsis Rhizosphere | LRHYRRVPHYVSLMRWTSKGVAGLPAWRERVEEGERIVEEAGGE |
Ga0190266_104550961 | 3300017965 | Soil | MRWTSQGMAGLPAWRERVEEGERIIEEAGGSLIGVYVTLGR |
Ga0187788_104997051 | 3300018032 | Tropical Peatland | VPHYVTLMRWTSQGFAGLPGWRERVEEGQQVIEGA |
Ga0184619_100813991 | 3300018061 | Groundwater Sediment | MPHYVSLMRWTSQGVAGLPAWRDRIEEGERIIGEAGGSLVG |
Ga0184619_102654151 | 3300018061 | Groundwater Sediment | VPHYISLMRWTTQGVAGLPAWRERVEEGQRTIEEAGGQLIGVYV |
Ga0184619_105077951 | 3300018061 | Groundwater Sediment | MAHYVTLMRWTTQGYAGLPKWRERLEEGERIIADAGGSLVGVYVTL |
Ga0187773_107661342 | 3300018064 | Tropical Peatland | VPHYVTLMRWTSQGFAGLPGWRERVEEGQQVIEGAGGTLVGVYVTLGQ |
Ga0066667_120036702 | 3300018433 | Grasslands Soil | MPHYVSLMRWTSKGVAGLPAWRERVEEGERIVEEAG |
Ga0066667_121743762 | 3300018433 | Grasslands Soil | VAHYISLMRWTTAGRAGLPAWRDRVEDGERLIEEAGGKLVGVWVTL |
Ga0190270_115835951 | 3300018469 | Soil | MPHYISLMRWTSQGMAGLPAWRERVEEGERIIEEAG |
Ga0173482_100478091 | 3300019361 | Soil | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVEEAGGSLVGV |
Ga0173479_101179871 | 3300019362 | Soil | MPHYISLMRWTSQGMAGLPAWRERVEEGERIIEEAGGSLIGVYVT |
Ga0173479_103031781 | 3300019362 | Soil | VPHYISLIRWTSQGRLGLPAWRDRVEDGEREIEETGGKLVGV |
Ga0193756_10322121 | 3300019866 | Soil | MAHYVTLMRFTTQGFAGLPKWRERIEEGERVITEAGGK |
Ga0193728_13064702 | 3300019890 | Soil | MASYIRRVAHYVTLMRWTTQGYAGLPKWRERIEEGE |
Ga0210382_100762501 | 3300021080 | Groundwater Sediment | MRWTSQGLAGLPGWRERVEEGERTIQEAGGRLVGVYVTL |
Ga0182009_104870252 | 3300021445 | Soil | VPHYITLMRWTSQGRMGLPAWRDRVEEGERLITENGGTLVGVYVTLGRY |
Ga0247794_101370532 | 3300024055 | Soil | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVQEAGGE |
Ga0247664_11180301 | 3300024232 | Soil | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVEEAGG |
Ga0207652_118119802 | 3300025921 | Corn Rhizosphere | MPHYITLMKWTSQGRMGLPAWRDRVEEGERLIEEGGGR |
Ga0207646_109875371 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHYVTLMRWTSQGVAGLPAWRERVEEGEQIIHEAGGTLV |
Ga0207646_117502801 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VPHYISLMRWTSQGRMGLPAWRDRVEDGERLIVEAGGKLVNVWVTFG |
Ga0207681_115065602 | 3300025923 | Switchgrass Rhizosphere | VPHYVTLMRWTSQGVAGLPAWRERVEEGERIIEEAGGKLI |
Ga0207687_102615761 | 3300025927 | Miscanthus Rhizosphere | VAHYVTLMRFTTQGFAGLPKWRERIEEGERVITEAGG |
Ga0207664_104025083 | 3300025929 | Agricultural Soil | VAEKIRAAVPHYISLMRWTTQGRAGLPAWRDRVEDGERLIEE |
Ga0207704_106496772 | 3300025938 | Miscanthus Rhizosphere | MPHYVSLMRWTSQGVAGLPAWRDRIEEGERIIGEAGGSLVGVYV |
Ga0207691_104144793 | 3300025940 | Miscanthus Rhizosphere | VAHYVTLMRFTTQGFAGLPKWRERIEEGERVITEAGGSMVGVYVT |
Ga0207661_100018471 | 3300025944 | Corn Rhizosphere | VPHYITLMRWTSQGRMGLPAWRDRVEEGERMIQEGG |
Ga0208529_10200832 | 3300026008 | Rice Paddy Soil | VPHYVSLMRWTSTGRLGLPAWRDRVEEGERMIDEAGGTLVGVWVTLG |
Ga0207702_122417541 | 3300026078 | Corn Rhizosphere | VPHYITLMKWTSQGRMGLPAWRDRIEEGERTISASGGTLVGVWVTLG |
Ga0207702_123366451 | 3300026078 | Corn Rhizosphere | MPHYISLMRWTSQGVAGLPGWRERVEEGERIIEDAGGELIGV |
Ga0209808_11376033 | 3300026523 | Soil | VPHYISLMRWTTQGRAGLPAWRDRVEDGERLIQESGGKLVG |
Ga0209156_103720251 | 3300026547 | Soil | VPHYVTLMRWTSQGVAGLPAWRERVEEGQRVIEDAGGQLIGVYV |
Ga0209161_105714431 | 3300026548 | Soil | MPHYVSLMRWTSQGVAGLPAWRDRVEEGERIISDAG |
Ga0256866_12135141 | 3300027650 | Soil | VPHYISLMRWTSQGMAGLPGWRERVEEGERIIKEAGGSLTGVYVTLG |
Ga0209579_106752102 | 3300027869 | Surface Soil | MRWTSQGRLGLPAWRDRVEEGEREIEQAGGKLVGV |
Ga0209486_109563561 | 3300027886 | Agricultural Soil | MPHYISLMRWTSQGLAGLPAWRERVEEGERIIQDAGGSLIGVYVT |
Ga0209168_104516562 | 3300027986 | Surface Soil | MAVPHYISLMRWTTAGRAGLPAWRDRVEDGERLIQEAGGTLVGVYVT |
Ga0307276_100646942 | 3300028705 | Soil | VAHYVTLMRFTTQGFAGLPKWRERIEEGERIITEAGGS |
Ga0307322_101505851 | 3300028710 | Soil | MPHYVSLMRWTSQGVAGLPAWRDRIEEGERIIGEAGGSL |
Ga0307293_101242922 | 3300028711 | Soil | VPHYVTLMRWTSQGVAGLPAWRERVEEGERIIDEAGGSLIGVYVTFGRY |
Ga0307309_101288942 | 3300028714 | Soil | MRFTTQGFAGLPKWRERIEEGERIITEAGGSMVGVYV |
Ga0307317_100148294 | 3300028720 | Soil | MPHYVTLMRFTTQGFAGLPKWRERIEEGERVITEAGGKMVGVYVTLG |
Ga0307280_103089442 | 3300028768 | Soil | MRWTTQGYAGLPKWRERIEEGERIITEAGGSLVGVYVTL |
Ga0307306_101148361 | 3300028782 | Soil | MPHYVSLMRWTSTGRMGLPAWRDRVEEGERTIEEAGGTLVGV |
Ga0307282_104031081 | 3300028784 | Soil | MAHYVTLMRWTTQGYAGLPKWRERLEEGERIIADAGGS |
Ga0307323_101538152 | 3300028787 | Soil | VPHYVTLMRWTSQGVAGLPAWRERVEEGERIIEEAGGKLIGVYVTLG |
Ga0307323_102093172 | 3300028787 | Soil | MAHYVTLMRFTTQGFAGLPKWRERIEEGERIITEAGGS |
Ga0307299_100925433 | 3300028793 | Soil | VPHYISLMRWTSQGVAGLPAWRDRVEEGERIIGAAGGSLV |
Ga0307284_104071491 | 3300028799 | Soil | MPHYISLMRWTSQGLAGLPAWRERVEEGERTITEAGGSLVGVYVT |
Ga0307284_104219751 | 3300028799 | Soil | VPHYVTLMRWTSQGVAGLPAWRERVEEGERIIEEAG |
Ga0307305_100941753 | 3300028807 | Soil | MPHYISLMRWTSQGLAGLPAWRERVEDGERTITEAGGTLVGV |
Ga0307292_100774081 | 3300028811 | Soil | MPHYVSLMRWTSQGVAGLPAWRDRIEEGERIIGEAG |
Ga0307302_104994361 | 3300028814 | Soil | VAHYVTLMRWTTQGYAGLPKWRERLEEGERIIAEAGGSIVGV |
Ga0307302_105361402 | 3300028814 | Soil | MAHYVTLMRWTTQGYAGLPKWRERLEEGERIIADAGGSLV |
Ga0307296_101694911 | 3300028819 | Soil | MAHYVTLMRWTTQGYAGLPKWRERLEEGERIIADAGGSLVGVY |
Ga0307310_100387804 | 3300028824 | Soil | MAHYVTLMRWTTQGYAGLPKWRERLEEGERIIAEAGGSIVGV |
Ga0307310_101376513 | 3300028824 | Soil | MRWTTQGYAGLPKWRERIEEGERIITEAGGSMVGV |
Ga0307312_101831691 | 3300028828 | Soil | VAHYVTLMRWTTQGYAGLPKWRERIEEGERIITEAGGS |
Ga0307312_105450402 | 3300028828 | Soil | MRWTTQGYAGLPKWRERIEEGERIITEAGGSMVGVYVTLGRYDVVE |
Ga0307312_106125891 | 3300028828 | Soil | VAHYVTLMRWTTQGYAGLPKWRERLEDGERIIAEAGGSIVGVYVTLGR |
Ga0307312_109885392 | 3300028828 | Soil | MPHYVSLMRWTSTGRMGLPAWRDRVEEGERTIEEAGGTLVGVWVT |
Ga0307289_104290702 | 3300028875 | Soil | VPHYVSLMRWTSKGVAGLPAWRERVEEGERMVEEAGGK |
Ga0307278_103850492 | 3300028878 | Soil | VAHYITLMRWTTQGYAGLPKWRERVEEGEQIIKDAGGTLVGVYVT |
Ga0307277_100179421 | 3300028881 | Soil | MGVVPHYVTLMRWTSQGVAGLPAWRDRIEEGERTIAEAGGNLVGVYVTLG |
Ga0307277_105664781 | 3300028881 | Soil | VPHYISLMRWTSQGVAGLPAWRERVEEGQRTIEEAGGTLIGV |
Ga0307308_105951861 | 3300028884 | Soil | VPHYVSLMRWTSKGVAGLPAWRERVEEGERMVEEAGGKLVGV |
Ga0307308_106232181 | 3300028884 | Soil | MPHYVSLMRWTSTGRMGLPAWRDRVEEGERTIEEAGGTLVG |
Ga0299907_101760724 | 3300030006 | Soil | MITAVPHYISLMRWTSQGMAGLPGWRERVEEGERIIV |
Ga0265325_104928732 | 3300031241 | Rhizosphere | VPHYISLMRWTTQSRAGVAGLPAWRDRVEDGERVIEEA |
Ga0307418_11369721 | 3300031341 | Salt Marsh | MPCYISLMRWTSQDRMGLPAWRDRIEEGERTIEEAGGTLV |
Ga0318568_105805631 | 3300031819 | Soil | MPHYVTLMHWTSQGIAGLPAWRERIEEGERIIKEAGG |
Ga0307473_113083042 | 3300031820 | Hardwood Forest Soil | VPHYVTLMRWTSQGVAGLPAWRERVEDGERIIGEAGGSLVGVYVT |
Ga0307406_102415323 | 3300031901 | Rhizosphere | VPHYVSLMRWTSKGVAGLPAWRERVEEGERIVQEAGGSLVGVYVTLGRY |
Ga0307406_104680903 | 3300031901 | Rhizosphere | VPHYISLMRWTSKGVAGLPAWRERVEEGERIVQEAGGSLVGVY |
Ga0307406_116830112 | 3300031901 | Rhizosphere | MPHYITLMRWTTQGYVGLPKWRERVEEGERVIREAGGHLVGVYV |
Ga0307479_114029982 | 3300031962 | Hardwood Forest Soil | VPHYISLMHWTTQGRMGLPAWRDRVEDGERLIKEAGGSLVNVWVTLG |
Ga0335080_106124583 | 3300032828 | Soil | MRWTNQGRAGLPAWRDRVEDGERLIEESGGKLVGVWVTFGRYD |
Ga0335080_117058522 | 3300032828 | Soil | VPHYISLIRWTSQGRMGLPAWRDRIEDGEREIEEAGG |
Ga0335083_107782462 | 3300032954 | Soil | VPHYISLMRWTTAGRAGLPAWRDRVEDGERVIEEAGGKLVGVWV |
Ga0310810_109817051 | 3300033412 | Soil | MPHYVSLMRWTSQGVAGLPAWRDRVEEGQRIISDAGGSL |
⦗Top⦘ |