| Basic Information | |
|---|---|
| Family ID | F024236 |
| Family Type | Metagenome |
| Number of Sequences | 206 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELR |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 206 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 35.92 % |
| % of genes near scaffold ends (potentially truncated) | 47.09 % |
| % of genes from short scaffolds (< 2000 bps) | 82.52 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.534 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (29.612 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.971 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (79.126 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 206 Family Scaffolds |
|---|---|---|
| PF07040 | DUF1326 | 3.40 |
| PF03401 | TctC | 1.94 |
| PF13505 | OMP_b-brl | 1.94 |
| PF08734 | GYD | 1.94 |
| PF12071 | DUF3551 | 1.46 |
| PF04226 | Transgly_assoc | 1.46 |
| PF01068 | DNA_ligase_A_M | 0.97 |
| PF12706 | Lactamase_B_2 | 0.97 |
| PF03457 | HA | 0.97 |
| PF13493 | DUF4118 | 0.97 |
| PF01436 | NHL | 0.97 |
| PF13458 | Peripla_BP_6 | 0.97 |
| PF13191 | AAA_16 | 0.97 |
| PF12833 | HTH_18 | 0.49 |
| PF13202 | EF-hand_5 | 0.49 |
| PF01274 | Malate_synthase | 0.49 |
| PF07813 | LTXXQ | 0.49 |
| PF14026 | DUF4242 | 0.49 |
| PF13676 | TIR_2 | 0.49 |
| PF09851 | SHOCT | 0.49 |
| PF02530 | Porin_2 | 0.49 |
| PF04828 | GFA | 0.49 |
| PF06577 | EipA | 0.49 |
| PF00313 | CSD | 0.49 |
| PF00528 | BPD_transp_1 | 0.49 |
| PF03446 | NAD_binding_2 | 0.49 |
| PF02668 | TauD | 0.49 |
| PF00589 | Phage_integrase | 0.49 |
| PF01323 | DSBA | 0.49 |
| PF16347 | DUF4976 | 0.49 |
| PF07045 | DUF1330 | 0.49 |
| PF01165 | Ribosomal_S21 | 0.49 |
| PF02771 | Acyl-CoA_dh_N | 0.49 |
| PF04430 | DUF498 | 0.49 |
| PF10691 | DUF2497 | 0.49 |
| PF12802 | MarR_2 | 0.49 |
| PF13392 | HNH_3 | 0.49 |
| PF09694 | Gcw_chp | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
|---|---|---|---|
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 3.40 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.94 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.94 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.46 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.97 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.97 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.49 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.49 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
| COG2225 | Malate synthase | Energy production and conversion [C] | 0.49 |
| COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.49 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.49 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.53 % |
| All Organisms | root | All Organisms | 34.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10075777 | Not Available | 848 | Open in IMG/M |
| 3300000716|JGI12331J11884_104588 | Not Available | 553 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10018077 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10067672 | Not Available | 775 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1031041 | Not Available | 564 | Open in IMG/M |
| 3300004633|Ga0066395_10202610 | Not Available | 1039 | Open in IMG/M |
| 3300004633|Ga0066395_10210616 | Not Available | 1023 | Open in IMG/M |
| 3300004633|Ga0066395_10356008 | Not Available | 815 | Open in IMG/M |
| 3300005332|Ga0066388_100385735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2047 | Open in IMG/M |
| 3300005332|Ga0066388_100427054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1968 | Open in IMG/M |
| 3300005332|Ga0066388_100593562 | Not Available | 1731 | Open in IMG/M |
| 3300005332|Ga0066388_100711828 | Not Available | 1609 | Open in IMG/M |
| 3300005332|Ga0066388_100716435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12 | 1605 | Open in IMG/M |
| 3300005332|Ga0066388_101197155 | Not Available | 1298 | Open in IMG/M |
| 3300005332|Ga0066388_101496060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| 3300005332|Ga0066388_102390096 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005332|Ga0066388_103741106 | Not Available | 776 | Open in IMG/M |
| 3300005332|Ga0066388_104186918 | Not Available | 735 | Open in IMG/M |
| 3300005332|Ga0066388_104294822 | Not Available | 726 | Open in IMG/M |
| 3300005332|Ga0066388_104378706 | Not Available | 719 | Open in IMG/M |
| 3300005332|Ga0066388_105355477 | Not Available | 650 | Open in IMG/M |
| 3300005332|Ga0066388_105659360 | Not Available | 632 | Open in IMG/M |
| 3300005332|Ga0066388_106160351 | Not Available | 605 | Open in IMG/M |
| 3300005332|Ga0066388_106430454 | Not Available | 592 | Open in IMG/M |
| 3300005332|Ga0066388_106607454 | Not Available | 584 | Open in IMG/M |
| 3300005332|Ga0066388_108158359 | Not Available | 523 | Open in IMG/M |
| 3300005332|Ga0066388_108400408 | Not Available | 515 | Open in IMG/M |
| 3300005332|Ga0066388_108492926 | Not Available | 511 | Open in IMG/M |
| 3300005332|Ga0066388_108820243 | Not Available | 500 | Open in IMG/M |
| 3300005764|Ga0066903_100189327 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300005764|Ga0066903_100217075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2892 | Open in IMG/M |
| 3300005764|Ga0066903_100629156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1869 | Open in IMG/M |
| 3300005764|Ga0066903_101236594 | Not Available | 1390 | Open in IMG/M |
| 3300005764|Ga0066903_101345510 | Not Available | 1338 | Open in IMG/M |
| 3300005764|Ga0066903_101727414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1193 | Open in IMG/M |
| 3300005764|Ga0066903_101866845 | Not Available | 1150 | Open in IMG/M |
| 3300005764|Ga0066903_102270826 | Not Available | 1047 | Open in IMG/M |
| 3300005764|Ga0066903_102299254 | Not Available | 1041 | Open in IMG/M |
| 3300005764|Ga0066903_102349788 | Not Available | 1030 | Open in IMG/M |
| 3300005764|Ga0066903_102367120 | Not Available | 1027 | Open in IMG/M |
| 3300005764|Ga0066903_102847458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300005764|Ga0066903_103319172 | Not Available | 869 | Open in IMG/M |
| 3300005764|Ga0066903_104162839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300005764|Ga0066903_104256950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 765 | Open in IMG/M |
| 3300005764|Ga0066903_105567987 | Not Available | 663 | Open in IMG/M |
| 3300005764|Ga0066903_105581199 | Not Available | 662 | Open in IMG/M |
| 3300005764|Ga0066903_106086605 | Not Available | 631 | Open in IMG/M |
| 3300005764|Ga0066903_107725714 | Not Available | 553 | Open in IMG/M |
| 3300005764|Ga0066903_108151570 | Not Available | 536 | Open in IMG/M |
| 3300005764|Ga0066903_108777850 | Not Available | 513 | Open in IMG/M |
| 3300009792|Ga0126374_10270358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1122 | Open in IMG/M |
| 3300009792|Ga0126374_11554076 | Not Available | 545 | Open in IMG/M |
| 3300010043|Ga0126380_12194395 | Not Available | 510 | Open in IMG/M |
| 3300010046|Ga0126384_11062060 | Not Available | 740 | Open in IMG/M |
| 3300010047|Ga0126382_11757741 | Not Available | 581 | Open in IMG/M |
| 3300010048|Ga0126373_10079063 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300010048|Ga0126373_10189640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1984 | Open in IMG/M |
| 3300010048|Ga0126373_10515293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
| 3300010048|Ga0126373_10544160 | Not Available | 1208 | Open in IMG/M |
| 3300010048|Ga0126373_12046121 | Not Available | 635 | Open in IMG/M |
| 3300010358|Ga0126370_10098820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2013 | Open in IMG/M |
| 3300010359|Ga0126376_11403153 | Not Available | 723 | Open in IMG/M |
| 3300010360|Ga0126372_10661435 | Not Available | 1013 | Open in IMG/M |
| 3300010360|Ga0126372_12340493 | Not Available | 584 | Open in IMG/M |
| 3300010361|Ga0126378_11672968 | Not Available | 723 | Open in IMG/M |
| 3300010361|Ga0126378_11802720 | Not Available | 696 | Open in IMG/M |
| 3300010361|Ga0126378_12103019 | Not Available | 644 | Open in IMG/M |
| 3300010362|Ga0126377_10517448 | Not Available | 1227 | Open in IMG/M |
| 3300010362|Ga0126377_11241336 | Not Available | 816 | Open in IMG/M |
| 3300010376|Ga0126381_100097873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3737 | Open in IMG/M |
| 3300010376|Ga0126381_100249909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2402 | Open in IMG/M |
| 3300010376|Ga0126381_100338357 | Not Available | 2076 | Open in IMG/M |
| 3300010376|Ga0126381_100380090 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| 3300010376|Ga0126381_100422711 | Not Available | 1862 | Open in IMG/M |
| 3300010376|Ga0126381_101086635 | Not Available | 1155 | Open in IMG/M |
| 3300010376|Ga0126381_101110047 | Not Available | 1142 | Open in IMG/M |
| 3300010376|Ga0126381_102446593 | Not Available | 749 | Open in IMG/M |
| 3300010376|Ga0126381_104398127 | Not Available | 545 | Open in IMG/M |
| 3300010398|Ga0126383_13651622 | Not Available | 503 | Open in IMG/M |
| 3300010863|Ga0124850_1000468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8849 | Open in IMG/M |
| 3300010863|Ga0124850_1019383 | Not Available | 2174 | Open in IMG/M |
| 3300012971|Ga0126369_10719314 | Not Available | 1077 | Open in IMG/M |
| 3300012971|Ga0126369_11169499 | Not Available | 859 | Open in IMG/M |
| 3300012971|Ga0126369_12470217 | Not Available | 605 | Open in IMG/M |
| 3300016270|Ga0182036_10126504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1783 | Open in IMG/M |
| 3300016294|Ga0182041_10015125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4553 | Open in IMG/M |
| 3300016294|Ga0182041_10168524 | Not Available | 1711 | Open in IMG/M |
| 3300016294|Ga0182041_11330302 | Not Available | 658 | Open in IMG/M |
| 3300016319|Ga0182033_11080624 | Not Available | 716 | Open in IMG/M |
| 3300016319|Ga0182033_11542192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia massiliensis | 600 | Open in IMG/M |
| 3300016319|Ga0182033_11887710 | Not Available | 543 | Open in IMG/M |
| 3300016341|Ga0182035_10280507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1358 | Open in IMG/M |
| 3300016341|Ga0182035_11225502 | Not Available | 670 | Open in IMG/M |
| 3300016371|Ga0182034_10487114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1026 | Open in IMG/M |
| 3300016371|Ga0182034_11000908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300016371|Ga0182034_11139559 | Not Available | 677 | Open in IMG/M |
| 3300016371|Ga0182034_12050709 | Not Available | 505 | Open in IMG/M |
| 3300016387|Ga0182040_10032315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3080 | Open in IMG/M |
| 3300016387|Ga0182040_10705534 | Not Available | 825 | Open in IMG/M |
| 3300016404|Ga0182037_10721277 | Not Available | 855 | Open in IMG/M |
| 3300016422|Ga0182039_11510307 | Not Available | 612 | Open in IMG/M |
| 3300016422|Ga0182039_11872115 | Not Available | 551 | Open in IMG/M |
| 3300016422|Ga0182039_12226991 | Not Available | 506 | Open in IMG/M |
| 3300016445|Ga0182038_10439051 | Not Available | 1102 | Open in IMG/M |
| 3300016445|Ga0182038_10625550 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300017959|Ga0187779_10052758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2374 | Open in IMG/M |
| 3300017961|Ga0187778_10579044 | Not Available | 751 | Open in IMG/M |
| 3300017973|Ga0187780_10765035 | Not Available | 698 | Open in IMG/M |
| 3300018058|Ga0187766_11085845 | Not Available | 574 | Open in IMG/M |
| 3300018060|Ga0187765_10037010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2447 | Open in IMG/M |
| 3300021560|Ga0126371_10009199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8892 | Open in IMG/M |
| 3300021560|Ga0126371_10033677 | Not Available | 4817 | Open in IMG/M |
| 3300021560|Ga0126371_10272357 | Not Available | 1813 | Open in IMG/M |
| 3300021560|Ga0126371_11234504 | Not Available | 883 | Open in IMG/M |
| 3300021560|Ga0126371_12013561 | Not Available | 695 | Open in IMG/M |
| 3300021560|Ga0126371_12243206 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300021560|Ga0126371_12999003 | Not Available | 572 | Open in IMG/M |
| 3300021560|Ga0126371_13150946 | Not Available | 558 | Open in IMG/M |
| 3300026330|Ga0209473_1269995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J367 | 576 | Open in IMG/M |
| 3300026804|Ga0207737_106630 | Not Available | 810 | Open in IMG/M |
| 3300026823|Ga0207759_114606 | Not Available | 616 | Open in IMG/M |
| 3300026835|Ga0207782_100882 | Not Available | 3807 | Open in IMG/M |
| 3300026871|Ga0207825_103752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1282 | Open in IMG/M |
| 3300026908|Ga0207787_1002306 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
| 3300026927|Ga0207744_1006756 | Not Available | 1177 | Open in IMG/M |
| 3300026927|Ga0207744_1012210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300026945|Ga0207743_1016083 | Not Available | 776 | Open in IMG/M |
| 3300027014|Ga0207815_1023763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 752 | Open in IMG/M |
| 3300027516|Ga0207761_1071164 | Not Available | 675 | Open in IMG/M |
| 3300027703|Ga0207862_1260287 | Not Available | 507 | Open in IMG/M |
| 3300027874|Ga0209465_10038849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2259 | Open in IMG/M |
| 3300027874|Ga0209465_10198274 | Not Available | 1002 | Open in IMG/M |
| 3300031543|Ga0318516_10233939 | Not Available | 1062 | Open in IMG/M |
| 3300031545|Ga0318541_10001275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9252 | Open in IMG/M |
| 3300031545|Ga0318541_10150406 | Not Available | 1277 | Open in IMG/M |
| 3300031545|Ga0318541_10454533 | Not Available | 716 | Open in IMG/M |
| 3300031546|Ga0318538_10660061 | Not Available | 567 | Open in IMG/M |
| 3300031573|Ga0310915_10002379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9984 | Open in IMG/M |
| 3300031640|Ga0318555_10182333 | Not Available | 1129 | Open in IMG/M |
| 3300031680|Ga0318574_10484712 | Not Available | 724 | Open in IMG/M |
| 3300031682|Ga0318560_10099722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 | 1501 | Open in IMG/M |
| 3300031713|Ga0318496_10465995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300031713|Ga0318496_10784605 | Not Available | 525 | Open in IMG/M |
| 3300031719|Ga0306917_10024857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3759 | Open in IMG/M |
| 3300031719|Ga0306917_10330429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12 | 1182 | Open in IMG/M |
| 3300031719|Ga0306917_10368587 | Not Available | 1118 | Open in IMG/M |
| 3300031719|Ga0306917_10837804 | Not Available | 721 | Open in IMG/M |
| 3300031724|Ga0318500_10605520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 555 | Open in IMG/M |
| 3300031736|Ga0318501_10682886 | Not Available | 566 | Open in IMG/M |
| 3300031744|Ga0306918_10973553 | Not Available | 659 | Open in IMG/M |
| 3300031771|Ga0318546_10003721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7242 | Open in IMG/M |
| 3300031781|Ga0318547_10520611 | Not Available | 735 | Open in IMG/M |
| 3300031793|Ga0318548_10062183 | Not Available | 1732 | Open in IMG/M |
| 3300031793|Ga0318548_10272148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 833 | Open in IMG/M |
| 3300031797|Ga0318550_10003217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5538 | Open in IMG/M |
| 3300031797|Ga0318550_10206966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 950 | Open in IMG/M |
| 3300031797|Ga0318550_10263534 | Not Available | 836 | Open in IMG/M |
| 3300031819|Ga0318568_10266604 | Not Available | 1061 | Open in IMG/M |
| 3300031832|Ga0318499_10141692 | Not Available | 937 | Open in IMG/M |
| 3300031879|Ga0306919_10039876 | Not Available | 3037 | Open in IMG/M |
| 3300031879|Ga0306919_10080436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2244 | Open in IMG/M |
| 3300031879|Ga0306919_10361988 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300031879|Ga0306919_11402122 | Not Available | 527 | Open in IMG/M |
| 3300031890|Ga0306925_10203715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2134 | Open in IMG/M |
| 3300031890|Ga0306925_10593621 | Not Available | 1170 | Open in IMG/M |
| 3300031890|Ga0306925_10772073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 1000 | Open in IMG/M |
| 3300031890|Ga0306925_11414495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300031893|Ga0318536_10340630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 759 | Open in IMG/M |
| 3300031897|Ga0318520_10649494 | Not Available | 657 | Open in IMG/M |
| 3300031897|Ga0318520_10738196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300031910|Ga0306923_10602112 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. CG24A | 1233 | Open in IMG/M |
| 3300031910|Ga0306923_10701869 | Not Available | 1126 | Open in IMG/M |
| 3300031910|Ga0306923_10735599 | Not Available | 1095 | Open in IMG/M |
| 3300031912|Ga0306921_10258624 | Not Available | 2039 | Open in IMG/M |
| 3300031912|Ga0306921_10317322 | Not Available | 1823 | Open in IMG/M |
| 3300031941|Ga0310912_10047969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2990 | Open in IMG/M |
| 3300031942|Ga0310916_11201508 | Not Available | 627 | Open in IMG/M |
| 3300031942|Ga0310916_11488433 | Not Available | 552 | Open in IMG/M |
| 3300031945|Ga0310913_10011340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 | 5341 | Open in IMG/M |
| 3300031945|Ga0310913_10206009 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300031947|Ga0310909_10020223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4784 | Open in IMG/M |
| 3300031954|Ga0306926_10134191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3061 | Open in IMG/M |
| 3300031954|Ga0306926_10331435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1882 | Open in IMG/M |
| 3300031954|Ga0306926_11869770 | Not Available | 679 | Open in IMG/M |
| 3300031954|Ga0306926_13004846 | Not Available | 503 | Open in IMG/M |
| 3300032001|Ga0306922_10409138 | Not Available | 1452 | Open in IMG/M |
| 3300032001|Ga0306922_12128228 | Not Available | 543 | Open in IMG/M |
| 3300032025|Ga0318507_10058039 | Not Available | 1539 | Open in IMG/M |
| 3300032025|Ga0318507_10283876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 719 | Open in IMG/M |
| 3300032035|Ga0310911_10004714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5830 | Open in IMG/M |
| 3300032041|Ga0318549_10550312 | Not Available | 518 | Open in IMG/M |
| 3300032044|Ga0318558_10303327 | Not Available | 789 | Open in IMG/M |
| 3300032052|Ga0318506_10208329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 863 | Open in IMG/M |
| 3300032059|Ga0318533_10022389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4011 | Open in IMG/M |
| 3300032063|Ga0318504_10031802 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300032064|Ga0318510_10132006 | Not Available | 974 | Open in IMG/M |
| 3300032065|Ga0318513_10503539 | Not Available | 593 | Open in IMG/M |
| 3300032066|Ga0318514_10733414 | Not Available | 525 | Open in IMG/M |
| 3300032076|Ga0306924_10967956 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300032076|Ga0306924_11043902 | Not Available | 894 | Open in IMG/M |
| 3300032076|Ga0306924_12485964 | Not Available | 520 | Open in IMG/M |
| 3300032261|Ga0306920_100157753 | Not Available | 3382 | Open in IMG/M |
| 3300032261|Ga0306920_103382673 | Not Available | 593 | Open in IMG/M |
| 3300032261|Ga0306920_104308150 | Not Available | 511 | Open in IMG/M |
| 3300032261|Ga0306920_104465477 | Not Available | 500 | Open in IMG/M |
| 3300033289|Ga0310914_11897338 | Not Available | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 29.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000716 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026804 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300026835 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 60 (SPAdes) | Environmental | Open in IMG/M |
| 3300026871 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 78 (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300026927 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 56 (SPAdes) | Environmental | Open in IMG/M |
| 3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100757772 | 3300000597 | Forest Soil | MHLVPVXIVAVGLYVLGMIVLALVAILGRVRGNRELKKLEPELR* |
| JGI12331J11884_1045882 | 3300000716 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRGNRELKKLEPEPRPGDY* |
| AF_2010_repII_A001DRAFT_100180773 | 3300000793 | Forest Soil | MHLVLVFTVAVCLYVLGMIVLALTAILGSVRRNRELKKPRLTV* |
| AF_2010_repII_A001DRAFT_100676721 | 3300000793 | Forest Soil | MHLVPVFIVAVGLYVLGMIVLALVAILGRVRRNRELKKLEPELR* |
| AF_2010_repII_A10DRAFT_10310412 | 3300000816 | Forest Soil | MHLVLVLTVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELRPGDY |
| Ga0066395_102026102 | 3300004633 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLALVAILGRVRGNKEMKKLEPELR* |
| Ga0066395_102106162 | 3300004633 | Tropical Forest Soil | MHLVLVLTVAAGLYVLGMIVLALAAILGSVRGKRELKKRRLTV* |
| Ga0066395_103560082 | 3300004633 | Tropical Forest Soil | VFIVAVGLYVLGMIVLALVAILGRVRGNRELKKLEPEPR* |
| Ga0066388_1003857355 | 3300005332 | Tropical Forest Soil | MHLVLVFTVAVGLYVVGMIVLALAAILGSVGGNRELKKLKPEPRPGNY* |
| Ga0066388_1004270542 | 3300005332 | Tropical Forest Soil | MGPFLLYVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGDY* |
| Ga0066388_1005935624 | 3300005332 | Tropical Forest Soil | MHLVLVLTVAAGLYVLGMIVLALVAILGSVRGKRELKKRRLTV* |
| Ga0066388_1007118283 | 3300005332 | Tropical Forest Soil | MHLFLVFIVAVGLYVLGMIVLALAAILGRVRRNRELKKLEPELR* |
| Ga0066388_1007164351 | 3300005332 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRGNRKLKKPRLTV* |
| Ga0066388_1011971553 | 3300005332 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRRNRELKKRRLTV* |
| Ga0066388_1014960601 | 3300005332 | Tropical Forest Soil | MHLVPVLIVAVGLYVLGMIVLALVAILGRVRGNRELKKRRLTV* |
| Ga0066388_1023900961 | 3300005332 | Tropical Forest Soil | MHLVLVLTVAVGLYVLGMIVLALAAILGGRRGRELKKTRLTV* |
| Ga0066388_1037411061 | 3300005332 | Tropical Forest Soil | MGPFLLYVFIVAVSLYVVGMIVLALAAILGSVRGKRELKKLEPVPRPRDY* |
| Ga0066388_1041869181 | 3300005332 | Tropical Forest Soil | MAFLLYVFIVAVSLYVVGMVVLALAAILGSVRGNRDLKKLEREPRPGDY* |
| Ga0066388_1042948221 | 3300005332 | Tropical Forest Soil | MHLVLVFTVAVGLYVVGMIVLALAAFLGSVRTNRELKKLKPKPLPGDY* |
| Ga0066388_1043787061 | 3300005332 | Tropical Forest Soil | MHLVPVLIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELR* |
| Ga0066388_1053554771 | 3300005332 | Tropical Forest Soil | MHLVLVLIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPDLR* |
| Ga0066388_1056593602 | 3300005332 | Tropical Forest Soil | MLLVLVFTVAVGLYVLGMIVLALVAILGSVRRNRELKKPRFTV* |
| Ga0066388_1061603512 | 3300005332 | Tropical Forest Soil | MHLVLVLIVAVGLYVLGMIVLAFTAILGRVRGNRELKKLEPELR* |
| Ga0066388_1064304542 | 3300005332 | Tropical Forest Soil | MHLVSVFIVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV* |
| Ga0066388_1066074542 | 3300005332 | Tropical Forest Soil | VLVFTVAVCLYVLGMIVLALTAILGSVRRNRELKKPRLTV* |
| Ga0066388_1081583592 | 3300005332 | Tropical Forest Soil | MHLFLVFTVAVGLYVLGMIALALAAFLGRVRGNREMKKLEPELG* |
| Ga0066388_1084004081 | 3300005332 | Tropical Forest Soil | MHLVLVFIVAVGLYVLGMIVLALVAILGRVRGNRELKKLE |
| Ga0066388_1084929261 | 3300005332 | Tropical Forest Soil | MAFLLYVFIVAVSLYVVGMIVLALAAILGSVRGRELKKPEREPRPGDY* |
| Ga0066388_1088202431 | 3300005332 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLAIVAILGRVRGNRELKKLEPELR* |
| Ga0066903_1001893274 | 3300005764 | Tropical Forest Soil | MHLVLVFTVAVGLYVIGMVVLTLAAILGRRRGNRELKKLEPELR* |
| Ga0066903_1002170751 | 3300005764 | Tropical Forest Soil | VAVGLYVIGMVVLALAAILGRRRGNREFKKLEPELR* |
| Ga0066903_1006291563 | 3300005764 | Tropical Forest Soil | MHLVLVLIVGIGLYVVGMIVLALAAILGRVRSNRELKKLELELR* |
| Ga0066903_1012365943 | 3300005764 | Tropical Forest Soil | MHLVLVFTVLVGLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGDY* |
| Ga0066903_1013455102 | 3300005764 | Tropical Forest Soil | MHLVFVFTVAVGLYVVGMIFLALAAILGSVRGDRKLQKLEPRPGDH* |
| Ga0066903_1017274143 | 3300005764 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIALALATLLGRARSNRELKKLEPELR* |
| Ga0066903_1018668454 | 3300005764 | Tropical Forest Soil | MHLVLVFTVAVGLYAIGMVVLALVAILGMVRGNRELKKFEPELR* |
| Ga0066903_1022708262 | 3300005764 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALVAILGSVRRNRELKKPRLTV* |
| Ga0066903_1022992544 | 3300005764 | Tropical Forest Soil | MHLVAVLTVAVGLYVLGMIVLALAAILGSVRGKRELKKRRLTV* |
| Ga0066903_1023497882 | 3300005764 | Tropical Forest Soil | MHLVLVFTVAVGLYVIGMVVLALAAILGRRRSNREFKKFEPELR* |
| Ga0066903_1023671203 | 3300005764 | Tropical Forest Soil | MHLVLVFTIAVGLYVLGMIVLALTAILGRVRGNRELKKLEPELR* |
| Ga0066903_1028474583 | 3300005764 | Tropical Forest Soil | KGGVLSKGSLPMHLVPVFIVAVGLYVLGMIVLALVAILGSVRRNRELKKLEPELR* |
| Ga0066903_1033191722 | 3300005764 | Tropical Forest Soil | MAFLLYVFIVAVSLYVVGMIVLALAAILGNVRGNRDLKKLEREPRPGDY* |
| Ga0066903_1041628393 | 3300005764 | Tropical Forest Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELR* |
| Ga0066903_1042569502 | 3300005764 | Tropical Forest Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV* |
| Ga0066903_1055679872 | 3300005764 | Tropical Forest Soil | MHLVLVFTVAVGLYVIGMVVLALAAILGRRRSNREFKK |
| Ga0066903_1055811992 | 3300005764 | Tropical Forest Soil | MHLVAVLTVAVGLYVLGMIVLALVAILGSVRGKRELKKRRLTV* |
| Ga0066903_1060866051 | 3300005764 | Tropical Forest Soil | LIVAVGLYVLGMIVLALVAILGRVRGNRELKKRRLTV* |
| Ga0066903_1077257142 | 3300005764 | Tropical Forest Soil | VPVFIVAVGLYVLGMIVLALVAILGRVRGNRELKKLEPELR* |
| Ga0066903_1081515702 | 3300005764 | Tropical Forest Soil | SVLSKASLPMHLVPVFIVAVGLYVLGMIVLALVAILGSVRRKRELKKRRLTV* |
| Ga0066903_1087778502 | 3300005764 | Tropical Forest Soil | MHLVPVLIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELRPGDY* |
| Ga0126374_102703582 | 3300009792 | Tropical Forest Soil | MHLVLVFIVAVGLYVLGMIVLALTAILGSVRRNRELKK |
| Ga0126374_115540762 | 3300009792 | Tropical Forest Soil | LRMALLLYVFIVAVSLYVVGMVVLALAAILGSVRGNRDLKKLVREPRPGDY* |
| Ga0126380_121943951 | 3300010043 | Tropical Forest Soil | MHLVLVFTVAVGLYVVGMIVLALAAILGSVRGNRELKKLKPEPRPGNY* |
| Ga0126384_110620602 | 3300010046 | Tropical Forest Soil | MHLVLVFIVAVGLYVLGMIVLALTAILGSVRRNRELKKPRLTV* |
| Ga0126382_117577412 | 3300010047 | Tropical Forest Soil | MHPVIVFTVAVGLYVVGMIVLALAAILGSVRGNRKLKKLEPRPGDY* |
| Ga0126373_100790634 | 3300010048 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLALVAILGSVRGKRELKKRRLTV* |
| Ga0126373_101896406 | 3300010048 | Tropical Forest Soil | MHLVLVFTVAVGLYVIGMVVLALAAILGRRRGNREFKKLEPELR* |
| Ga0126373_105152933 | 3300010048 | Tropical Forest Soil | VLSKASLPMHLVPVLIVAVGLYVLGMIVLALVAILGRVRGKRELKKRRLTV* |
| Ga0126373_105441603 | 3300010048 | Tropical Forest Soil | MAFLLYVFIVAVSLYVVGMIVLALAAILGSVRGDRKLKKVEPRPGD* |
| Ga0126373_120461211 | 3300010048 | Tropical Forest Soil | MAFLLYVFIVAVSLYVVGMIVLALAAILGNVRGNRDLKK |
| Ga0126370_100988204 | 3300010358 | Tropical Forest Soil | MLLVLVFTVAVGLYVLGMIVLALVAILGSVRGKRELKKRRLTV* |
| Ga0126376_114031532 | 3300010359 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAVLGGVRGNKELKKPRLTV* |
| Ga0126372_106614352 | 3300010360 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLALVAILGRVRGNRELKKLEPELR* |
| Ga0126372_123404931 | 3300010360 | Tropical Forest Soil | MHLFLVFIVAVGLYVLGMIVLALAAILGRVRGNRKLKKLEPELR* |
| Ga0126378_116729682 | 3300010361 | Tropical Forest Soil | MHLILVFTVAVGLYVLGMIVLALAAILGSVRGNRELKKLEPELRPGDY* |
| Ga0126378_118027201 | 3300010361 | Tropical Forest Soil | MHLVFVFIVAVGLDVLEMIVLAQASILGTVRRNRELKKPRLTV* |
| Ga0126378_121030191 | 3300010361 | Tropical Forest Soil | VPVFIVAVGLYVLGMIVLALVAILGRVRGNKEMKKLEPELR* |
| Ga0126377_105174483 | 3300010362 | Tropical Forest Soil | VLVFIVAVGLYVVGMIVLALAAILGRVRGNRELKKLEPEPRPGDY* |
| Ga0126377_112413362 | 3300010362 | Tropical Forest Soil | MAFLLYVFIVAVSLYVVGMIVLALAAILGSVRGNGDLKKLEREPRPGDY* |
| Ga0126381_1000978734 | 3300010376 | Tropical Forest Soil | MGDVMHLVLVFTVAVGLYVVGMIVLALAAISGRVRGNRELKKLEPELR* |
| Ga0126381_1002499091 | 3300010376 | Tropical Forest Soil | MHLVFVFIVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV* |
| Ga0126381_1003383573 | 3300010376 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAISGRVRGNRELKRLEPELH* |
| Ga0126381_1003800904 | 3300010376 | Tropical Forest Soil | TLRMHLVLVFTVAVGLYVVGMIVLALAAFLGSVRTNRELKKLKPKPLPGDY* |
| Ga0126381_1004227113 | 3300010376 | Tropical Forest Soil | MALLLYVFIVAVSLYVVGMIVLALAAILGSVRGNRELKNSNRSRIRATT |
| Ga0126381_1010866352 | 3300010376 | Tropical Forest Soil | MGDVMHLVLVFTVAVGLYVLGMIALALAAISGRVRGNRELKKSRLTV* |
| Ga0126381_1011100471 | 3300010376 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELR* |
| Ga0126381_1024465932 | 3300010376 | Tropical Forest Soil | MHLVLVLTVAVGLYVLGMIVLALVAILGRVRGNRELKKLEPELR* |
| Ga0126381_1043981271 | 3300010376 | Tropical Forest Soil | PMHLVLVFTVAVGLYVIGMVVLALAAILGRRRGNREFKKLEPELR* |
| Ga0126383_136516222 | 3300010398 | Tropical Forest Soil | MHLVLVFIVAVGLYVVGMIVLALAAILGSVRGNGKLKKLEPEPRPGDY* |
| Ga0124850_100046813 | 3300010863 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMVVLALVAILGRVRGNKELKKLEPELR* |
| Ga0124850_10193834 | 3300010863 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLAIVAILGRVRGNKEMKKLEPELR* |
| Ga0126369_107193141 | 3300012971 | Tropical Forest Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLE |
| Ga0126369_111694991 | 3300012971 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLALAAILGRVRGNRKLKKLEPELR* |
| Ga0126369_124702171 | 3300012971 | Tropical Forest Soil | MGPFLLYVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGD |
| Ga0182036_101265041 | 3300016270 | Soil | IVAVSLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGD |
| Ga0182041_100151253 | 3300016294 | Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEP |
| Ga0182041_101685243 | 3300016294 | Soil | MHLVPVLTVAVGLYVLGMIVLALAAILGRARGNRELKKFEPEPR |
| Ga0182041_113303022 | 3300016294 | Soil | MAFLLYVFIVAVSLYVVGMIVLALVAILGSVRGNRELKKLEREPRPGDY |
| Ga0182033_110806242 | 3300016319 | Soil | LVFIVAVGLYVLGMIVLALVVILGRVRGNRELKKLEPELR |
| Ga0182033_115421922 | 3300016319 | Soil | MHLVSVFIVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLT |
| Ga0182033_118877102 | 3300016319 | Soil | MYLVLVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGD |
| Ga0182035_102805071 | 3300016341 | Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRRNRE |
| Ga0182035_112255021 | 3300016341 | Soil | MHLVAVLTVAVGLYVLGMIVLALVAILGSVRGKRELKKPRLTV |
| Ga0182034_104871141 | 3300016371 | Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGRVRGNRELKKLELELR |
| Ga0182034_110009082 | 3300016371 | Soil | MYLVLVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKL |
| Ga0182034_111395592 | 3300016371 | Soil | MHLVLVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKL |
| Ga0182034_120507091 | 3300016371 | Soil | TVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0182040_100323157 | 3300016387 | Soil | MHLVTVLAVAVGLYVLGMIVLALAAILGSVRRNRELKKPRL |
| Ga0182040_107055341 | 3300016387 | Soil | REGSVLSKGSLPMHLVTVLAVAVCLYVLGMIVLALTAILGSVRRNRKLKKTRLTV |
| Ga0182037_107212771 | 3300016404 | Soil | MHLVPVLTVAVGLYVLGMIVLALAAILGRARGNRELKKFE |
| Ga0182039_115103072 | 3300016422 | Soil | MHLVLVLTVAAGLYVLGMIVLALAAILGSVRGKRELK |
| Ga0182039_118721151 | 3300016422 | Soil | TLRMHLVLVFTVAVCLYVLGMIVLALTAILGSVRRNKELKKPRLTV |
| Ga0182039_122269911 | 3300016422 | Soil | VAAGLYVLGMMVLALAAILGSTRGKRELKKRRLTV |
| Ga0182038_104390513 | 3300016445 | Soil | KGSLPMHLVFVFIVAVGLYVLGMIVLALAVILGSVRRNRELKKPRLTV |
| Ga0182038_106255503 | 3300016445 | Soil | TVLAVAVCLYVLGMIVLALTAILGSVRRNRELKKTRLTV |
| Ga0187779_100527581 | 3300017959 | Tropical Peatland | RMHLVLVFTVAVGLYVLGMIVLALAAILGSVRGKRELKKSRLTV |
| Ga0187778_105790442 | 3300017961 | Tropical Peatland | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRGKRELKKSRLTV |
| Ga0187780_107650352 | 3300017973 | Tropical Peatland | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRGKRELKKRRLTV |
| Ga0187766_110858451 | 3300018058 | Tropical Peatland | MHLVLVFSVAVGLYVIGMVVLALAAILGKRRGNRELKPRPGDYSAV |
| Ga0187765_100370104 | 3300018060 | Tropical Peatland | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRGNKLKKPRLRV |
| Ga0126371_1000919911 | 3300021560 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAISGRVRGNRELKRLEPELH |
| Ga0126371_100336772 | 3300021560 | Tropical Forest Soil | MHLVLVFTVAVGLYVIGMVVLALAAILGRRRGNRELKKLEPELR |
| Ga0126371_102723571 | 3300021560 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLALVAILGSVRGKRELKKRRLTV |
| Ga0126371_112345043 | 3300021560 | Tropical Forest Soil | MHLVLVFTVAVGLYAIGMVVLALVAILGMVRGNRELKKFEPELR |
| Ga0126371_120135611 | 3300021560 | Tropical Forest Soil | VPVFIVAVGLYVLGMIVLAIVAILGRVRGNRELKKLEPELR |
| Ga0126371_122432061 | 3300021560 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAISGRVRGNRELKKLEPEL |
| Ga0126371_129990031 | 3300021560 | Tropical Forest Soil | SVLSKGSLPMHLVLVFTVAVGLYVIGMVVLALAAILGRRRGNREFKKLEPELR |
| Ga0126371_131509461 | 3300021560 | Tropical Forest Soil | MHLVLVFIVAVGLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0209473_12699952 | 3300026330 | Soil | MAFLLYVFIVAVSLYVVGMIVLALAAILGSVRGDRKLIKREPRPGDY |
| Ga0207737_1066302 | 3300026804 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRGNRELKKLEPEPRPGDY |
| Ga0207759_1146061 | 3300026823 | Tropical Forest Soil | TVAVGLYVLGMIVLALAAILGSVRDNRELKKARLTV |
| Ga0207782_1008822 | 3300026835 | Tropical Forest Soil | MHLVVVFTVAVGLYVLGMIVLALAAILGSVRGNRELKKLEPEPRPGDY |
| Ga0207825_1037521 | 3300026871 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRRNRELKKLEPEPRPGDY |
| Ga0207787_10023064 | 3300026908 | Tropical Forest Soil | MHLVSVFTVAVGLYVLGMIVLALAAILGSVRGNRELKKLEPEPRPGDYQ |
| Ga0207744_10067562 | 3300026927 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRRNRELKKP |
| Ga0207744_10122103 | 3300026927 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRGNRELKKLEPEPRPGD |
| Ga0207743_10160831 | 3300026945 | Tropical Forest Soil | MHLVSVFTVAVGLYVLGMIVLALAAILGSVRGNRELKKARLTV |
| Ga0207815_10237631 | 3300027014 | Tropical Forest Soil | HLVLVFTVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0207761_10711642 | 3300027516 | Tropical Forest Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGTVRGNREL |
| Ga0207862_12602872 | 3300027703 | Tropical Forest Soil | LRMHLVSVFTVAVGLYVLGMIVLALAAILGSVRDNRELKKARLTV |
| Ga0209465_100388491 | 3300027874 | Tropical Forest Soil | VFIVAVGLYVLGMIVLALVAILGRVRGNRELKKLEPEPR |
| Ga0209465_101982742 | 3300027874 | Tropical Forest Soil | MHLVPVFIVAVGLYVLGMIVLALVAILGRVRGNKEMKKLEPELR |
| Ga0318516_102339392 | 3300031543 | Soil | VLAVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0318541_100012754 | 3300031545 | Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0318541_101504062 | 3300031545 | Soil | MHLVLVFTVAVGLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGDY |
| Ga0318541_104545332 | 3300031545 | Soil | LPMHLVLVFIVAVGLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0318538_106600612 | 3300031546 | Soil | MAFLLYVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGD |
| Ga0310915_100023797 | 3300031573 | Soil | MHLVTVLAVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0318555_101823331 | 3300031640 | Soil | HLVLVFIVAVGLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0318574_104847121 | 3300031680 | Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRRNREL |
| Ga0318560_100997222 | 3300031682 | Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKK |
| Ga0318496_104659952 | 3300031713 | Soil | MHLVTVLAVAVCLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0318496_107846051 | 3300031713 | Soil | MHLVLVFTVAVGLYVLGMIVLALVAILGSVRGNRELKKPRLTV |
| Ga0306917_100248577 | 3300031719 | Soil | VFTVAVCLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0306917_103304291 | 3300031719 | Soil | MHLVTVLAVAVCLYVLGMIVLALTAILGSVRRNSH |
| Ga0306917_103685871 | 3300031719 | Soil | LVTVLAVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0306917_108378041 | 3300031719 | Soil | MYLVLVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKLEPEP |
| Ga0318500_106055201 | 3300031724 | Soil | LPMHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0318501_106828861 | 3300031736 | Soil | MHLVLVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKLEP |
| Ga0306918_109735532 | 3300031744 | Soil | MHLVLVFTVAVCLYVLGMIVLALTAILGSVRRNRELKKPAHSLASPP |
| Ga0318546_100037211 | 3300031771 | Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELK |
| Ga0318547_105206113 | 3300031781 | Soil | VLVFTVAVGLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGDY |
| Ga0318548_100621831 | 3300031793 | Soil | VTILAVAVCLYVLGMFVLALAAILGSVRRNRKLKKTCLTV |
| Ga0318548_102721482 | 3300031793 | Soil | VFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0318550_100032179 | 3300031797 | Soil | MHLVLVFTVAVCLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0318550_102069661 | 3300031797 | Soil | LVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0318550_102635341 | 3300031797 | Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPSRSMSAEP |
| Ga0318568_102666041 | 3300031819 | Soil | FTVAVCLYVLGMIVLALTAILGSVRRNRELKKPAHSLASPPRLTAAQ |
| Ga0318499_101416921 | 3300031832 | Soil | MHLVLVFTVAVCLYVLGMIVLALTAILGSVRRNRELKKPAHS |
| Ga0306919_100398765 | 3300031879 | Soil | MHLVPVFIIDVGLYVLGMIVLALIAILGSVRRNRELKKPRLTV |
| Ga0306919_100804361 | 3300031879 | Soil | TLRMHLVLVFTVAVCLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0306919_103619881 | 3300031879 | Soil | MHLVFVFIVAVGLYVLGMIVLALAVILGSVRRNRELKKPRLTV |
| Ga0306919_114021221 | 3300031879 | Soil | MSFLLYVFIVAVSLYVVGMIVLALVAILGSVRGNRELKKLEREPRPGDY |
| Ga0306925_102037153 | 3300031890 | Soil | MHLVPVLIVAVGLYVLGMIVLALAAILGRVRANRELKKLEPELR |
| Ga0306925_105936211 | 3300031890 | Soil | MHLVLVFTVAVGLYVVGMIVLALAAILGSVRGNRELKKREPEPRPGDH |
| Ga0306925_107720731 | 3300031890 | Soil | MHLVLVLTVAAGLYVLGMIVLALAAILGSVRGKRELKKRRLTV |
| Ga0306925_114144951 | 3300031890 | Soil | VFTVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0318536_103406301 | 3300031893 | Soil | PMHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0318520_106494942 | 3300031897 | Soil | HLVPVFIIAVGLYVLGMIVLALIAILGSVRRNRELKKPRLTV |
| Ga0318520_107381961 | 3300031897 | Soil | MYLVLVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGDY |
| Ga0306923_106021123 | 3300031910 | Soil | MHLVTVLAVAVCLYVLGMIVLALTAILGSVRRNRELKKTRLTV |
| Ga0306923_107018694 | 3300031910 | Soil | FTVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0306923_107355992 | 3300031910 | Soil | VFTVAVGLYVVGMIVLALAAILGSVRGNRELKKREPEPRPGDY |
| Ga0306921_102586241 | 3300031912 | Soil | GSLPMHLVPVFIVAVCLYVLGMIVLALIAILGSVRRNRKLKKIRLTV |
| Ga0306921_103173222 | 3300031912 | Soil | MHLVPVFIIAVGLYVLGMIVLALIAILGSVRRNRELKKPRLTV |
| Ga0310912_100479695 | 3300031941 | Soil | MHLVTILAVAACLYVLGMIVLALAAILGSVRRNRKLKKPRLTV |
| Ga0310916_112015081 | 3300031942 | Soil | MHLVLVFTVAVGLYVVGMIVLALAAILGSVRGNRELKKREPEPRPGDY |
| Ga0310916_114884331 | 3300031942 | Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRRNRELKKPGLPV |
| Ga0310913_100113402 | 3300031945 | Soil | MHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPDLR |
| Ga0310913_102060091 | 3300031945 | Soil | LVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0310909_100202231 | 3300031947 | Soil | TVLAVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0306926_101341914 | 3300031954 | Soil | MHLVLVLTVAAGLYVLGMMVLALAAILGSVRGKRELKKRRLTV |
| Ga0306926_103314351 | 3300031954 | Soil | MHLVFVFIVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0306926_118697701 | 3300031954 | Soil | LVFTVAVGLYVVGMIVLALAAILGSVRGNRELKKREPEPRPGDY |
| Ga0306926_130048461 | 3300031954 | Soil | LVLVFIVAVGLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0306922_104091381 | 3300032001 | Soil | MHLVTVLAVAVCLYVLAMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0306922_121282282 | 3300032001 | Soil | LSKASLPMHLVPVLIVAVGLYVLGMIVLALVAILGSVRGKRELKKRRLTV |
| Ga0318507_100580393 | 3300032025 | Soil | GGSVLSKGSLPMHLVLVFIVAVGLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0318507_102838761 | 3300032025 | Soil | GSLPMHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0310911_100047141 | 3300032035 | Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0318549_105503121 | 3300032041 | Soil | VPVLTVAVGLYVLGMIVLALAAILGRARGNRELKKFEPEPR |
| Ga0318558_103033272 | 3300032044 | Soil | MHLVLVFTVAVCLYVLGMIVLALTAILGSVRRNRE |
| Ga0318506_102083292 | 3300032052 | Soil | GSVLSKGSLPMHLVLVFIVAVGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0318533_100223896 | 3300032059 | Soil | VLTVAVGLYVLGMIVLALAAILGSVRRNRELKKPRLTV |
| Ga0318504_100318024 | 3300032063 | Soil | VGLYVLGMIVLALAAILGRVRGNRELKKLEPELTEPNRVV |
| Ga0318510_101320061 | 3300032064 | Soil | VAVCLYVLGMIVLALTAILGSVRRNRELKKPAHSLASPPRLTAAQ |
| Ga0318513_105035393 | 3300032065 | Soil | RMHLVLVFTVAVGLYVLGMIVLALAAILGSVRRNRELKKSRLTV |
| Ga0318514_107334141 | 3300032066 | Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGSVRRYRELKKPRLTV |
| Ga0306924_109679561 | 3300032076 | Soil | MHLVFVFIVAVGLYVLGMIVLALAVILGSVRRNRELKK |
| Ga0306924_110439022 | 3300032076 | Soil | VLVFIVAVGLYVLGMIVLALTAILGSVRRNRELKKPRLTV |
| Ga0306924_124859641 | 3300032076 | Soil | LYVVGMIVLALAAILGSVRGNRELKKREPEPRPGDH |
| Ga0306920_1001577531 | 3300032261 | Soil | MHLVPVFIVAVCLYVLGMIVLALIAILGSVRRNRKLKKIRLTV |
| Ga0306920_1033826731 | 3300032261 | Soil | MHLFLVFIVAVGLYVLGMIVLALVAILGRVRGNRELKKLEPDLR |
| Ga0306920_1043081501 | 3300032261 | Soil | MHLVLVFTVAVGLYVLGMIVLALAAILGTVRGNRELKKPRPAAQ |
| Ga0306920_1044654771 | 3300032261 | Soil | MHLVLVFIVAVSLYVVGMIVLALAAILGSVRGNRELKKLEPEPRPGD |
| Ga0310914_118973382 | 3300033289 | Soil | MHLVLVFTVAVCLYVLGMIVLALTAILGSVRRNRELKK |
| ⦗Top⦘ |