| Basic Information | |
|---|---|
| Family ID | F024226 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 207 |
| Average Sequence Length | 46 residues |
| Representative Sequence | EYLERFDAEWQAVFAINIAKTPSKQSIAFSCKAFAEWVAKNQDLL |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 207 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.49 % |
| % of genes near scaffold ends (potentially truncated) | 95.65 % |
| % of genes from short scaffolds (< 2000 bps) | 86.96 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (42.029 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.435 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.599 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.531 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.84% β-sheet: 0.00% Coil/Unstructured: 56.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 207 Family Scaffolds |
|---|---|---|
| PF13203 | DUF2201_N | 61.35 |
| PF01870 | Hjc | 0.48 |
| PF01612 | DNA_pol_A_exo1 | 0.48 |
| PF11753 | DUF3310 | 0.48 |
| PF01435 | Peptidase_M48 | 0.48 |
| PF04545 | Sigma70_r4 | 0.48 |
| PF13412 | HTH_24 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 207 Family Scaffolds |
|---|---|---|---|
| COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.71 % |
| Unclassified | root | N/A | 20.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000203|TB18AUG2009E_c002179 | All Organisms → Viruses → Predicted Viral | 3206 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1008479 | All Organisms → Viruses → Predicted Viral | 2259 | Open in IMG/M |
| 3300001419|JGI11705J14877_10008556 | All Organisms → Viruses → Predicted Viral | 4610 | Open in IMG/M |
| 3300001580|Draft_10357507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300001842|RCM30_1027116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300002091|JGI24028J26656_1004698 | All Organisms → Viruses → Predicted Viral | 2110 | Open in IMG/M |
| 3300002161|JGI24766J26685_10112926 | Not Available | 575 | Open in IMG/M |
| 3300002206|metazooDRAFT_1325546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300002519|JGI25130J35507_1017607 | All Organisms → Viruses → Predicted Viral | 1691 | Open in IMG/M |
| 3300003394|JGI25907J50239_1014690 | All Organisms → Viruses → Predicted Viral | 1799 | Open in IMG/M |
| 3300003797|Ga0007846_1025060 | Not Available | 502 | Open in IMG/M |
| 3300004095|Ga0007829_10045003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300004693|Ga0065167_1049549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300004805|Ga0007792_10091829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
| 3300004807|Ga0007809_10021003 | All Organisms → Viruses → Predicted Viral | 2290 | Open in IMG/M |
| 3300005525|Ga0068877_10475038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300005582|Ga0049080_10133070 | Not Available | 837 | Open in IMG/M |
| 3300006072|Ga0007881_1124256 | Not Available | 637 | Open in IMG/M |
| 3300006110|Ga0007871_1023264 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300006119|Ga0007866_1038769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300006802|Ga0070749_10132213 | All Organisms → Viruses → Predicted Viral | 1461 | Open in IMG/M |
| 3300006920|Ga0070748_1112449 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300007516|Ga0105050_10276188 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300008108|Ga0114341_10463159 | Not Available | 586 | Open in IMG/M |
| 3300008110|Ga0114343_1045950 | All Organisms → Viruses → Predicted Viral | 1714 | Open in IMG/M |
| 3300008262|Ga0114337_1221302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300009068|Ga0114973_10178497 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300009081|Ga0105098_10402822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300009081|Ga0105098_10599637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300009085|Ga0105103_10457994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300009155|Ga0114968_10755410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300009158|Ga0114977_10348036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300009159|Ga0114978_10012822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6395 | Open in IMG/M |
| 3300009159|Ga0114978_10672955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300009160|Ga0114981_10044813 | All Organisms → Viruses → Predicted Viral | 2493 | Open in IMG/M |
| 3300009160|Ga0114981_10746327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300009163|Ga0114970_10487905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300009164|Ga0114975_10357839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300009182|Ga0114959_10298980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300009182|Ga0114959_10336199 | Not Available | 747 | Open in IMG/M |
| 3300009184|Ga0114976_10184421 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
| 3300009187|Ga0114972_10560068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300009502|Ga0114951_10098536 | All Organisms → Viruses → Predicted Viral | 1667 | Open in IMG/M |
| 3300009502|Ga0114951_10122450 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
| 3300010160|Ga0114967_10079475 | All Organisms → Viruses → Predicted Viral | 1957 | Open in IMG/M |
| 3300010334|Ga0136644_10230503 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300010885|Ga0133913_11819041 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300010885|Ga0133913_12701517 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300011010|Ga0139557_1047357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300011261|Ga0151661_1302798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300013005|Ga0164292_10540001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10813951 | Not Available | 545 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10538502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300013286|Ga0136641_1106866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300013372|Ga0177922_10354862 | All Organisms → Viruses → Predicted Viral | 2085 | Open in IMG/M |
| 3300013372|Ga0177922_10385337 | All Organisms → Viruses → Predicted Viral | 1376 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10357358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300015050|Ga0181338_1014748 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300015050|Ga0181338_1021365 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300015050|Ga0181338_1026019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300015050|Ga0181338_1035638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176 | 750 | Open in IMG/M |
| 3300017716|Ga0181350_1038604 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300017716|Ga0181350_1040456 | All Organisms → Viruses → Predicted Viral | 1261 | Open in IMG/M |
| 3300017716|Ga0181350_1079731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300017716|Ga0181350_1122586 | Not Available | 623 | Open in IMG/M |
| 3300017723|Ga0181362_1045099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300017723|Ga0181362_1108638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300017736|Ga0181365_1066380 | Not Available | 892 | Open in IMG/M |
| 3300017747|Ga0181352_1077552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
| 3300017747|Ga0181352_1092783 | Not Available | 834 | Open in IMG/M |
| 3300017747|Ga0181352_1124955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300017747|Ga0181352_1178420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium mediterraneum | 552 | Open in IMG/M |
| 3300017747|Ga0181352_1190128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300017747|Ga0181352_1207614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300017754|Ga0181344_1021064 | All Organisms → Viruses → Predicted Viral | 2024 | Open in IMG/M |
| 3300017754|Ga0181344_1040318 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
| 3300017754|Ga0181344_1112562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300017754|Ga0181344_1118392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300017754|Ga0181344_1141514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300017754|Ga0181344_1178833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300017761|Ga0181356_1251770 | Not Available | 503 | Open in IMG/M |
| 3300017766|Ga0181343_1067639 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300017766|Ga0181343_1197535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300017774|Ga0181358_1002558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8102 | Open in IMG/M |
| 3300017774|Ga0181358_1253917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300017774|Ga0181358_1268070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300017777|Ga0181357_1051398 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300017777|Ga0181357_1301437 | Not Available | 544 | Open in IMG/M |
| 3300017778|Ga0181349_1103227 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300017778|Ga0181349_1215569 | Not Available | 657 | Open in IMG/M |
| 3300017780|Ga0181346_1088998 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
| 3300017780|Ga0181346_1217487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300017784|Ga0181348_1078423 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300017784|Ga0181348_1154861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300017784|Ga0181348_1168720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300017785|Ga0181355_1083663 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300017785|Ga0181355_1155462 | Not Available | 921 | Open in IMG/M |
| 3300017785|Ga0181355_1217219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300017785|Ga0181355_1263584 | Not Available | 657 | Open in IMG/M |
| 3300017785|Ga0181355_1302894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300019122|Ga0188839_1012362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
| 3300019784|Ga0181359_1260070 | Not Available | 521 | Open in IMG/M |
| 3300020048|Ga0207193_1196617 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300020048|Ga0207193_1456825 | Not Available | 848 | Open in IMG/M |
| 3300020084|Ga0194110_10026871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5681 | Open in IMG/M |
| 3300020506|Ga0208091_1007508 | All Organisms → Viruses → Predicted Viral | 1411 | Open in IMG/M |
| 3300021092|Ga0194122_10014040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6161 | Open in IMG/M |
| 3300021137|Ga0214165_1038052 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300021138|Ga0214164_1062809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Cronobacter phage vB_CsaP_Ss1 | 772 | Open in IMG/M |
| 3300021139|Ga0214166_1032619 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300021424|Ga0194117_10075523 | All Organisms → Viruses → Predicted Viral | 1857 | Open in IMG/M |
| 3300021962|Ga0222713_10219228 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
| 3300021962|Ga0222713_10749623 | Not Available | 551 | Open in IMG/M |
| 3300021963|Ga0222712_10235737 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
| 3300021963|Ga0222712_10834166 | Not Available | 505 | Open in IMG/M |
| 3300022179|Ga0181353_1114828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300022179|Ga0181353_1155873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300022179|Ga0181353_1155955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus → Synechococcus virus AC2014fSyn7803C8 | 523 | Open in IMG/M |
| 3300022190|Ga0181354_1180730 | Not Available | 641 | Open in IMG/M |
| 3300022200|Ga0196901_1211959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300022407|Ga0181351_1045024 | All Organisms → Viruses → Predicted Viral | 1854 | Open in IMG/M |
| 3300023179|Ga0214923_10213133 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
| 3300023184|Ga0214919_10192902 | All Organisms → Viruses → Predicted Viral | 1542 | Open in IMG/M |
| 3300023311|Ga0256681_11372733 | All Organisms → Viruses → Predicted Viral | 2694 | Open in IMG/M |
| 3300024433|Ga0209986_10302330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300025339|Ga0208502_1015887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300025366|Ga0208505_1026961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300025382|Ga0208256_1055317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300025391|Ga0208740_1046247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300025403|Ga0208745_1006906 | All Organisms → Viruses → Predicted Viral | 2006 | Open in IMG/M |
| 3300025430|Ga0208622_1086452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300025598|Ga0208379_1014329 | All Organisms → Viruses → Predicted Viral | 2325 | Open in IMG/M |
| 3300025838|Ga0208872_1028260 | All Organisms → Viruses → Predicted Viral | 2516 | Open in IMG/M |
| 3300027079|Ga0255188_1091266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176 | 524 | Open in IMG/M |
| 3300027145|Ga0255114_1057918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300027594|Ga0255120_1062657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300027598|Ga0255121_1095992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300027608|Ga0208974_1074168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300027627|Ga0208942_1152202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300027659|Ga0208975_1068658 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300027710|Ga0209599_10225279 | Not Available | 510 | Open in IMG/M |
| 3300027734|Ga0209087_1159179 | Not Available | 900 | Open in IMG/M |
| 3300027736|Ga0209190_1375346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300027749|Ga0209084_1220231 | Not Available | 753 | Open in IMG/M |
| 3300027756|Ga0209444_10086999 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300027759|Ga0209296_1055448 | All Organisms → Viruses → Predicted Viral | 2046 | Open in IMG/M |
| 3300027759|Ga0209296_1065629 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300027764|Ga0209134_10175595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300027785|Ga0209246_10164399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176 | 871 | Open in IMG/M |
| 3300027798|Ga0209353_10255769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300027798|Ga0209353_10277287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300027798|Ga0209353_10302014 | Not Available | 678 | Open in IMG/M |
| 3300027798|Ga0209353_10413444 | Not Available | 551 | Open in IMG/M |
| 3300027806|Ga0209985_10308134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300027808|Ga0209354_10278224 | Not Available | 668 | Open in IMG/M |
| 3300027892|Ga0209550_10606915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300027896|Ga0209777_10412865 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300027896|Ga0209777_10869105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300027896|Ga0209777_10890910 | Not Available | 617 | Open in IMG/M |
| 3300027901|Ga0209427_10745108 | Not Available | 700 | Open in IMG/M |
| 3300027963|Ga0209400_1079902 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300027969|Ga0209191_1185588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300027974|Ga0209299_1280634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300027976|Ga0209702_10412760 | Not Available | 531 | Open in IMG/M |
| 3300027983|Ga0209284_10402395 | Not Available | 674 | Open in IMG/M |
| 3300028298|Ga0268280_1198890 | Not Available | 510 | Open in IMG/M |
| 3300028393|Ga0304728_1274126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300028394|Ga0304730_1046823 | All Organisms → Viruses → Predicted Viral | 2120 | Open in IMG/M |
| 3300031539|Ga0307380_10697151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300031746|Ga0315293_11048042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300031758|Ga0315907_11167383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300031857|Ga0315909_10169640 | All Organisms → Viruses → Predicted Viral | 1769 | Open in IMG/M |
| 3300031857|Ga0315909_10454931 | Not Available | 898 | Open in IMG/M |
| 3300031857|Ga0315909_10629751 | Not Available | 710 | Open in IMG/M |
| 3300031857|Ga0315909_10941353 | Not Available | 528 | Open in IMG/M |
| 3300031857|Ga0315909_10984280 | Not Available | 511 | Open in IMG/M |
| 3300031885|Ga0315285_10408168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300031951|Ga0315904_10187795 | All Organisms → Viruses → Predicted Viral | 2043 | Open in IMG/M |
| 3300031951|Ga0315904_10475956 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300031951|Ga0315904_10560725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300031952|Ga0315294_10102174 | All Organisms → Viruses → Predicted Viral | 2965 | Open in IMG/M |
| 3300031963|Ga0315901_10551132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
| 3300032053|Ga0315284_10431483 | All Organisms → Viruses → Predicted Viral | 1617 | Open in IMG/M |
| 3300032053|Ga0315284_10498279 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300032092|Ga0315905_11276730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300032093|Ga0315902_10300454 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
| 3300032093|Ga0315902_10750267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300032116|Ga0315903_10082802 | All Organisms → Viruses → Predicted Viral | 3123 | Open in IMG/M |
| 3300032116|Ga0315903_10364499 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300032173|Ga0315268_10064302 | All Organisms → Viruses → Predicted Viral | 3462 | Open in IMG/M |
| 3300032605|Ga0316232_1310360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300032753|Ga0316224_1028706 | All Organisms → Viruses → Predicted Viral | 2588 | Open in IMG/M |
| 3300033993|Ga0334994_0509242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300033993|Ga0334994_0585940 | Not Available | 503 | Open in IMG/M |
| 3300034101|Ga0335027_0409233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300034103|Ga0335030_0608945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300034104|Ga0335031_0146888 | All Organisms → Viruses → Predicted Viral | 1633 | Open in IMG/M |
| 3300034104|Ga0335031_0346266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300034105|Ga0335035_0360265 | Not Available | 838 | Open in IMG/M |
| 3300034109|Ga0335051_0335122 | Not Available | 727 | Open in IMG/M |
| 3300034118|Ga0335053_0148991 | All Organisms → Viruses → Predicted Viral | 1580 | Open in IMG/M |
| 3300034118|Ga0335053_0495219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300034280|Ga0334997_0309639 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 30.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 7.25% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.93% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.93% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.45% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.45% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.45% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.45% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.97% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.48% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.48% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.48% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.48% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.48% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.48% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.48% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.48% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.48% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.48% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300002519 | Marine viral communities from the Pacific Ocean - ETNP_2_300 | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006110 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025339 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025366 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025403 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027079 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027598 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB18AUG2009E_0021797 | 3300000203 | Freshwater | ISPFMTYLERFEPEWQACFAINIAKSPSKQSIAFSSAKFADWVQKNEDLL* |
| LV_Brine_h2_0102DRAFT_10084791 | 3300000405 | Hypersaline | LGRFDMEWQAAFAINVAKNPTKQSVAFSSSAFAQWVEKNEDLL* |
| JGI11705J14877_1000855610 | 3300001419 | Saline Water And Sediment | WQAAFCINLAKKAKKQSLAFSSKAFADWVTENEDLL* |
| Draft_103575072 | 3300001580 | Hydrocarbon Resource Environments | EWQAVFCINIAKSNKQAVAFSSKKFSEWVTKNQDLL* |
| RCM30_10271161 | 3300001842 | Marine Plankton | MEYLERFDPEWQATFAIQLAKTQSKQAIAFSNPAFAKWVAKNQDLL* |
| JGI24028J26656_10046987 | 3300002091 | Lentic | GRMEAEWQAAFVINTAKSETKQQIAFTCKAFSDWVAKNMDII* |
| JGI24766J26685_101129261 | 3300002161 | Freshwater And Sediment | GRLPHEWQAAFAINLAKNPQRQAIAFRSAAFAAWVSKNEDLL* |
| metazooDRAFT_13255461 | 3300002206 | Lake | ITPFMEYLERFDAEWQAVFAINIAKTQSKQAIAFSCKAFADWVAKNQDLL* |
| JGI25130J35507_10176071 | 3300002519 | Marine | MTPFMNYLDRFDAEWQAAFAINVAKNPNKNSIAFGSKAFADWVQKNEDLL* |
| JGI25907J50239_10146904 | 3300003394 | Freshwater Lake | ERLEHEWQSVFAINIAKNTAKQPIAFSCKAFADWVAKNQDLL* |
| Ga0007846_10250601 | 3300003797 | Freshwater | ETITPFMQYLERFDAEWQAVFAINIAKTPSKQAIAFSCKEFSAWVAKNQDLL* |
| Ga0007829_100450031 | 3300004095 | Freshwater | ETITPFMEYLSRFDAEWQAVFAINIAKTPSKQGIAFSCKAFSDWVAKNQDLL* |
| Ga0065167_10495491 | 3300004693 | Freshwater | STISPFMDYIERFGAEWQACFAINIAKTPSKQQIAFSSKKFADWVQKNEDLL* |
| Ga0007792_100918293 | 3300004805 | Freshwater | RFESEWQACFAINVAKAPTKQAIAFGSRKFTEWVAKNEDLL* |
| Ga0007809_100210031 | 3300004807 | Freshwater | FESEWQACFAINIAKSTSKQSIAFSSKKFSEWVAKNEDLL* |
| Ga0068877_104750381 | 3300005525 | Freshwater Lake | EWQAVFAINIAKSRVKQQVAFSCKAFSDWVAKNEDLL* |
| Ga0049080_101330701 | 3300005582 | Freshwater Lentic | FMDYLSRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL* |
| Ga0007881_11242563 | 3300006072 | Freshwater | FSPEWQAVFAINIAKSGTKQSIAFNCRAFSDWVAKNQDLL* |
| Ga0007871_10232641 | 3300006110 | Freshwater | FDAEWQAVFAINIAKTPSKQAIAFSCKAFSDWVAKNQDLL* |
| Ga0007866_10387691 | 3300006119 | Freshwater | EYLQRFDAEWQAVFAINIAKTPSKQAIAFSCKAFSDWVAKNQDLL* |
| Ga0070749_101322131 | 3300006802 | Aqueous | RADEEWQCVFSISLAKNKKKQGMAFTCKAFAEWCAKNQDLL* |
| Ga0070748_11124491 | 3300006920 | Aqueous | AVFAINIAKAPAKQSIAFSCKAFSAWVAKNQDLL* |
| Ga0105050_102761881 | 3300007516 | Freshwater | RFDMEWQAAFAINVAKNPDKQSVAFSSSAFAQWVEKNEDLL* |
| Ga0114341_104631591 | 3300008108 | Freshwater, Plankton | FMEYLGRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL* |
| Ga0114343_10459501 | 3300008110 | Freshwater, Plankton | FDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL* |
| Ga0114337_12213023 | 3300008262 | Freshwater, Plankton | AEWQAVFAINIAKAKDKQAIAFSSKSFSNWVAKNQDLL* |
| Ga0114973_101784973 | 3300009068 | Freshwater Lake | VDKKTIDKFMEYIERFDAEWQACFAINIAKNPQKQQVAFSAKKFSDWVEKNEDLL* |
| Ga0105098_104028222 | 3300009081 | Freshwater Sediment | ERFEPEWQACFAINVAKSPTKQAVAFSSAKFADWVQKNEDLL* |
| Ga0105098_105996371 | 3300009081 | Freshwater Sediment | EPEWQAVFAINIAKTPSKQGIAFSCKAFANWVAKNQDLL* |
| Ga0105103_104579941 | 3300009085 | Freshwater Sediment | PEWQACFAINIAKSTTKQQIAFSSSKFADWVQRNEDLL* |
| Ga0114980_102194081 | 3300009152 | Freshwater Lake | TPFMTYLERLAPAWQAAFAINVAKNPNKQKIAFSSGAFASWLERNEDLL* |
| Ga0114968_107554103 | 3300009155 | Freshwater Lake | DAEWQAVFAINIAKNPVKQSIAFSSNAFKDWVVKNQDLL* |
| Ga0114977_103480361 | 3300009158 | Freshwater Lake | ITKETISPFMEYLERFDAEWQAVFAINIAKNSTKQSIAFSSSAFKDWVVKNQDLL* |
| Ga0114978_1001282216 | 3300009159 | Freshwater Lake | RFDAEWQAVFAINIAKTTSKQNIAFSSKAFTDWVAKNQDLL* |
| Ga0114978_106729553 | 3300009159 | Freshwater Lake | PFMEYLERFDAEWQAVFAINIAKAPTKQSIAFSSKAFADWVAKNQDLL* |
| Ga0114981_100448134 | 3300009160 | Freshwater Lake | DAEWQAVFAVNIAKNTAKQNIAFSCAAFAAWVAKNQDIL* |
| Ga0114981_107463272 | 3300009160 | Freshwater Lake | PEWQACFAINIAKSSAKQAIAFSSMKFADWVQKNEDLL* |
| Ga0114970_104879052 | 3300009163 | Freshwater Lake | EYLERFDAEWQAVFAINIAKTPSKQSIAFSCKAFAEWVAKNQDLL* |
| Ga0114975_103578391 | 3300009164 | Freshwater Lake | EPEWQAAFCINAAKSKTKQAVAFSSKKFADWVRNNEDML* |
| Ga0114959_102989801 | 3300009182 | Freshwater Lake | FMEYISRFLPEWQACFAINIAKSPRQKIAFGNAAFSAWVAKNEDLL* |
| Ga0114959_103361993 | 3300009182 | Freshwater Lake | AEWQAVFAINIAKSQSKQSIAFSAKAFTAWVAKNQDLL* |
| Ga0114976_101844214 | 3300009184 | Freshwater Lake | ETIAPFMEYLSRFDAEWQAVFAINIAKNPSKQAIAFSSSAFKDWVVKNQDLL* |
| Ga0114972_105600681 | 3300009187 | Freshwater Lake | TPFMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL* |
| Ga0114951_100985365 | 3300009502 | Freshwater | FDAEWQAVFAINIAKTPGKQAIAFSSKAFADWVASNQDLL* |
| Ga0114951_101224503 | 3300009502 | Freshwater | EWQACFAINVAKAPTKQAIAFGSRKFTEWVAKNEDLL* |
| Ga0114967_100794751 | 3300010160 | Freshwater Lake | RLPAEWQAVFCINLAKSNKQNMAFSSRKFSEWVSKNQDLL* |
| Ga0136644_102305033 | 3300010334 | Freshwater Lake | VRFEPEWQSVFAINIAKTPTKQKIAFSCKAFADWVAKNQDLL* |
| Ga0133913_118190413 | 3300010885 | Freshwater Lake | EPEWQACFAINIAKSPSKQAVAFSSAKFADWVQKNEDLL* |
| Ga0133913_127015172 | 3300010885 | Freshwater Lake | SRFDAEWQAVFAINIAKNPAKQAIAFSSSAFKDWVVKNQDLL* |
| Ga0139557_10473571 | 3300011010 | Freshwater | TKESITPFMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL* |
| Ga0151661_13027982 | 3300011261 | Marine | NYLDRFEAEWQAAFAINIAKNPNRQKIAFSSNAFADWVQKNEDLL* |
| Ga0164292_105400011 | 3300013005 | Freshwater | IQRVEKDTIDAFMTYLERFEPEWQAAFCINIAKSKSKQVVAFGCRKFSAWVAKNNDLL* |
| (restricted) Ga0172373_108139513 | 3300013131 | Freshwater | ETIKPFMDYIERFEAEWQAVFAVNIARTPSKQAIAFGSEKFAAWVAKNQDLL* |
| (restricted) Ga0172362_105385021 | 3300013133 | Sediment | VTKETIKPFMDYIERFEAEWQAVFAVNIARTPSKQAIAFGSEKFAAWVAKNQDLL* |
| Ga0136641_11068661 | 3300013286 | Freshwater | TIAPFMQYLERFDAEWQAVFAINIAKSKEKQSIAFSAKAFADWVAKNQDLL* |
| Ga0177922_103548621 | 3300013372 | Freshwater | FEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL* |
| Ga0177922_103853371 | 3300013372 | Freshwater | LERFDAEWQAVFAINIAKSKEKQSIAFSAKAFADWVAKNQDLL* |
| (restricted) Ga0172376_103573581 | 3300014720 | Freshwater | KETIKPFMDYIERFEAEWQAVFAVNIARTPSKQAIAFGSEKFAAWVAKNQDLL* |
| Ga0181338_10019497 | 3300015050 | Freshwater Lake | VFGAIEKITAETMTPFMTYLERLAPAWQAAFAINVAKNPVKQKIAFSSGAFASWLERNEDLL* |
| Ga0181338_10147482 | 3300015050 | Freshwater Lake | QYLERFAPEWQAVFAVNIAKAPAKQSIAFSCKAFAAWVAKNQDLL* |
| Ga0181338_10213651 | 3300015050 | Freshwater Lake | MKYLERMSAEWQAVFAINIAKSDTKQEIAFSCKAFSDWVAKNQDLL* |
| Ga0181338_10260191 | 3300015050 | Freshwater Lake | TIDAFMEYLERFDAEWQAVFAINIAKNRDKQAIAFSCKAFSEWVAKNQDLL* |
| Ga0181338_10356383 | 3300015050 | Freshwater Lake | ERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL* |
| Ga0181350_10386041 | 3300017716 | Freshwater Lake | IDKQSITPFMEYVERFDAEWQAVFAINIAKNRDKQAIAFSCKAFSEWVAKNQDLL |
| Ga0181350_10404563 | 3300017716 | Freshwater Lake | FMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0181350_10797313 | 3300017716 | Freshwater Lake | AEWQAVFAINIAKSDTKQEIAFSCKAFSDWVAKNQDLL |
| Ga0181350_11225863 | 3300017716 | Freshwater Lake | QSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0181362_10450991 | 3300017723 | Freshwater Lake | QAVFAINIAKSPAKQSIAFSCKAFAAWVARNQDLL |
| Ga0181362_11086382 | 3300017723 | Freshwater Lake | WQAVFAINIAKSQSKQNIAFSCKAFSDWVAKNQDLL |
| Ga0181365_10663801 | 3300017736 | Freshwater Lake | TIDSFMEYLERFDAEWYAVFATNIAKTHAKQSIAFSAKAFTAWVAKNQDLL |
| Ga0181352_10775524 | 3300017747 | Freshwater Lake | QAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0181352_10927831 | 3300017747 | Freshwater Lake | FDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0181352_11249551 | 3300017747 | Freshwater Lake | EWQACFAINIAKSPRQKIAFGCSAFSAWVAKNEDLL |
| Ga0181352_11784202 | 3300017747 | Freshwater Lake | ITPFMEYLERFDAEWQAVFAIQLAKNRDKQAIAFSCQAFSNWVAKNQDLL |
| Ga0181352_11901281 | 3300017747 | Freshwater Lake | YMERFAPEWQAAFAINIAKSKTKQSVAFGCKAFSDWVARNEDLL |
| Ga0181352_12076143 | 3300017747 | Freshwater Lake | AEWQAVFAINISKTPSKQSIAFGAKAFADWVAKNQDLL |
| Ga0181344_10210645 | 3300017754 | Freshwater Lake | RFEPEWQAAFAINIAKSATKQKVAFSCKAFSDWVAKNEDLL |
| Ga0181344_10403181 | 3300017754 | Freshwater Lake | TKESITPFMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0181344_11125621 | 3300017754 | Freshwater Lake | AFNAISKVEKETMTPFMDYISRFAPEWQACFAINIAKSPRQKIAFGCSAFSAWVAKNEDL |
| Ga0181344_11183924 | 3300017754 | Freshwater Lake | FDAEWQAVFAINIAKTPSKQSIAFGAKAFADWVAKNQDLL |
| Ga0181344_11415143 | 3300017754 | Freshwater Lake | AEWQAVFAINIAKSNEKQAIAFSAKAFADWVAKNQDLL |
| Ga0181344_11788333 | 3300017754 | Freshwater Lake | FMEYLERFDAEWQAVFAINIAKTPSKQAIAFGAKAFADWVAKNQDLL |
| Ga0181356_12517703 | 3300017761 | Freshwater Lake | SRVEKHTIDAFMEYLERFDAEWQAVFAINIAKSQSKQSIAFSAKAFTAWVAKNQDLL |
| Ga0181343_10676391 | 3300017766 | Freshwater Lake | TTITPFMQYLDRFSPEWQAVFAINIAKTPSKQAIAFSCKSFADWVAKNQDLL |
| Ga0181343_11975353 | 3300017766 | Freshwater Lake | FTEEWQAAFAINIAKSKTKQPVAFSCKKFSEWVAKNEDLL |
| Ga0181358_100255814 | 3300017774 | Freshwater Lake | ERFQPEWQACFAINIAKSTSKQAIAFSSPKFADWVQRNEDLL |
| Ga0181358_12539171 | 3300017774 | Freshwater Lake | RKESITPFMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0181358_12680702 | 3300017774 | Freshwater Lake | PFMEYVERFEPEWQAAFCINLAKSKTKQAVAFSSKKFADWVRNNEDML |
| Ga0181357_10513981 | 3300017777 | Freshwater Lake | EWQAVFAINIAKSDTKQEIAFSCKAFSDWVAKNQDLL |
| Ga0181357_13014371 | 3300017777 | Freshwater Lake | KVDKTCITPFMKYLERFEPEWQACFAINVAKNPTKQAIAFSSPAFAGWVQANEDLL |
| Ga0181349_11032271 | 3300017778 | Freshwater Lake | IDAFMEYLERFDAEWQAVFAINIAKSQSKQSIAFSAKAFTAWVAKNQDLL |
| Ga0181349_12155693 | 3300017778 | Freshwater Lake | FDAEWQAVFAINIAKSQSKQNIAFSCKAFSDWVAKNQDLL |
| Ga0181346_10889984 | 3300017780 | Freshwater Lake | MEYLERFDAEWQAVFAINIAKSQAKQSIAFSAKAFTA |
| Ga0181346_12174871 | 3300017780 | Freshwater Lake | SITPFMTYLERFEPEWQSVFAINIAKSPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0181348_10784233 | 3300017784 | Freshwater Lake | EYLNRFDAEWQAVFAINIAKTPSKQSIAFSCKAFADWVAKNHDLL |
| Ga0181348_11548613 | 3300017784 | Freshwater Lake | CALVAFNAIAKVDKETMTPFMEYIERFHVEFQSCFCINMAKSPRQKIAFGCKAFSDWVAKNEDLL |
| Ga0181348_11687201 | 3300017784 | Freshwater Lake | KKGRSITPFMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0181355_10836631 | 3300017785 | Freshwater Lake | PAWQAAFAINVAKNPVKQKIAFSSGAFASWLERNEDLL |
| Ga0181355_11554621 | 3300017785 | Freshwater Lake | ETIAPFMEYLERFDAEWQAVFAINIAKNEIKQNVAFSSDAFKEWIVKNQDLL |
| Ga0181355_12172191 | 3300017785 | Freshwater Lake | IAPFMEYLNRFDAEWQAVFAINIAKTPSKQSIAFSCKAFADWVAKNHDLL |
| Ga0181355_12635843 | 3300017785 | Freshwater Lake | QAVFAINIAKNPSKQSIAFSSSAFKDWVVKNQDLL |
| Ga0181355_13028942 | 3300017785 | Freshwater Lake | DKSTITPFMQYLERFEPEWQACFAINVAKSPTKQSIAFSSTAFADWVAKNEDLL |
| Ga0188839_10123622 | 3300019122 | Freshwater Lake | EWQAVFAINVARTPAKQSLAFGNKKFADWLAANQDLL |
| Ga0181359_12600701 | 3300019784 | Freshwater Lake | PKFMEYIERFQAEWQACFAINIAKSPTKQQIAFSSSKFADWVQKNEDLL |
| Ga0207193_11966174 | 3300020048 | Freshwater Lake Sediment | PVEWQAVFAVNIAKSSKQSMAFTCREFSEWCAKNNDVL |
| Ga0207193_14568254 | 3300020048 | Freshwater Lake Sediment | EYLERFDAEWQAVFAINIAKSQAKQSIAFSAKAFTAWVAKNQDLL |
| Ga0194110_100268711 | 3300020084 | Freshwater Lake | WQAVFAVNIARTPSKQAIAFGSEKFAAWVAKNQDLL |
| Ga0208091_10075084 | 3300020506 | Freshwater | PFMEYLNRFDAEWQAVFAINIAKTPSKQSIAFSCKAFADWVAKNHDLL |
| Ga0194122_100140409 | 3300021092 | Freshwater Lake | EAEWQAVFAVNIARTPSKQAIAFGSEKFAAWVAKNQDLL |
| Ga0214165_10380522 | 3300021137 | Freshwater | WQAVFAINIAKTPSKQAIAFSCKAFSDWVAKNQDLL |
| Ga0214164_10628093 | 3300021138 | Freshwater | FDAEWQAVFAINIAKTPSKQAIAFSCKAFSDWVARNQDLL |
| Ga0214166_10326191 | 3300021139 | Freshwater | YLQRFDAEWQAVFAINIAKTPSKQAIAFGCKAFSDWVAKNQDLL |
| Ga0194117_100755231 | 3300021424 | Freshwater Lake | YIERFEAEWQAVFAVNIARTPSKQAIAFGSEKFAAWVAKNQDLL |
| Ga0222713_102192282 | 3300021962 | Estuarine Water | TINPFMDYIERFNAEWQACFAINIAKTPSKQAVAFSSKKFADWVQRNEDLL |
| Ga0222713_107496233 | 3300021962 | Estuarine Water | KTNITQFMKYLERFSAEWQAVFAINIARMPSKQAVAFGCKAFSDWVAKNQDLL |
| Ga0222712_102357371 | 3300021963 | Estuarine Water | KVDKSTINPFMDYIERFNAEWQACFAINIAKTPSKQAVAFSSKKFADWVQRNEDLL |
| Ga0222712_108341661 | 3300021963 | Estuarine Water | RFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0181353_11148281 | 3300022179 | Freshwater Lake | AIAKVEKDTITPFMDYISRFAPEWQACFAINIAKSPRQKIAFGCSAFSAWVAKNEDLL |
| Ga0181353_11558732 | 3300022179 | Freshwater Lake | AKVTKDTIAPFMEYLQRFEPEWQAVFAINIAKTPSKQAIAFSSKAFAEWVAKNQDLL |
| Ga0181353_11559552 | 3300022179 | Freshwater Lake | PFMEYLERFEPEWQAVFAINIAKTPSKQGIAFSCKAFANWVARNQDLL |
| Ga0181354_11807303 | 3300022190 | Freshwater Lake | EWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0196901_12119591 | 3300022200 | Aqueous | LERLEPEWQATFCINMAKNPQKQSVAFSSPAFADWIQQNQDLL |
| Ga0181351_10450244 | 3300022407 | Freshwater Lake | EKDTIVPFMEYLERLEHEWQSVFAINIAKNTAKQPIAFSCKAFADWVAKNQDLL |
| Ga0214923_102131334 | 3300023179 | Freshwater | ITKESITPFMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0214919_101929024 | 3300023184 | Freshwater | RITKESITPFMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0256681_113727331 | 3300023311 | Freshwater | MKYMDRFEPEWQAAFAINVAKNTTKQAIAFSSKAFSDWVRKNSDLL |
| Ga0209986_103023302 | 3300024433 | Deep Subsurface | FEPEWQACFAINVAKSPTKQSIAFSSSAFADWVAKNEDLL |
| Ga0208502_10158872 | 3300025339 | Freshwater | KETITPFMQYLERFDAEWQAVFAINIAKTPSKQAIAFSCKEFSAWVAKNQDLL |
| Ga0208505_10269612 | 3300025366 | Freshwater | DAEWQAVFAINIAKTPSKQGIAFSCKAFSDWVAKNQDLL |
| Ga0208256_10553171 | 3300025382 | Freshwater | FDAEWQAVFAINIAKTPSKQAIAFSCKAFSDWVAKNQDLL |
| Ga0208740_10462472 | 3300025391 | Freshwater | EWQAVFAINIAKTPSKQAIAFSCKAFSDWVAKNQDLL |
| Ga0208745_10069064 | 3300025403 | Freshwater | IARMTKESITPFMEYLQRFDAEWQAVFAINIAKTPSKQAIAFSCKAFSDWVAKNQDLL |
| Ga0208622_10864521 | 3300025430 | Freshwater | VTKETITPFMEYLERFSPEWQAVFAINIAKSGTKQSIAFNCRAFSDWVAKNQDLL |
| Ga0208379_10143294 | 3300025598 | Freshwater | ERFESEWQACFAINIAKSTSKQSIAFSSKKFSEWVAKNEDLL |
| Ga0208872_10282601 | 3300025838 | Freshwater | KDTITPFMTYLERFDAEWQAVFAINIAKTPSKQSIAFSSKAFSAWVAKNQDLL |
| Ga0255188_10912662 | 3300027079 | Freshwater | EAEWQAVFAINIAKTPSKQSIAFSCKAFADWVAKNQDLL |
| Ga0255114_10579183 | 3300027145 | Freshwater | IERFQAEWQACFAINIAKSPTKQQIAFSSSKFADWVQKNEDLL |
| Ga0255120_10626573 | 3300027594 | Freshwater | DKTTIEPFMTYLERFTEEWQAAFAINIAKSKTKQPVAFSCRKFSEWVAKNEDLL |
| Ga0255121_10959923 | 3300027598 | Freshwater | RFTEEWQAAFAINIAKSKTKQPVAFSCRKFSEWVAKNEDLL |
| Ga0208974_10741684 | 3300027608 | Freshwater Lentic | MDYLSRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0208942_11522021 | 3300027627 | Freshwater Lentic | DKFMAYIERFEAEWQACFCINIAKSNKQAVAFSSKKFSDWVTKNQDLL |
| Ga0208975_10686581 | 3300027659 | Freshwater Lentic | RITKDTITPFMEYLERFDAEWQAVFAINIAKSKDKQAIAFSSKAFSNWVAKNQDLL |
| Ga0209599_102252791 | 3300027710 | Deep Subsurface | ITKETISPFMDYLSRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0209087_11591794 | 3300027734 | Freshwater Lake | RITKETIAPFMEYLSRFDAEWQAVFAINIAKNPSKQAIAFSSSAFKDWVVKNQDLL |
| Ga0209190_13753461 | 3300027736 | Freshwater Lake | AEWQAVFAINIAKSKEKQSIAFSAKAFADWVAKNQDLL |
| Ga0209084_12202313 | 3300027749 | Freshwater Lake | LERFDAEWQAVFAINIAKSQSKQSIAFSAKAFTAWVAKNQDLL |
| Ga0209444_100869991 | 3300027756 | Freshwater Lake | YLERFDAEWQAVFCINIAKAVSKQNIAFSSKAFANWVAKNQDLL |
| Ga0209296_10554484 | 3300027759 | Freshwater Lake | ISPFMDYLSRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0209296_10656294 | 3300027759 | Freshwater Lake | LDAEWQAVFAINIAKTPRKQQIAFGTKEFSDWVAKNQDLL |
| Ga0209134_101755952 | 3300027764 | Freshwater Lake | LERFEPEWQSVFAIQIAKTPAKQSIAFSCKAFADWVSKNQDLL |
| Ga0209246_101643993 | 3300027785 | Freshwater Lake | PFMTYLERFEPEWQSVFAINIAKTPTKQNIAFSCKAFADWVAKNQDLL |
| Ga0209353_102557691 | 3300027798 | Freshwater Lake | MDYIERFNAEWQACFAINIAKTPSKQAVAFSSKKFADWVQRNEDLL |
| Ga0209353_102772872 | 3300027798 | Freshwater Lake | LERFEPEWQATFAINIAKNPSKQSIAFTSSAFGNWMQENEDLL |
| Ga0209353_103020141 | 3300027798 | Freshwater Lake | YLERFDAEWQAVFAINIAKSQSKQNIAFSCKAFSDWVAKNQDLL |
| Ga0209353_104134443 | 3300027798 | Freshwater Lake | TKETISPFMDYLSRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0209985_103081341 | 3300027806 | Freshwater Lake | ERFEPEWQAVFAINIAKSRVKQQVAFSCKAFSDWVAKNEDLL |
| Ga0209354_102782241 | 3300027808 | Freshwater Lake | WQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0209550_106069153 | 3300027892 | Freshwater Lake | ISPFMEYLSRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0209777_104128651 | 3300027896 | Freshwater Lake Sediment | ERFESEWQACFAINVAKAPTKQAIAFSSRKFTEWVAKNEDLL |
| Ga0209777_108691052 | 3300027896 | Freshwater Lake Sediment | MEYLQRFDAEWQAVFAINIAKTPSKQAIAFSCKAFSDWVAKNQDLL |
| Ga0209777_108909103 | 3300027896 | Freshwater Lake Sediment | DKDTITPFMTYLERFDAEWQAVFAINIAKTPSKQSIAFSSKAFSAWVAANQDLL |
| Ga0209427_107451081 | 3300027901 | Marine Sediment | MEYIGRFDAEWQAVFAINIAKTPSKQNIAFSCKAFADWVAANQDLL |
| Ga0209400_10799021 | 3300027963 | Freshwater Lake | DYLGRFSPEWQASFAINIAKNKTKQSIAFGNKAFSDWVAANQDLL |
| Ga0209191_11855881 | 3300027969 | Freshwater Lake | ERMEPEWQAAFCINAAKSKTKQAVAFSSKKFADWVRNNEDML |
| Ga0209299_12806343 | 3300027974 | Freshwater Lake | KMDKQSMPKFMEYIERFQPEWQACFAINIAKSPSKQAIAFSSSKFADWVQKNEDLL |
| Ga0209702_104127602 | 3300027976 | Freshwater | EEWQAAFAINVAKNPNKQKVAFTSDAFRNWVLENEDLL |
| Ga0209284_104023952 | 3300027983 | Freshwater | KPFMKYISRFQEEWQAAFAINVAKNPNKQKVAFTSEAFRDWVLKNEDLL |
| Ga0268280_11988903 | 3300028298 | Saline Water | TISPFMDYLSRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0304728_12741263 | 3300028393 | Freshwater Lake | IAKIDKNTIDTFMTYLERFESEWQACFAINVAKSPSKQAIAFSSRKFTEWVAKNEDLL |
| Ga0304730_10468234 | 3300028394 | Freshwater Lake | ERFGAEWQACFAINIAKTPSKQQIAFSSKKFADWVQKNEDLL |
| Ga0307380_106971512 | 3300031539 | Soil | KVTKDTIGPFMKYLERFEPEWQACFAINVAKSPTKQSIAFSSSAFADWVAKNEDLL |
| Ga0315293_110480421 | 3300031746 | Sediment | FEPEWQACFAINIAKNPAKQSIAFSSSAFAAWVAKNEDLL |
| Ga0315907_111673831 | 3300031758 | Freshwater | PFMEYLQRFSPEWQAVFAINIAKTPSKQAIAFSCKAFADWVAKNQDLL |
| Ga0315909_101696404 | 3300031857 | Freshwater | ERFDAEWQAVFAINIAKAKDKQAIAFSSKSFSNWVAKNQDLL |
| Ga0315909_104549314 | 3300031857 | Freshwater | YLSRFDAEWQAVFAINIAKNPSKQSIAFSSSAFKDWVVKNQDLL |
| Ga0315909_105172761 | 3300031857 | Freshwater | TPFMKYLERFDMEWQAAFAINVAKNPTKQSVAFSCAAFAQWVERNEDLL |
| Ga0315909_106297513 | 3300031857 | Freshwater | TIAPFMEYLGRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0315909_109413533 | 3300031857 | Freshwater | CITPFMKYLERFEPEWQACFAINVAKNPTKQAIAFSSPAFAGWVQANEDLL |
| Ga0315909_109842801 | 3300031857 | Freshwater | KIDKSTIGPFMEYIERFEPEWQACFAINVAKNPQKQSIAFSAKAFGDWVSKNEDLL |
| Ga0315285_104081682 | 3300031885 | Sediment | VAKDSIASFMQYLERFEPEWQACFAINIAKNPAKQSIAFSSSAFAAWVAKNEDLL |
| Ga0315904_101877955 | 3300031951 | Freshwater | FMQYLERFEPEWQAVFAINIAKSRVKQQVAFSCKAFSDWVAKNEDLL |
| Ga0315904_104759561 | 3300031951 | Freshwater | SPEWQAVFAINIAKTPSKQAIAFSCKAFADWVAKNQDLL |
| Ga0315904_105607251 | 3300031951 | Freshwater | RMQPEWQAVFAINLSKAHAKQQVAFSSRAFSDWVAKNQDLL |
| Ga0315294_101021741 | 3300031952 | Sediment | MQYLERFEPEWQACFAINIAKNPAKQSIAFSSSAFAAWVAKNEDLL |
| Ga0315901_105511323 | 3300031963 | Freshwater | KYLERFDMEWQAAFAINVAKNPTKQSVAFSCAAFAQWVERNEDLL |
| Ga0315284_104314831 | 3300032053 | Sediment | PFMQYLERFAPEWQAVFAVNIAKSPAKQSIAFSCKAFAACVAKNQDLL |
| Ga0315284_104982793 | 3300032053 | Sediment | EWQACFAINIAKNPAKQSIAFSSSAFAAWVAKNEDLL |
| Ga0315905_112767301 | 3300032092 | Freshwater | RVTKETIAPFMEYLERFDAEWQAVFCINIAKATSKQSIAFSSKAFANWVAKNQDLL |
| Ga0315902_103004545 | 3300032093 | Freshwater | FMEYLQRFSPEWQAVFAINIAKTPSKQAIAFSCKAFADWVAKNQDLL |
| Ga0315902_107502671 | 3300032093 | Freshwater | MKYLERFDMEWQAAFAINVAKNPTKQSVAFSCAAFAQWVERNEDLL |
| Ga0315903_100828021 | 3300032116 | Freshwater | PKFMEYIERFQAEWQACFAINIAKSPSKQAIAFSSSKFADWVQKNEDLL |
| Ga0315903_103644992 | 3300032116 | Freshwater | TPLMQYLERFEPEWQAVFAINIAKSMAKQQVAFSCKAFSDWVAKNEDLLG |
| Ga0315268_100643026 | 3300032173 | Sediment | DKQTITPFMEYLERFDAEWQAVFAINIAKSQSKQNIAFSCKAFSDWVAKNQDLL |
| Ga0316232_13103601 | 3300032605 | Freshwater | SRVTKETITPFMEYLERFSPEWQAVFAINIAKSGTKQSIAFNCRAFSDWVAKNQDLL |
| Ga0316224_10287066 | 3300032753 | Freshwater | LERFSPEWQAVFAINIAKSGTKQSIAFNCRAFSDWVAKNQDLL |
| Ga0334994_0509242_407_547 | 3300033993 | Freshwater | MEYLERFDAEWQAVFAINIAKTKEKQSIAFSAKAFADWVAKNQDLL |
| Ga0334994_0585940_2_109 | 3300033993 | Freshwater | QAVFVINIAKTPSKQAIAFKSKTFADWAAKNVDLL |
| Ga0335027_0409233_746_877 | 3300034101 | Freshwater | LSRFEPEWQACFAINIAKNPQRQSVAFSSAAFANWVRDNEDLL |
| Ga0335030_0608945_467_607 | 3300034103 | Freshwater | MEYLQRFEPEWQAVFAINIAKTPSKQAIAFSSKAFAEWVAKNQDLL |
| Ga0335031_0146888_1463_1627 | 3300034104 | Freshwater | VDKQTITPFMQYLERFDPEWQACFAINIAKSSKQSIAFSCKAFSDWVAKNEDLL |
| Ga0335031_0346266_742_879 | 3300034104 | Freshwater | MEYMGRFDAEWQAAFAINIAKSAKQAIAFSNRAFADWVAKNQDLL |
| Ga0335035_0360265_59_199 | 3300034105 | Freshwater | MEYLSRFDAEWQAVFAINIAKNPAKQSIAFSSSAFKDWVVKNQDLL |
| Ga0335051_0335122_2_136 | 3300034109 | Freshwater | YLERFEPEWQACFAINIARTPSKQAIAFSCKAFSDWVAKNQDLL |
| Ga0335053_0148991_1425_1565 | 3300034118 | Freshwater | MQYLERFEPEWQACFAINVAKSPTKQAVAFSSTAFADWVAKNEDLL |
| Ga0335053_0495219_609_722 | 3300034118 | Freshwater | EWQAVFAVNIAKLAGKQSIAFASPRFAKWLAVNQDVL |
| Ga0335056_0321135_2_181 | 3300034120 | Freshwater | AIQRIDKDTLTPFMKYLGRLPHEWQAAFAINLAKNPQRQAIAFRSAAFAAWVSKNEDLL |
| Ga0334997_0309639_3_146 | 3300034280 | Freshwater | FMSYLERFEPEWQACFAINIARTPSKQAIAFSCKAFSDWVAKNQDLL |
| ⦗Top⦘ |