| Basic Information | |
|---|---|
| Family ID | F024193 |
| Family Type | Metagenome |
| Number of Sequences | 207 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MPANNQYVIIRDDLLVDPVTIIADGLLIGRLGQCELLLNHPSVSRVQAG |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 207 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.58 % |
| % of genes near scaffold ends (potentially truncated) | 99.52 % |
| % of genes from short scaffolds (< 2000 bps) | 94.20 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.068 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (9.179 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.140 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.285 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.88% Coil/Unstructured: 83.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 207 Family Scaffolds |
|---|---|---|
| PF13247 | Fer4_11 | 9.18 |
| PF00498 | FHA | 3.86 |
| PF12838 | Fer4_7 | 1.93 |
| PF13180 | PDZ_2 | 0.48 |
| PF00579 | tRNA-synt_1b | 0.48 |
| PF02401 | LYTB | 0.48 |
| PF03814 | KdpA | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 207 Family Scaffolds |
|---|---|---|---|
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 0.97 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.07 % |
| Unclassified | root | N/A | 1.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104522839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300000550|F24TB_10765567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300000559|F14TC_103518934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300000559|F14TC_104527416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1016366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 803 | Open in IMG/M |
| 3300000787|JGI11643J11755_10879774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 802 | Open in IMG/M |
| 3300000789|JGI1027J11758_12608996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 513 | Open in IMG/M |
| 3300004114|Ga0062593_102149170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 624 | Open in IMG/M |
| 3300004114|Ga0062593_102595894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300004145|Ga0055489_10211149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 606 | Open in IMG/M |
| 3300004157|Ga0062590_102107708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300004480|Ga0062592_100212986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1376 | Open in IMG/M |
| 3300004480|Ga0062592_101374901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 671 | Open in IMG/M |
| 3300004480|Ga0062592_101829323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300004643|Ga0062591_101444333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 685 | Open in IMG/M |
| 3300005176|Ga0066679_10112910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1666 | Open in IMG/M |
| 3300005289|Ga0065704_10184619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1210 | Open in IMG/M |
| 3300005293|Ga0065715_10615479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300005293|Ga0065715_11178946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 502 | Open in IMG/M |
| 3300005295|Ga0065707_11040952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 529 | Open in IMG/M |
| 3300005330|Ga0070690_100840307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 715 | Open in IMG/M |
| 3300005330|Ga0070690_101151903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300005334|Ga0068869_100974421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 737 | Open in IMG/M |
| 3300005334|Ga0068869_101991939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300005338|Ga0068868_101300686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300005338|Ga0068868_101855914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 570 | Open in IMG/M |
| 3300005364|Ga0070673_101328437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 676 | Open in IMG/M |
| 3300005365|Ga0070688_100627525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300005440|Ga0070705_101334702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300005440|Ga0070705_101671895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 537 | Open in IMG/M |
| 3300005441|Ga0070700_100670217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 821 | Open in IMG/M |
| 3300005441|Ga0070700_100727575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 792 | Open in IMG/M |
| 3300005444|Ga0070694_100506966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300005444|Ga0070694_100832272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 758 | Open in IMG/M |
| 3300005444|Ga0070694_101905000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 508 | Open in IMG/M |
| 3300005445|Ga0070708_102025320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 533 | Open in IMG/M |
| 3300005450|Ga0066682_10756291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 591 | Open in IMG/M |
| 3300005457|Ga0070662_101272405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300005459|Ga0068867_100091955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2303 | Open in IMG/M |
| 3300005459|Ga0068867_100649266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 926 | Open in IMG/M |
| 3300005459|Ga0068867_102162261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 528 | Open in IMG/M |
| 3300005536|Ga0070697_100498115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300005544|Ga0070686_100041354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 2881 | Open in IMG/M |
| 3300005545|Ga0070695_100884030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300005546|Ga0070696_101804546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 528 | Open in IMG/M |
| 3300005547|Ga0070693_100855622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 678 | Open in IMG/M |
| 3300005547|Ga0070693_101026133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 625 | Open in IMG/M |
| 3300005548|Ga0070665_100239480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1815 | Open in IMG/M |
| 3300005549|Ga0070704_100250617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1454 | Open in IMG/M |
| 3300005557|Ga0066704_10715595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 629 | Open in IMG/M |
| 3300005563|Ga0068855_101842596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 614 | Open in IMG/M |
| 3300005564|Ga0070664_100261391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1557 | Open in IMG/M |
| 3300005577|Ga0068857_101809838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 598 | Open in IMG/M |
| 3300005598|Ga0066706_10096719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 2134 | Open in IMG/M |
| 3300005617|Ga0068859_100366560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
| 3300005617|Ga0068859_100795078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1034 | Open in IMG/M |
| 3300005617|Ga0068859_101284573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300005719|Ga0068861_100349818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300005719|Ga0068861_101831952 | Not Available | 602 | Open in IMG/M |
| 3300005843|Ga0068860_102839949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 502 | Open in IMG/M |
| 3300005844|Ga0068862_100710236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300005844|Ga0068862_100713289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300005844|Ga0068862_101422622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 697 | Open in IMG/M |
| 3300005937|Ga0081455_10467481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 857 | Open in IMG/M |
| 3300006032|Ga0066696_10270386 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300006046|Ga0066652_101714071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300006169|Ga0082029_1595606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300006804|Ga0079221_10286145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 958 | Open in IMG/M |
| 3300006876|Ga0079217_10770736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300006894|Ga0079215_10403388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 808 | Open in IMG/M |
| 3300006969|Ga0075419_10704134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300007004|Ga0079218_10072317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2250 | Open in IMG/M |
| 3300009098|Ga0105245_10841226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300009098|Ga0105245_11352593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300009100|Ga0075418_10469094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300009100|Ga0075418_11369426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300009101|Ga0105247_11243997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300009147|Ga0114129_12043065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300009148|Ga0105243_10256684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1563 | Open in IMG/M |
| 3300009148|Ga0105243_12868746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300009162|Ga0075423_12993377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300009174|Ga0105241_10840609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300009174|Ga0105241_10842024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300009174|Ga0105241_11499669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300009174|Ga0105241_12646852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300009176|Ga0105242_12403390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300009545|Ga0105237_11089717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300009553|Ga0105249_10874186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300009840|Ga0126313_10985925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300010036|Ga0126305_10289268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300010038|Ga0126315_11265604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300010039|Ga0126309_10390897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300010047|Ga0126382_10655202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300010047|Ga0126382_12135282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300010047|Ga0126382_12205109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300010047|Ga0126382_12285599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010358|Ga0126370_11380935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300010373|Ga0134128_11868948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300010373|Ga0134128_12663705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300010375|Ga0105239_12291565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300010397|Ga0134124_10410190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
| 3300010397|Ga0134124_10739181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300010397|Ga0134124_11232244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300010397|Ga0134124_11444874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300010397|Ga0134124_12996167 | Not Available | 516 | Open in IMG/M |
| 3300010399|Ga0134127_10782367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300010399|Ga0134127_10979494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300010399|Ga0134127_13216347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300010400|Ga0134122_10325880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300010400|Ga0134122_10687254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300010400|Ga0134122_11094402 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 789 | Open in IMG/M |
| 3300010400|Ga0134122_11243504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300010400|Ga0134122_11689507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300011414|Ga0137442_1017594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300012093|Ga0136632_10066750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1662 | Open in IMG/M |
| 3300012096|Ga0137389_10056297 | Not Available | 2990 | Open in IMG/M |
| 3300012202|Ga0137363_10897166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300012204|Ga0137374_10256128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1463 | Open in IMG/M |
| 3300012208|Ga0137376_11662999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012285|Ga0137370_10818702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300012582|Ga0137358_10131775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1700 | Open in IMG/M |
| 3300012685|Ga0137397_11221067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300012917|Ga0137395_10215325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
| 3300012918|Ga0137396_10359563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300012922|Ga0137394_11116690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300012927|Ga0137416_10442069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300012944|Ga0137410_10670053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300012957|Ga0164303_10196943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300012960|Ga0164301_10073617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1862 | Open in IMG/M |
| 3300012961|Ga0164302_10580711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300013100|Ga0157373_10867815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300013100|Ga0157373_10900751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300013100|Ga0157373_11271509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300013297|Ga0157378_12404599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300013297|Ga0157378_13175976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300013306|Ga0163162_12490194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300013306|Ga0163162_12909367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300013308|Ga0157375_12002505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300013308|Ga0157375_13013128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300014325|Ga0163163_10497338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300014745|Ga0157377_10168808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
| 3300014968|Ga0157379_12377939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300014969|Ga0157376_12303236 | Not Available | 578 | Open in IMG/M |
| 3300015241|Ga0137418_10283311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
| 3300015371|Ga0132258_11729202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1577 | Open in IMG/M |
| 3300015373|Ga0132257_104313065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300015374|Ga0132255_100237358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2599 | Open in IMG/M |
| 3300018000|Ga0184604_10064880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1049 | Open in IMG/M |
| 3300018027|Ga0184605_10230885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 841 | Open in IMG/M |
| 3300018084|Ga0184629_10328594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300018422|Ga0190265_10967049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300018429|Ga0190272_11117320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300018476|Ga0190274_12222246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300019487|Ga0187893_10123313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2193 | Open in IMG/M |
| 3300021445|Ga0182009_10365013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300022694|Ga0222623_10421118 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025327|Ga0209751_10090956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2646 | Open in IMG/M |
| 3300025910|Ga0207684_10425441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300025911|Ga0207654_11401968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300025911|Ga0207654_11412042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300025914|Ga0207671_10768565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300025917|Ga0207660_10831877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300025920|Ga0207649_11348164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300025923|Ga0207681_10016964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 4568 | Open in IMG/M |
| 3300025925|Ga0207650_11434578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300025930|Ga0207701_11292067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300025930|Ga0207701_11475445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300025931|Ga0207644_11884783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300025935|Ga0207709_10489001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300025938|Ga0207704_11330650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300025942|Ga0207689_11374656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300025945|Ga0207679_10503758 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300025945|Ga0207679_10882896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300025945|Ga0207679_11491894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300025960|Ga0207651_10452642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300025981|Ga0207640_11642206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300026023|Ga0207677_11754351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300026035|Ga0207703_10607874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300026067|Ga0207678_11789964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300026088|Ga0207641_11100795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300026095|Ga0207676_11269515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300026116|Ga0207674_12002114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 544 | Open in IMG/M |
| 3300026116|Ga0207674_12195152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
| 3300026118|Ga0207675_101673225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300026318|Ga0209471_1181649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300027691|Ga0209485_1197014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300027750|Ga0209461_10182454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300027886|Ga0209486_11019740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300027903|Ga0209488_10749485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300028379|Ga0268266_10131383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2240 | Open in IMG/M |
| 3300028380|Ga0268265_10596507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300028381|Ga0268264_10022216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 5179 | Open in IMG/M |
| 3300028381|Ga0268264_11660372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300028381|Ga0268264_11902425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300028381|Ga0268264_12459001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300028381|Ga0268264_12682742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300028792|Ga0307504_10206707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300031226|Ga0307497_10524114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300031548|Ga0307408_101329796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300031548|Ga0307408_101384734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300031716|Ga0310813_11098053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300031716|Ga0310813_11278420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300031740|Ga0307468_100236470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300031740|Ga0307468_100835250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300031908|Ga0310900_10010681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 4506 | Open in IMG/M |
| 3300031911|Ga0307412_11868944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300032017|Ga0310899_10291169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.18% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.48% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.48% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.48% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.48% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1045228392 | 3300000364 | Soil | MAEKNQYVIIRDDLPIDPLQVTSEGLLLGRLLECEIVLNHPAVSRVQAGIKQVEGNFFLFPLRPT |
| F24TB_107655672 | 3300000550 | Soil | MANSYIIIRXXXXLDPLSILSEGLLIGRLTQCELSLNHPSVSRA |
| F14TC_1035189342 | 3300000559 | Soil | MDQKNKYIISREDLLQDPVTLISEGILIGRLKECELLLNHPFV |
| F14TC_1045274161 | 3300000559 | Soil | MSTRNKYIIIRDDLLTDPITVITEGLLIGRLLQCEVVLNHP |
| KanNP_Total_noBrdU_T14TCDRAFT_10163661 | 3300000596 | Soil | MATKNQYVIIRDDRPVDPVTVITEGLLIGRLLECEVLLNHPSVSRVQAGIKQI |
| JGI11643J11755_108797741 | 3300000787 | Soil | MSENRFIIIREDLVQDPVTLISDGLLIGRLVECELLLNHPAVSRAQAG |
| JGI1027J11758_126089961 | 3300000789 | Soil | MAAKNQYVIIRDDLPIDPVTVITEGLLIGRLMECELLLNHPAISRAQAGIKQID |
| Ga0062593_1021491702 | 3300004114 | Soil | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLPQCELLLNHPSVSRVQAGIKQFEE |
| Ga0062593_1025958942 | 3300004114 | Soil | MSANQFIIVRDDLPIDPVTIISEGLLIGRLGQCELLLNHPSVS |
| Ga0055489_102111492 | 3300004145 | Natural And Restored Wetlands | VAANQYVIIRDDLQVDPVLLISEGVLMGRLPQCEVLLNHPSVSRVQAGIKQFD |
| Ga0062590_1021077082 | 3300004157 | Soil | MPVNNQYIIIRQDLTIDPVTIISEGLLIGRLPECEVLLNHPS |
| Ga0062592_1002129861 | 3300004480 | Soil | MPVNNQYIIIRQDLTIDPVTIISEGLLIGRLPECEVLLNHPSVSRVQA |
| Ga0062592_1013749012 | 3300004480 | Soil | MVAKNQYFIVRNDLAVDPVTIISDGLLIGRLPSCEVLLNHPAVSRVQAGIKQVEAGY |
| Ga0062592_1018293232 | 3300004480 | Soil | MNQYTIIREDLLVDPVKIITEGLLIGRLPQCELLLNHPSV |
| Ga0062591_1014443331 | 3300004643 | Soil | MASRNKYVLIRDDLLTDPVTMFTDGLLIGRLRDCEVLLNHPSVSRVQA |
| Ga0066679_101129102 | 3300005176 | Soil | MEQPHKFTIVRTDLVQDATTILTDSLLIGRLRECELLLNHPWVSRVQAGI |
| Ga0065704_101846192 | 3300005289 | Switchgrass Rhizosphere | MPQANKYIIIREDLVQDPVTIITDGLLIGRLQECELLLNHPSVSRAQA |
| Ga0065715_106154792 | 3300005293 | Miscanthus Rhizosphere | MPSESKFVIIREDLVQDPLTVIGGSLLIGRLLDCELRLNHPAVSRVQAGIKFA |
| Ga0065715_111789462 | 3300005293 | Miscanthus Rhizosphere | MKNQFVIIRDDLLTDPVTLISDGVLIGRLMACEILLNHPSVSRAQAGIKGIDDNYYLFALRPNN |
| Ga0065707_110409522 | 3300005295 | Switchgrass Rhizosphere | MPQTNKYIIIREDLVQDPVTIITDGLLIGRLQECELLLNHPSVSRAQ |
| Ga0070690_1008403072 | 3300005330 | Switchgrass Rhizosphere | MASQNKYTIIRDDLLTDPVTMFTEGLLIGRLRDCEVLLNHPSVSRVQAGIKQ |
| Ga0070690_1011519032 | 3300005330 | Switchgrass Rhizosphere | MAAPNQYVIVRSDLPIDPVTIISDGMLIGRLPECELLLNHPS |
| Ga0068869_1009744212 | 3300005334 | Miscanthus Rhizosphere | MASQNKYTIIRDDLLTDPVTMFTEGLLIGRLRDCEVLLNHPSVS |
| Ga0068869_1019919391 | 3300005334 | Miscanthus Rhizosphere | MPQANKYIIIREDLVQDPVTIITDGLLLGRLQECELLLNHPSVSR |
| Ga0068868_1013006862 | 3300005338 | Miscanthus Rhizosphere | MAAPNQYVIVRSDLPIDPVTIISDGMLIGRLPECELLLNHP |
| Ga0068868_1018559141 | 3300005338 | Miscanthus Rhizosphere | MPTENKFVIIREDLVQDPLTVIADSLLIGRLLDCELLLNHPAVSRVQAGIKVA |
| Ga0070673_1013284371 | 3300005364 | Switchgrass Rhizosphere | MNQYLIIRDDLLVDPVTIISEGLLIGRLLQCELLLNHPSVSRVQAGIKQFG |
| Ga0070688_1006275251 | 3300005365 | Switchgrass Rhizosphere | VKNQYVIIRDDLLIDPVTVITEGLLIGRLMECELLLNHPAV |
| Ga0070705_1013347021 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNQFVIIRDDLLTDPVTLICDGVLIGRPMACEILLNHPSVSRAQA |
| Ga0070705_1016718952 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVNNQYIIIRQDLTIDPVTIISEGLLIGRLPECEVLLNHPSVSRVQAGIKQFE |
| Ga0070700_1006702172 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSANQFIIVRDDLPIDPVTIITEGLLIGRLSHCELLLNHPSVSRAQAGIKQVEDDYYLFALRP |
| Ga0070700_1007275752 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQYTIIREDLLVDPVKIITEGLLIGRLPQCELLLNHPSVSRVQAGIKHLE |
| Ga0070694_1005069662 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MATNQYVIIRDDLLVDPVRIISEGLLIGRLSQCELRLNHP |
| Ga0070694_1008322722 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MASQNKYTIIRDDLLTDPVTMFTEGLLIGRLRDCEVLLNHPSVSRVQAGIKQI |
| Ga0070694_1019050002 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MASRNKYVLIRDDLLTDPVTMFTEGLLIGRLRDCEVLLNHPSVSRVQ |
| Ga0070708_1020253202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTNQYVIIREDLLTDPVTLISEGVLIGRLMECEVLLNHPAVSRAQAGIKQIDDN |
| Ga0066682_107562911 | 3300005450 | Soil | MPQHNKYIVDRGDLLQDPVTIITEGLLIGRLKQCDLLLNHPSVSR |
| Ga0070662_1012724051 | 3300005457 | Corn Rhizosphere | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLPQCELLLNHPSVS |
| Ga0068867_1000919552 | 3300005459 | Miscanthus Rhizosphere | MPTNQYVIIRDDLLVDPVMIISEGLLIGRLPQCELLLNHPSVS |
| Ga0068867_1006492661 | 3300005459 | Miscanthus Rhizosphere | MPTNQYVIIRDDLLVDPVRIISEGLLIGRLSQCELRLNHPSVSRVQAGIKQF |
| Ga0068867_1021622611 | 3300005459 | Miscanthus Rhizosphere | MSANQFIIIRDDLLVDPVTIIADGLLIGRLGQCELLLNHPSVSRVQAGIKQVE |
| Ga0070697_1004981152 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEQGNKYIVIREDLVQDPVTIISDGPLIGRLTQCELLLNHPTVS |
| Ga0070686_1000413541 | 3300005544 | Switchgrass Rhizosphere | MASQNKYTIIRDDLLTDPVTMFTEGLLIGRLRDCEVLLNHPSVSR |
| Ga0070695_1008840301 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNQFVIIRDDLLTDPVTLVSDGVLIGRLIACEILLNHPSVSRA |
| Ga0070696_1018045461 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQENKYIIIREDLVQDPVTIITEGLLLGRLQECELLLNHPSVSRAQAGIKLVQ |
| Ga0070693_1008556221 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNQFVIIRDDLLTDPVTLVSDGVLIGRLMACEILLNHPSVSRAQAGIKEI |
| Ga0070693_1010261331 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNNQYVIVRSDLAVDPVTIISDGLLIGRLPTCEVLLNHPLVSRVQAGI |
| Ga0070665_1002394802 | 3300005548 | Switchgrass Rhizosphere | MAEKNQYVIIRDDLPIDPLQVTSEGLLIGRLLECEVVLNHPAVS |
| Ga0070704_1002506172 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKFVIIRDDLPIDPVTVISDGLLIGRLPQCEVLLNHPSVSRVQAGIKQ |
| Ga0066704_107155951 | 3300005557 | Soil | MAARNTYIIIRDDLLIDPMTIITEGLLIGRLRESEVLLNHPSVSRAQAGIKQIESNYYL |
| Ga0068855_1018425962 | 3300005563 | Corn Rhizosphere | MPQENKYVIIREDLVQDPVTIITDGLLLGRLQECELLLNHPSVSRAQAGIK |
| Ga0070664_1002613912 | 3300005564 | Corn Rhizosphere | MNQYLIIRDDLLVDPVTIFSEGLLIGRLLQCELLLNHPSVSRVQAGIKQFGSDYYLFA |
| Ga0068857_1018098381 | 3300005577 | Corn Rhizosphere | MPQANKYVIVREDLVQDPVTIITDGLLIGRLQECELLLNHPAVSRAQAGIKLIGEDYF |
| Ga0066706_100967192 | 3300005598 | Soil | MQGTFIIIRDDLQVDPATIVAEGLLAGRLPTCELLLNHPSVSRLHAGITAS |
| Ga0068859_1003665602 | 3300005617 | Switchgrass Rhizosphere | VKNQYVIIRDDLLIDPVTVITEGLLIGRLMECELLLNHP |
| Ga0068859_1007950782 | 3300005617 | Switchgrass Rhizosphere | VKNQYVIIRDDLPTDPVTVITDGLLIGRLMECEVLLNHPSVSRAQAGIKQVEDNYYLFPL |
| Ga0068859_1012845731 | 3300005617 | Switchgrass Rhizosphere | MATNRYVIIRDDLLVDPVTIISEGLLIGRLPQCELLLNHPSVS |
| Ga0068861_1003498181 | 3300005719 | Switchgrass Rhizosphere | MAAPNQYVIVRSDLPIDPVTIISDGMLIGRLPECELL |
| Ga0068861_1018319521 | 3300005719 | Switchgrass Rhizosphere | MKNQFLIIRDDLLTDPVTVISDGLLIGRLMECEVL |
| Ga0068860_1028399491 | 3300005843 | Switchgrass Rhizosphere | MSANQFIIVRDDLPIDPVTIITEGLLIGRLSHCELLLNHPSVS |
| Ga0068862_1007102361 | 3300005844 | Switchgrass Rhizosphere | MAQGNRFIIIREDLVQDPVTIISDGLLIGRLQECE |
| Ga0068862_1007132891 | 3300005844 | Switchgrass Rhizosphere | VKNQYVIIRADLPIDPVTVISEGLLIGRLMECEVLLNHPSVS |
| Ga0068862_1014226222 | 3300005844 | Switchgrass Rhizosphere | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLSQCELLLNHPSVSRVQAGIKHF |
| Ga0081455_104674811 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MATRNQYIIIRDDRAVDPVTVISEGLLIGRLLECEVLLNHPSVSRVQAGIK |
| Ga0066696_102703862 | 3300006032 | Soil | MPQENKYVIVREDLVQDPVTIITDGLLIGRLQECELLLNHPAVSRAQAGIKLVKESY |
| Ga0066652_1017140711 | 3300006046 | Soil | MSQHNKFIVIREDLLQDPVTIITEGLLLGRLTECELLLNHPS |
| Ga0082029_15956061 | 3300006169 | Termite Nest | MSTNQYIIIRDDLLVDPVTIISEGLLIGRLLQCELLL |
| Ga0079221_102861451 | 3300006804 | Agricultural Soil | MPTNHYVIIRDDLLVDPVTIISEGLLIGRLPQCELRLNHPSVSRVQAGIKQF |
| Ga0079217_107707362 | 3300006876 | Agricultural Soil | MTVRNKYVIIRDDLPNDPATIISEGLLIGRLLDCE |
| Ga0079215_104033881 | 3300006894 | Agricultural Soil | MPVNNQYIIVRDDLMIDPVTIISDGLLIGRLPECEVLLNHPSVSRVQAGIKQ |
| Ga0075419_107041341 | 3300006969 | Populus Rhizosphere | MSTNQYVIIRDDLLTDPVTLISEGVLIGRLMECEV |
| Ga0079218_100723172 | 3300007004 | Agricultural Soil | MAARNQYVIVRNDLPIDPVTIITDGLLIGRLPECEVLLNHPSVSR |
| Ga0105245_108412261 | 3300009098 | Miscanthus Rhizosphere | MPQQNKYIIIREDLVQDPVTIITDGLLLGRLQECELLLNHPSVSRAQAGIKL |
| Ga0105245_113525932 | 3300009098 | Miscanthus Rhizosphere | MPAKNQYVIIRDDLPVDPVSIISEGMLIGRLPECELQLN |
| Ga0075418_104690942 | 3300009100 | Populus Rhizosphere | MPAKNQYVVVRSDLTVDPVTIISDGLLIGRLPECEVLLN |
| Ga0075418_113694262 | 3300009100 | Populus Rhizosphere | MPTRNKYVIIRDDLLTDPVTMFSEGLLIGRLLACEVLLNHPAVSRVQAGIKQV |
| Ga0105247_112439971 | 3300009101 | Switchgrass Rhizosphere | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLPQCELLLNHPSVSR |
| Ga0114129_120430652 | 3300009147 | Populus Rhizosphere | MPEKNQYVIIREDLTVDPVTIITEGLLIGRLPQCE |
| Ga0105243_102566842 | 3300009148 | Miscanthus Rhizosphere | MPQANKYIIIREDLVQDPVTIITDGLLLGRLQECELLLNHPSVSRAQAGIKL |
| Ga0105243_128687462 | 3300009148 | Miscanthus Rhizosphere | MNKFVIIRDDLPIDPVTVISDGLLIGRLPQCEVLLNHPSVSRIQAG |
| Ga0075423_129933771 | 3300009162 | Populus Rhizosphere | MAAKNQFIIVRHDLPVDPITIVSEGLLIGRLLQCELLLNHPSVSRVK |
| Ga0105241_108406092 | 3300009174 | Corn Rhizosphere | MAEKNQYVIIRDDLPIDPLQVTSEGLLIGRLLECEVVLN |
| Ga0105241_108420241 | 3300009174 | Corn Rhizosphere | MNQFVIIRDDLPLDPVTIISEGLLIGRLPQCEVLLNHPSVSRVQAGIKQF |
| Ga0105241_114996691 | 3300009174 | Corn Rhizosphere | MPTNQYVIIRDDLLVDPITIISEGLLIGRLSQCELLLNHPSV |
| Ga0105241_126468522 | 3300009174 | Corn Rhizosphere | MPAKNQYLIIRDDLLTDPVTVISDGLLIGRLMECELLLNHPAVSRAQAG |
| Ga0105242_124033902 | 3300009176 | Miscanthus Rhizosphere | MAQANKYIIIREDLVQDPVTIITDGLLIGRLQECELLLNHPSVSR |
| Ga0105237_110897172 | 3300009545 | Corn Rhizosphere | MPTNHYVIIRDDLLVDPATIISEGLLIGRLPQCELRLNHPSVSRVQAGIK |
| Ga0105249_108741861 | 3300009553 | Switchgrass Rhizosphere | MPAKNQYVIIRDDLPVDPVTIISEGMLIGRLPECELQLNHPSVSRVQA |
| Ga0126313_109859251 | 3300009840 | Serpentine Soil | MPANHYVIIRDDLPVDPATVISDGLLIGRLLQCELLLNHPSVSRVQAGIKQ |
| Ga0126305_102892681 | 3300010036 | Serpentine Soil | MSNQFIIIRNDLPLDPVTIITRGLLIGRLPACEVLLNHPSVSRVQAGI |
| Ga0126315_112656041 | 3300010038 | Serpentine Soil | MPSNNQYVIIRDDLPIDPVTIISEGLLIGRLSQCELMLNHPSVSRVQAG |
| Ga0126309_103908971 | 3300010039 | Serpentine Soil | MAGNQYVIIRDDLAVDPVTVISDGLLIGRLPQCELLLNHPSVSRVQAGIKQF |
| Ga0126382_106552022 | 3300010047 | Tropical Forest Soil | MPANQYIIIRDDLLVDPVTIISDGLLIGRLHQCELLLNHPSVSRVQAGIKQ |
| Ga0126382_121352822 | 3300010047 | Tropical Forest Soil | MNQYLIIRDDLPVDPVTIISDGLLIGRLLQCELLLNHPSVSRVQG |
| Ga0126382_122051091 | 3300010047 | Tropical Forest Soil | MNQYIIIRDDLPVDPVTIVSDGLLIGRLRQCELLLNHPSVSRVQAGIKQFDENY |
| Ga0126382_122855992 | 3300010047 | Tropical Forest Soil | MKNQFVIIRDDQLTDPVTLFSDGVLIGRLMACEILLNHPSVSRAQAGIKEIDDN |
| Ga0126370_113809351 | 3300010358 | Tropical Forest Soil | MNRFIIIRDDLPVDPVTIISEGLLIGRLLQCDLLLNHP |
| Ga0134128_118689481 | 3300010373 | Terrestrial Soil | MPSENKFVIIREDLVQDPLTVIGDSLLIGRLLDCELLLNHPAV |
| Ga0134128_126637052 | 3300010373 | Terrestrial Soil | MPQENKYIIVREDLVQDPVTIVTDGLLVGRLQECELLLNHPSVSRAQAGIKLVGDSYFLF |
| Ga0105239_122915652 | 3300010375 | Corn Rhizosphere | MPTNRYVIIRDDLLVDPVTIISEGLLIGRLPQCEL |
| Ga0134124_104101902 | 3300010397 | Terrestrial Soil | MPQENKYVIIREDLVQDPVTIITDGLLLGRLQECELL |
| Ga0134124_107391812 | 3300010397 | Terrestrial Soil | MAVKNQYIIIRDQLLTDPVTVITDGLLIGRLMECELLLNHPAVSRAQAGIKQIDDAY |
| Ga0134124_112322441 | 3300010397 | Terrestrial Soil | MAAKNQFVIIRDDLPVDPVTIISDGLLIGRLLQCELLLNHPSV |
| Ga0134124_114448741 | 3300010397 | Terrestrial Soil | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLPQCELRLNHPSVSRVQA |
| Ga0134124_129961672 | 3300010397 | Terrestrial Soil | MAEKNQYTIIRDDLPIDPLQVTSEGLLIGRLLECEVVLN |
| Ga0134127_107823672 | 3300010399 | Terrestrial Soil | MNQYHIIRDDLPLDPVTIISEGLLIGRLPQCEVLLNH |
| Ga0134127_109794941 | 3300010399 | Terrestrial Soil | MPQANKYVIIREDLVQDPVTIITDGLLIGRLQECELLLNHPAVSRAQA |
| Ga0134127_132163471 | 3300010399 | Terrestrial Soil | MPQENKYIIIREDLVQDPVTIITDGLLLGRLQECELLLNHPSVSRAQAGIKLVQ |
| Ga0134122_103258802 | 3300010400 | Terrestrial Soil | MPVNNQYIIIRQDLTIDPVTIISEGLLIGRLPECE |
| Ga0134122_106872542 | 3300010400 | Terrestrial Soil | MPQENKYIIIREDLLQDPVTIITDGLLLGRLQECELLLNHPSVSRAQAGIKLVKDSYFLFGLRPS |
| Ga0134122_110944021 | 3300010400 | Terrestrial Soil | MPAKNQYVVVRSDLAVDPVTIISDGLLIGRLPECELLLNHPAVS |
| Ga0134122_112435042 | 3300010400 | Terrestrial Soil | MNRYLIIRDDLPVDPVTIISDGLLIGRLLQCELLLN |
| Ga0134122_116895072 | 3300010400 | Terrestrial Soil | MPTNQYVIIRDDLLVDPVTIISDGLLIGRLPQCELLLNHPSVSRVQ |
| Ga0137442_10175941 | 3300011414 | Soil | MPQANKYIIIREDLVQDPVSIITDGLLVGRLQECELLLNHPSVSRAQAGIKLVQDSYFL |
| Ga0136632_100667502 | 3300012093 | Polar Desert Sand | MSQQNQYIIIREDLVQDPVTIITEGLLIGRLLECELLLNHPAVSRAQAGIKG |
| Ga0137389_100562971 | 3300012096 | Vadose Zone Soil | MPGENKFVIIREDLVQDPLTVISDGLLIGRLVECEL |
| Ga0137363_108971661 | 3300012202 | Vadose Zone Soil | MEQQNKFIVVREDLPQDPVTIITEGLLVGRLLECE |
| Ga0137374_102561281 | 3300012204 | Vadose Zone Soil | MPQENKYHIVREDLVQDPVTIITDGLLIGRLQECE |
| Ga0137376_116629992 | 3300012208 | Vadose Zone Soil | MEPQFIILREDLLLDPVTIITDGLLIGRLQECELLLNHPSVSRVQAGIKAIE |
| Ga0137370_108187021 | 3300012285 | Vadose Zone Soil | MAQENKYIIIREDLVQDPVTIITDGLLIGRLQECELLLNHPAVSRAQAGIKLIN |
| Ga0137358_101317752 | 3300012582 | Vadose Zone Soil | MPARNTYIIIRDDLQVDPVTIITESLLIGRLRDSEVLLNHPSVSR |
| Ga0137397_112210671 | 3300012685 | Vadose Zone Soil | MPARNTYIIIRDDLLIDPVTIITEGLLIGRLRDSEVLLNHPSVSRAQAGIKQIESDYYLF |
| Ga0137395_102153252 | 3300012917 | Vadose Zone Soil | MAARNTYIIIRDDLLIDPVTIITEGLLIGRLRESEVLLNHPSVSRAQAGIKQIES |
| Ga0137396_103595631 | 3300012918 | Vadose Zone Soil | MPARNTYIIIRDDLLIDPVTIITEGLLIGRLRESEVL |
| Ga0137394_111166901 | 3300012922 | Vadose Zone Soil | MQGTFIIIRDDLQVDPATIVAEGLLAGRLPTCELLLNHPSVSRLHAGITAT |
| Ga0137416_104420692 | 3300012927 | Vadose Zone Soil | MPGENKFVIIREDLVQDPLTVISDGLLIGRLVECELLLNHTAVSRVQAGIKVAAGNYHLF |
| Ga0137410_106700531 | 3300012944 | Vadose Zone Soil | MPQENKYIIIREDLVQDPVTIITDGLLIGRLQECELLLNHPSV |
| Ga0164303_101969431 | 3300012957 | Soil | MKNQFVIIRDDLLTDPVTLVSDGVLIGRLMACEILLNHPS |
| Ga0164301_100736172 | 3300012960 | Soil | MPQENRYIIIREDLVQDPVTIITDGLLIGRLQECELLLNHPSVSRAQAGIKLI |
| Ga0164302_105807111 | 3300012961 | Soil | MPSENKFVIIREDLQVDPVTIVADGILIGRLPASELLLNHPSVSRLQAGITNVDGDYY |
| Ga0157373_108678151 | 3300013100 | Corn Rhizosphere | MNKFILIRDDLLVDPVTIISEGLLIGRLLQCELLLNHPSVSRVQAGIKQIDD |
| Ga0157373_109007511 | 3300013100 | Corn Rhizosphere | MPAKNQYIVVRHDLAVDPVTIISDGLLIGRLSTCELLLNHPSVSRVQAG |
| Ga0157373_112715091 | 3300013100 | Corn Rhizosphere | MPVNNQFIIIRQDLTIDPVTIVSEGLLIGRLSECEVRLNHPSVSRV |
| Ga0157378_124045992 | 3300013297 | Miscanthus Rhizosphere | MPAKNQYIVVRHDLAVDPVTIISDGLLIGRLPTCELLLNHPSVSRVQAGI |
| Ga0157378_131759761 | 3300013297 | Miscanthus Rhizosphere | VKNQYVIIRADLPIDPVTVISEGLLIGRLMECEILLNHPSVSRAQAGIKHI |
| Ga0163162_124901941 | 3300013306 | Switchgrass Rhizosphere | MNQYHIIRDDLPLDPVTIISEGLLIGRLPQCEVLLNHPSVSRVQAG |
| Ga0163162_129093671 | 3300013306 | Switchgrass Rhizosphere | MPSESKFVIIREDLVQDPLTVIGGSLLIGRLLDCELRLNHPAV |
| Ga0157375_120025052 | 3300013308 | Miscanthus Rhizosphere | MAQANKYVIVREDLVQDPVTIITDGLLIGRLQECELLLNHPAV |
| Ga0157375_130131281 | 3300013308 | Miscanthus Rhizosphere | MSQNRFIIIREDLVQDPVTIISDGLLIGRLLECELLLNHP |
| Ga0163163_104973382 | 3300014325 | Switchgrass Rhizosphere | MAEKNQYTIIRDDLPIDPLEVTSEGLLIGRLLECEIVLNHPAVSRVQAGI |
| Ga0157377_101688081 | 3300014745 | Miscanthus Rhizosphere | MNQYQIIRDDLPLDPVMIISEGLLIGRLPQCEVLLNHPSVSRVQAGIKQF |
| Ga0157379_123779391 | 3300014968 | Switchgrass Rhizosphere | MPAKNQYLIIRDDLPVDPVTIISDGLLIGRLLQCELLLNHP |
| Ga0157376_123032362 | 3300014969 | Miscanthus Rhizosphere | VKNQYVIIRDDLLIDPVTVITEGLLIGRLMECELLLNH |
| Ga0137418_102833111 | 3300015241 | Vadose Zone Soil | MPARNTYIIIRDDLLIDPVTIITEGLLIGRLRDSEVLLNHPS |
| Ga0132258_117292022 | 3300015371 | Arabidopsis Rhizosphere | MKNQFVIIRDDLLTDPVTLVSDGVLIGRLMACEILLNHPSVSRAQAGIKGIDDNY |
| Ga0132257_1043130652 | 3300015373 | Arabidopsis Rhizosphere | MKNQFVIIRDDLLTDPVTLISDGVLIGRLMACEILLNHPSVPRAQAGIKGIDDNYYLFRLRPNNPV |
| Ga0132255_1002373581 | 3300015374 | Arabidopsis Rhizosphere | VKNQYVIIRDDLLIDPVTVITEGLLIGRLMECELLLNHPAVSRAQAGI |
| Ga0184604_100648801 | 3300018000 | Groundwater Sediment | MPQANKYIIIREDLVQDPVTIITAGLLVGRLQECELLLNHPSVSRAQAGIKLVQDSYFHFGLRPSNPVKLN |
| Ga0184605_102308852 | 3300018027 | Groundwater Sediment | LLSALGHHRILLMAQENKYVIIREDLVQDPVTIIADGLLIGRLLECEVLLNHPSISRVQAGIKKVNG |
| Ga0184629_103285941 | 3300018084 | Groundwater Sediment | MPQENKYIIIREDLVQDPVTIITDGLLLGRLQECELLLNHPSVSRAQAGIKLVHDSY |
| Ga0190265_109670492 | 3300018422 | Soil | MNQYVIIRDDLLIHPVRVVTEGLLIGRLPQCEVLLNHPSVSRVQA |
| Ga0190272_111173201 | 3300018429 | Soil | MPSPRKFIIVREDLVQDPLTIITEGLLIGRLPTCELPLNHPAVSRAQAGIRGLSD |
| Ga0190274_122222462 | 3300018476 | Soil | MSTKPRLSNQMPQNKYIIIREDLMQDPVIIITEGLLIGRLLECELLLNHPAVSRAQAGIK |
| Ga0187893_101233132 | 3300019487 | Microbial Mat On Rocks | MNRFIIMREDLVQDPVTIISDGLLIGRLKECELLLNHPSVSRAQAG |
| Ga0182009_103650131 | 3300021445 | Soil | MTTKNQYIIIRDDLPVDPVTIISDGLMIGRLHQCELLLNHPSVSRVQAGIKQFEDN |
| Ga0222623_104211182 | 3300022694 | Groundwater Sediment | MSQENKYVIIREDLVQDPVTIITDGLLIGRLQECELQLNHPAVSRGQAGI |
| Ga0209751_100909561 | 3300025327 | Soil | MEQGNKFIIIREDLLQDPVTIISDGMLIGRLKECELLLNHPY |
| Ga0207684_104254411 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNQFVIIRDDLLTDPVTLVSDGVLIGRLMACEILLNHPSVSRAQAGIKEIDDNYYL |
| Ga0207654_114019682 | 3300025911 | Corn Rhizosphere | MPTNQYVIIRDDLLVDPITIISEGLLIGRLSQCELLLNHP |
| Ga0207654_114120422 | 3300025911 | Corn Rhizosphere | MNQYTIIREDLLVDPVKIITEGLLIGRLPQCELLLNHPS |
| Ga0207671_107685652 | 3300025914 | Corn Rhizosphere | MKNQFVIIRDDLLTDPVTLVSDGVLIGRLIACEILLNHPSVSRAQAGI |
| Ga0207660_108318771 | 3300025917 | Corn Rhizosphere | MPAKNQYIVVRHDLAVDPVTIISDGLLIGRLPTCEL |
| Ga0207649_113481641 | 3300025920 | Corn Rhizosphere | MPVNNQFIIIRQDLDIDPITIISDGLLIGRLGECELLLNHPSVSRVQ |
| Ga0207681_100169641 | 3300025923 | Switchgrass Rhizosphere | MAQGNRFIIIREDLVQDPVTIISDGLLIGRLQECELLLNH |
| Ga0207650_114345782 | 3300025925 | Switchgrass Rhizosphere | MPANNQYVIIRDDLLVDPVTIIADGLLIGRLGQCELLLNHPSVSRVQAG |
| Ga0207701_112920671 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MASQNKYTIIRDDLLTDPVTMFTEGLLIGRLRDCE |
| Ga0207701_114754451 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNQFVIIRDDLLTDPVTLVSDGVLIGRLMACEILLNHPSVSRVQAGIKGIDDNYYL |
| Ga0207644_118847831 | 3300025931 | Switchgrass Rhizosphere | MKNQFVIIRDDLLTDPVTLISDGVLIGRLMACEILLNHPSVSRAQAGIKGIDDNYYLFALRPN |
| Ga0207709_104890012 | 3300025935 | Miscanthus Rhizosphere | MPTNQYVIIRDDLLVDPVTIISDGLLIGRLTQCELLLNHPSVSRVQAGIK |
| Ga0207704_113306501 | 3300025938 | Miscanthus Rhizosphere | MASRNKYVIIRDDLLTDPVTMFTEGLLIGRLRDCE |
| Ga0207689_113746562 | 3300025942 | Miscanthus Rhizosphere | MNQYVIIRGDLLVDPVTIISEGLLIGRLLQCELLLNHPSVSRVQAGIKQL |
| Ga0207679_105037581 | 3300025945 | Corn Rhizosphere | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLPQCELLLNHPSVSRVQAGIKQFE |
| Ga0207679_108828961 | 3300025945 | Corn Rhizosphere | MNQYLIIRDDLLVDPVTIFSEGLLIGRLLQCELLLNHPSVSRVQAGIKQFGSDYYLFALRPGN |
| Ga0207679_114918941 | 3300025945 | Corn Rhizosphere | MNRYLIIRDDLLLDPVTVITEGLLIGRLPQCEVLLNHPSVSRVQAG |
| Ga0207651_104526422 | 3300025960 | Switchgrass Rhizosphere | MNQYVIIRDDLLIDPVTVITEGLLIGRLMECELLLNHPAVSR |
| Ga0207640_116422062 | 3300025981 | Corn Rhizosphere | MAEKNQYVIIRDDLPIDPLQVTSEGLLIGRLLECEVVLNHPAVSRVQAGIKQ |
| Ga0207677_117543511 | 3300026023 | Miscanthus Rhizosphere | MNQYVIIRDDLLVDPVTIISEGLLIGRLLQCELLLNHPSVSRVQAGIKQL |
| Ga0207703_106078741 | 3300026035 | Switchgrass Rhizosphere | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLSQCELLLNHPSVSRVQAG |
| Ga0207678_117899641 | 3300026067 | Corn Rhizosphere | MPQANKYVIVREDLVQDPVTIITDGLLLGRLQECELLLNHPSVSRAQAGIKLI |
| Ga0207641_111007951 | 3300026088 | Switchgrass Rhizosphere | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLPQCELLLNHPSV |
| Ga0207676_112695152 | 3300026095 | Switchgrass Rhizosphere | MPTNQYVIIRDDLLVDPVTIISEGLLIGRLSQCELLLNHPSVSRVQAGIKH |
| Ga0207674_120021141 | 3300026116 | Corn Rhizosphere | MASRNKYVIIRDDLLTDPVTMFTEGLLIGRLRDCEVLLNHPSVSRVQAGIKQ |
| Ga0207674_121951522 | 3300026116 | Corn Rhizosphere | MAAPNQYVIVRSDLPIDPVTIISDGMLIGRLPECELLLNHPSVSRVQAGA |
| Ga0207675_1016732251 | 3300026118 | Switchgrass Rhizosphere | MPQENKYVIIREDLVQDPVTIITDGLLLGRLQECELLLNHPSVSRAQAGIKLVDENYII |
| Ga0209471_11816492 | 3300026318 | Soil | MEQPHKFTIVRTDLVQDATTILTDSLLIGRLRECELLLNHPWVSRVQAG |
| Ga0209485_11970142 | 3300027691 | Agricultural Soil | MSRFVIIREDLVQDPLTIISDGLLIGRLVECELLLNHPAVSRAQAG |
| Ga0209461_101824541 | 3300027750 | Agave | MSANQYVIIRDDLPIDPVTIISDGLLIGRLPQCELLLNHPS |
| Ga0209486_110197402 | 3300027886 | Agricultural Soil | MAARNQYVIVRNDLPIDPVTIITDGLLIGRLPECEVL |
| Ga0209488_107494851 | 3300027903 | Vadose Zone Soil | MEATFIIIREDLQVDPVTIVAEGLLVGRLPTCELLLNHPSVSRLHAGVTSADG |
| Ga0268266_101313832 | 3300028379 | Switchgrass Rhizosphere | MAEKNQYVIIRDDLPIDPLQVTSEGLLIGRLLECEVVLNHPAVSRVQA |
| Ga0268265_105965071 | 3300028380 | Switchgrass Rhizosphere | MPAKNQYLIIRDDLPVDPVTIISDGLLIGRLLQCELLLNHPSVSRVQAGIKQVGDDYYI |
| Ga0268264_100222164 | 3300028381 | Switchgrass Rhizosphere | MNQYHIIRDDLPLDPVTIISEGLLIGRLPQCEVLLNHPSVSRVQAGIK |
| Ga0268264_116603722 | 3300028381 | Switchgrass Rhizosphere | MAEKNQYVIIRDDLPIDPLQVTSEGLLIGRLLECEVVLNHPAV |
| Ga0268264_119024251 | 3300028381 | Switchgrass Rhizosphere | MPTNHYVIIRDDLLVDPATIISEGLLIGRLPQCELRLNHPSV |
| Ga0268264_124590011 | 3300028381 | Switchgrass Rhizosphere | MPTNRYVIIRDDLLVDPVTIISEGLLIGRLPQCELRLNHPS |
| Ga0268264_126827421 | 3300028381 | Switchgrass Rhizosphere | MNQYTIIREDLLVDPVTIITEGLLIGRLPQCELLLNHPSVSRVQAGIKYL |
| Ga0307504_102067072 | 3300028792 | Soil | MPQENKYLIVREDLVQDPVTIITDGLLIGRLQECELLLNHPAVSRAQAGIKLIA |
| Ga0307497_105241142 | 3300031226 | Soil | VKNQYVIIRDDHLPTDPVTVISDGLLIGRLMECELLLNHPSVSRAQAGIKQI |
| Ga0307408_1013297962 | 3300031548 | Rhizosphere | MSANQFIIIRDDLPIDPVTIISEGLLIGRLGHCELLLNH |
| Ga0307408_1013847342 | 3300031548 | Rhizosphere | MSQNRFIIIREDLVQDPVTIISDGLLIGRLVECELLLNHPAV |
| Ga0310813_110980532 | 3300031716 | Soil | MASQNKYTIIRDDLLTDPVTMFTEGLLIGRLRDCEVQLNHPS |
| Ga0310813_112784202 | 3300031716 | Soil | MDPTFVIIREDLQVDPVTIVATGILIGRLPTCELLLNHPSVSRLQAGITNVDG |
| Ga0307468_1002364702 | 3300031740 | Hardwood Forest Soil | MPQENKYIIIREDLVQDPVTIITDGLLIGRLQECELLLNHPAVSRAQAGIKLIGDSYFLFGLRP |
| Ga0307468_1008352501 | 3300031740 | Hardwood Forest Soil | MPQENKYIIIREDLVQDPVTIITDGLLMGRLQECELLLNHPAVSRAQ |
| Ga0310900_100106814 | 3300031908 | Soil | MASRNKYVIIRDDLLTDPVTMFTEGLLIGRLRDCEVLLNHPSVSRVQAGI |
| Ga0307412_118689441 | 3300031911 | Rhizosphere | MPVSNQYIIIRQDLQVDPITIISEGLLIGRLTECEVMLNHPSVSRAQA |
| Ga0310899_102911692 | 3300032017 | Soil | MSANQFIIVRDDLPIDPVTIITEGLLIGRLGHCELLLNHPSVSRAQAGIKQVEDDYYLF |
| ⦗Top⦘ |