Metagenome Family F024052

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F024052
Family Type	Metagenome
Number of Sequences	207
Average Sequence Length	43 residues
Representative Sequence	MSQTDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS
Number of Associated Samples	158
Number of Associated Scaffolds	207

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	87.92 %
% of genes near scaffold ends (potentially truncated)	20.29 %
% of genes from short scaffolds (< 2000 bps)	80.19 %
Associated GOLD sequencing projects	142
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (93.720 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.145 % of family members)
Environment Ontology (ENVO)	Unclassified (22.705 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (29.952 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 23.61% β-sheet: 0.00% Coil/Unstructured: 76.39%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 207 Family Scaffolds
PF03401	TctC	16.43
PF00903	Glyoxalase	8.70
PF01042	Ribonuc_L-PSP	5.80
PF04909	Amidohydro_2	3.38
PF01712	dNK	2.90
PF01177	Asp_Glu_race	2.42
PF01070	FMN_dh	2.42
PF02548	Pantoate_transf	1.93
PF03070	TENA_THI-4	1.93
PF02464	CinA	1.93
PF01124	MAPEG	1.45
PF01975	SurE	0.97
PF04392	ABC_sub_bind	0.97
PF03450	CO_deh_flav_C	0.48
PF13492	GAF_3	0.48
PF00171	Aldedh	0.48
PF02569	Pantoate_ligase	0.48
PF07883	Cupin_2	0.48
PF00933	Glyco_hydro_3	0.48
PF13649	Methyltransf_25	0.48
PF04679	DNA_ligase_A_C	0.48
PF03030	H_PPase	0.48
PF00296	Bac_luciferase	0.48
PF01551	Peptidase_M23	0.48
PF02776	TPP_enzyme_N	0.48
PF13414	TPR_11	0.48
PF03446	NAD_binding_2	0.48
PF01909	NTP_transf_2	0.48
PF02826	2-Hacid_dh_C	0.48
PF14518	Haem_oxygenas_2	0.48
PF02371	Transposase_20	0.48
PF00557	Peptidase_M24	0.48
PF09130	DUF1932	0.48
PF13462	Thioredoxin_4	0.48
PF13592	HTH_33	0.48
PF13519	VWA_2	0.48
PF07331	TctB	0.48
PF00072	Response_reg	0.48

COG ID	Name	Functional Category	% Frequency in 207 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	16.43
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	5.80
COG1428	Deoxyadenosine/deoxycytidine kinase	Nucleotide transport and metabolism [F]	2.90
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	2.42
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	2.42
COG0413	Ketopantoate hydroxymethyltransferase	Coenzyme transport and metabolism [H]	1.93
COG1546	Nicotinamide mononucleotide (NMN) deamidase PncC	Coenzyme transport and metabolism [H]	1.93
COG0496	Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE	Replication, recombination and repair [L]	0.97
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.97
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.48
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.48
COG3808	Na+ or H+-translocating membrane pyrophosphatase	Energy production and conversion [C]	0.48
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.48
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.48
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	0.48
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.48
COG1472	Periplasmic beta-glucosidase and related glycosidases	Carbohydrate transport and metabolism [G]	0.48
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.48
COG0414	Panthothenate synthetase	Coenzyme transport and metabolism [H]	0.48

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.72 %
Unclassified	root	N/A	6.28 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.72 %
Unclassified	root	N/A	6.28 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.72 %
Unclassified	root	N/A	6.28 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	50.24 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	10.14 %
Unclassified	root	N/A	6.28 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.48 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	20.29 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	10.14 %
Unclassified	root	N/A	6.28 %
Candidatus Kryptonia	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia	0.48 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.97 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.97 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	20.29 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	10.14 %
Unclassified	root	N/A	6.28 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.48 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.48 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.48 %
Candidatus Kryptonia	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia	0.48 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	14.49 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	10.14 %
Unclassified	root	N/A	6.28 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.48 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.48 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.48 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.48 %
Candidatus Kryptonia	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia	0.48 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	14.49 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	10.14 %
Unclassified	root	N/A	6.28 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.48 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.48 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.48 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.48 %
Candidatus Kryptonia	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia	0.48 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	14.49 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	10.14 %
Unclassified	root	N/A	6.28 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.48 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.48 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.48 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.48 %
Candidatus Kryptonia	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia	0.48 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	14.49 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	10.14 %
Unclassified	root	N/A	6.28 %
Bradyrhizobium sp. WSM2793	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM2793	0.48 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.48 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.48 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.48 %
Candidatus Kryptonia	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia	0.48 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090015\|GPICI_9070640	All Organisms → cellular organisms → Bacteria → Proteobacteria	1458	Open in IMG/M
2140918013\|NODE_1594_length_1379_cov_11.755620	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1411	Open in IMG/M
2140918013\|NODE_8251_length_1184_cov_7.368243	All Organisms → cellular organisms → Bacteria → Proteobacteria	1216	Open in IMG/M
2170459016\|G1P06HT01CHEDL	All Organisms → cellular organisms → Bacteria → Proteobacteria	675	Open in IMG/M
2228664022\|INPgaii200_c1209947	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300000559\|F14TC_100114237	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1113	Open in IMG/M
3300000789\|JGI1027J11758_13040554	All Organisms → cellular organisms → Bacteria → Proteobacteria	1042	Open in IMG/M
3300003911\|JGI25405J52794_10002566	All Organisms → cellular organisms → Bacteria	3138	Open in IMG/M
3300003987\|Ga0055471_10004737	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2589	Open in IMG/M
3300003992\|Ga0055470_10009079	All Organisms → cellular organisms → Bacteria	1564	Open in IMG/M
3300003995\|Ga0055438_10084413	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	876	Open in IMG/M
3300003996\|Ga0055467_10004504	All Organisms → cellular organisms → Bacteria	2408	Open in IMG/M
3300003997\|Ga0055466_10021878	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1393	Open in IMG/M
3300003999\|Ga0055469_10276452	Not Available	540	Open in IMG/M
3300004013\|Ga0055465_10198931	Not Available	657	Open in IMG/M
3300004052\|Ga0055490_10187757	Not Available	621	Open in IMG/M
3300004052\|Ga0055490_10235522	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	561	Open in IMG/M
3300004114\|Ga0062593_100227385	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1516	Open in IMG/M
3300004114\|Ga0062593_102314972	All Organisms → cellular organisms → Bacteria → Proteobacteria	604	Open in IMG/M
3300004145\|Ga0055489_10057371	Not Available	1056	Open in IMG/M
3300004156\|Ga0062589_101190511	All Organisms → cellular organisms → Bacteria → Proteobacteria	728	Open in IMG/M
3300004463\|Ga0063356_100308937	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1966	Open in IMG/M
3300004463\|Ga0063356_102615631	All Organisms → cellular organisms → Bacteria → Proteobacteria	775	Open in IMG/M
3300004463\|Ga0063356_102737468	All Organisms → cellular organisms → Bacteria	759	Open in IMG/M
3300004463\|Ga0063356_105031839	All Organisms → cellular organisms → Bacteria → Proteobacteria	568	Open in IMG/M
3300004463\|Ga0063356_105205327	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	559	Open in IMG/M
3300004480\|Ga0062592_102228038	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300004643\|Ga0062591_100255663	All Organisms → cellular organisms → Bacteria → Proteobacteria	1340	Open in IMG/M
3300005289\|Ga0065704_10289015	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	907	Open in IMG/M
3300005295\|Ga0065707_10002536	All Organisms → cellular organisms → Bacteria	6967	Open in IMG/M
3300005295\|Ga0065707_10982561	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	544	Open in IMG/M
3300005332\|Ga0066388_100075827	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM2793	3701	Open in IMG/M
3300005332\|Ga0066388_102681106	All Organisms → cellular organisms → Bacteria → Proteobacteria	909	Open in IMG/M
3300005332\|Ga0066388_102803213	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	890	Open in IMG/M
3300005332\|Ga0066388_103483996	All Organisms → cellular organisms → Bacteria	803	Open in IMG/M
3300005332\|Ga0066388_104467644	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	712	Open in IMG/M
3300005332\|Ga0066388_104558852	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	705	Open in IMG/M
3300005336\|Ga0070680_101061539	All Organisms → cellular organisms → Bacteria → Proteobacteria	700	Open in IMG/M
3300005339\|Ga0070660_101852506	All Organisms → cellular organisms → Bacteria → Proteobacteria	514	Open in IMG/M
3300005445\|Ga0070708_101255072	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	692	Open in IMG/M
3300005457\|Ga0070662_101170734	All Organisms → cellular organisms → Bacteria → Proteobacteria	660	Open in IMG/M
3300005468\|Ga0070707_100125669	All Organisms → cellular organisms → Bacteria	2492	Open in IMG/M
3300005555\|Ga0066692_10568965	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300005559\|Ga0066700_10366560	All Organisms → cellular organisms → Bacteria	1017	Open in IMG/M
3300005713\|Ga0066905_101774913	Not Available	568	Open in IMG/M
3300005713\|Ga0066905_101809753	All Organisms → cellular organisms → Bacteria → Proteobacteria	563	Open in IMG/M
3300005764\|Ga0066903_103999635	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	790	Open in IMG/M
3300005764\|Ga0066903_105965025	All Organisms → cellular organisms → Bacteria → Proteobacteria	638	Open in IMG/M
3300005937\|Ga0081455_10088282	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2520	Open in IMG/M
3300005981\|Ga0081538_10116914	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1292	Open in IMG/M
3300005981\|Ga0081538_10195952	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300006049\|Ga0075417_10002501	All Organisms → cellular organisms → Bacteria	5551	Open in IMG/M
3300006844\|Ga0075428_102690786	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300006845\|Ga0075421_100022900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7866	Open in IMG/M
3300006845\|Ga0075421_101522902	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	731	Open in IMG/M
3300006845\|Ga0075421_102694232	All Organisms → cellular organisms → Bacteria → Proteobacteria	514	Open in IMG/M
3300006845\|Ga0075421_102740557	All Organisms → cellular organisms → Bacteria → Proteobacteria	509	Open in IMG/M
3300006846\|Ga0075430_100534054	All Organisms → cellular organisms → Bacteria → Proteobacteria	967	Open in IMG/M
3300006847\|Ga0075431_100653727	All Organisms → cellular organisms → Bacteria → Proteobacteria	1031	Open in IMG/M
3300006852\|Ga0075433_10404957	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1203	Open in IMG/M
3300006853\|Ga0075420_100293529	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1411	Open in IMG/M
3300006865\|Ga0073934_10122795	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1912	Open in IMG/M
3300006876\|Ga0079217_10174792	All Organisms → cellular organisms → Bacteria	1069	Open in IMG/M
3300006876\|Ga0079217_11201275	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	577	Open in IMG/M
3300006894\|Ga0079215_10037042	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1796	Open in IMG/M
3300006918\|Ga0079216_10145611	All Organisms → cellular organisms → Bacteria → Proteobacteria	1226	Open in IMG/M
3300006969\|Ga0075419_10330548	All Organisms → cellular organisms → Bacteria → Proteobacteria	1033	Open in IMG/M
3300007004\|Ga0079218_10565520	All Organisms → cellular organisms → Bacteria	1027	Open in IMG/M
3300007004\|Ga0079218_12437769	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	616	Open in IMG/M
3300009078\|Ga0105106_10089860	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2260	Open in IMG/M
3300009081\|Ga0105098_10090740	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1307	Open in IMG/M
3300009087\|Ga0105107_10284782	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1153	Open in IMG/M
3300009100\|Ga0075418_12394547	All Organisms → cellular organisms → Bacteria → Proteobacteria	576	Open in IMG/M
3300009137\|Ga0066709_101195374	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1119	Open in IMG/M
3300009157\|Ga0105092_10013103	All Organisms → cellular organisms → Bacteria	4354	Open in IMG/M
3300009157\|Ga0105092_10015772	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3968	Open in IMG/M
3300009157\|Ga0105092_10219881	All Organisms → cellular organisms → Bacteria	1063	Open in IMG/M
3300009157\|Ga0105092_10283411	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	933	Open in IMG/M
3300009157\|Ga0105092_10871550	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300009162\|Ga0075423_10698537	All Organisms → cellular organisms → Bacteria → Proteobacteria	1071	Open in IMG/M
3300009610\|Ga0105340_1114209	All Organisms → cellular organisms → Bacteria	1093	Open in IMG/M
3300009610\|Ga0105340_1145512	All Organisms → cellular organisms → Bacteria → Proteobacteria	975	Open in IMG/M
3300009610\|Ga0105340_1398410	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	613	Open in IMG/M
3300009807\|Ga0105061_1000289	All Organisms → cellular organisms → Bacteria	4174	Open in IMG/M
3300009811\|Ga0105084_1001443	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2714	Open in IMG/M
3300009815\|Ga0105070_1010832	All Organisms → cellular organisms → Bacteria	1505	Open in IMG/M
3300009821\|Ga0105064_1039045	All Organisms → cellular organisms → Bacteria	900	Open in IMG/M
3300010037\|Ga0126304_10948088	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300010043\|Ga0126380_11635154	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300010047\|Ga0126382_10339079	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1146	Open in IMG/M
3300010047\|Ga0126382_10895949	All Organisms → cellular organisms → Bacteria → Proteobacteria	767	Open in IMG/M
3300010359\|Ga0126376_12122016	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	606	Open in IMG/M
3300010359\|Ga0126376_12297964	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	585	Open in IMG/M
3300010376\|Ga0126381_102225799	All Organisms → cellular organisms → Bacteria	788	Open in IMG/M
3300010376\|Ga0126381_103683850	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300010398\|Ga0126383_12116500	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300010399\|Ga0134127_10152183	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2102	Open in IMG/M
3300010400\|Ga0134122_10630778	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	995	Open in IMG/M
3300011405\|Ga0137340_1022087	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1169	Open in IMG/M
3300011414\|Ga0137442_1106478	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	613	Open in IMG/M
3300011430\|Ga0137423_1051835	Not Available	1223	Open in IMG/M
3300011437\|Ga0137429_1129489	All Organisms → cellular organisms → Bacteria → Proteobacteria	777	Open in IMG/M
3300011438\|Ga0137451_1186542	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	657	Open in IMG/M
3300012143\|Ga0137354_1034024	All Organisms → cellular organisms → Bacteria → Proteobacteria	794	Open in IMG/M
3300012146\|Ga0137322_1064352	All Organisms → cellular organisms → Bacteria → Proteobacteria	563	Open in IMG/M
3300012204\|Ga0137374_11090311	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300012208\|Ga0137376_10094856	All Organisms → cellular organisms → Bacteria → Proteobacteria	2521	Open in IMG/M
3300012353\|Ga0137367_10232593	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1328	Open in IMG/M
3300012361\|Ga0137360_10012566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5442	Open in IMG/M
3300012941\|Ga0162652_100074792	All Organisms → cellular organisms → Bacteria → Proteobacteria	582	Open in IMG/M
3300012944\|Ga0137410_10262697	All Organisms → cellular organisms → Bacteria → Proteobacteria	1356	Open in IMG/M
3300012957\|Ga0164303_11152660	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300014268\|Ga0075309_1018281	All Organisms → cellular organisms → Bacteria → Proteobacteria	1485	Open in IMG/M
3300014320\|Ga0075342_1193074	Not Available	572	Open in IMG/M
3300014865\|Ga0180078_1082469	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300014877\|Ga0180074_1006907	All Organisms → cellular organisms → Bacteria	2018	Open in IMG/M
3300014883\|Ga0180086_1153168	Not Available	600	Open in IMG/M
3300014884\|Ga0180104_1030667	Not Available	1379	Open in IMG/M
3300014884\|Ga0180104_1045926	All Organisms → cellular organisms → Bacteria	1160	Open in IMG/M
3300014885\|Ga0180063_1144932	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	748	Open in IMG/M
3300015252\|Ga0180075_1095361	Not Available	529	Open in IMG/M
3300015255\|Ga0180077_1011904	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1466	Open in IMG/M
3300015372\|Ga0132256_100050088	All Organisms → cellular organisms → Bacteria	3878	Open in IMG/M
3300015373\|Ga0132257_100005125	All Organisms → cellular organisms → Bacteria	12501	Open in IMG/M
3300015374\|Ga0132255_100107330	All Organisms → cellular organisms → Bacteria	3807	Open in IMG/M
3300015374\|Ga0132255_105541261	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	534	Open in IMG/M
3300016357\|Ga0182032_10139545	All Organisms → cellular organisms → Bacteria	1777	Open in IMG/M
3300018052\|Ga0184638_1011171	All Organisms → cellular organisms → Bacteria	3043	Open in IMG/M
3300018053\|Ga0184626_10002951	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6273	Open in IMG/M
3300018053\|Ga0184626_10123015	All Organisms → cellular organisms → Bacteria → Proteobacteria	1102	Open in IMG/M
3300018053\|Ga0184626_10408299	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300018056\|Ga0184623_10057538	All Organisms → cellular organisms → Bacteria	1780	Open in IMG/M
3300018059\|Ga0184615_10106548	All Organisms → cellular organisms → Bacteria	1578	Open in IMG/M
3300018072\|Ga0184635_10010380	All Organisms → cellular organisms → Bacteria	3232	Open in IMG/M
3300018075\|Ga0184632_10006689	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	4800	Open in IMG/M
3300018075\|Ga0184632_10177966	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	938	Open in IMG/M
3300018075\|Ga0184632_10412056	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300018081\|Ga0184625_10189514	All Organisms → cellular organisms → Bacteria → Proteobacteria	1078	Open in IMG/M
3300018084\|Ga0184629_10131379	Not Available	1256	Open in IMG/M
3300018422\|Ga0190265_10029915	All Organisms → cellular organisms → Bacteria	4505	Open in IMG/M
3300018422\|Ga0190265_10032799	All Organisms → cellular organisms → Bacteria	4342	Open in IMG/M
3300018422\|Ga0190265_10365767	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1532	Open in IMG/M
3300018422\|Ga0190265_10373342	All Organisms → cellular organisms → Bacteria	1518	Open in IMG/M
3300018422\|Ga0190265_11757414	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	729	Open in IMG/M
3300018422\|Ga0190265_11955367	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	692	Open in IMG/M
3300018422\|Ga0190265_12670035	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	596	Open in IMG/M
3300018422\|Ga0190265_12673188	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300018422\|Ga0190265_13600755	Not Available	517	Open in IMG/M
3300018429\|Ga0190272_11537613	All Organisms → cellular organisms → Bacteria → Proteobacteria	678	Open in IMG/M
3300018432\|Ga0190275_12477359	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300018432\|Ga0190275_13329103	All Organisms → cellular organisms → Bacteria → Proteobacteria	520	Open in IMG/M
3300018433\|Ga0066667_10739500	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	829	Open in IMG/M
3300019377\|Ga0190264_10328186	All Organisms → cellular organisms → Bacteria → Proteobacteria	946	Open in IMG/M
3300019789\|Ga0137408_1152603	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1718	Open in IMG/M
3300019886\|Ga0193727_1041027	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1535	Open in IMG/M
3300021081\|Ga0210379_10210429	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia	839	Open in IMG/M
3300021344\|Ga0193719_10402770	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300025324\|Ga0209640_10000238	All Organisms → cellular organisms → Bacteria	40956	Open in IMG/M
3300025559\|Ga0210087_1000942	All Organisms → cellular organisms → Bacteria	6427	Open in IMG/M
3300025792\|Ga0210143_1079449	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300025917\|Ga0207660_10694454	All Organisms → cellular organisms → Bacteria → Proteobacteria	830	Open in IMG/M
3300025922\|Ga0207646_10621899	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300025933\|Ga0207706_10770328	All Organisms → cellular organisms → Bacteria → Proteobacteria	819	Open in IMG/M
3300026037\|Ga0208655_1007213	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	879	Open in IMG/M
3300026090\|Ga0208912_1030120	Not Available	786	Open in IMG/M
3300026535\|Ga0256867_10021958	All Organisms → cellular organisms → Bacteria → Proteobacteria	2721	Open in IMG/M
3300027056\|Ga0209879_1026818	All Organisms → cellular organisms → Bacteria	956	Open in IMG/M
3300027209\|Ga0209875_1002908	All Organisms → cellular organisms → Bacteria	2141	Open in IMG/M
3300027209\|Ga0209875_1004611	All Organisms → cellular organisms → Bacteria	1681	Open in IMG/M
3300027561\|Ga0209887_1067213	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	751	Open in IMG/M
3300027577\|Ga0209874_1000158	All Organisms → cellular organisms → Bacteria	17885	Open in IMG/M
3300027617\|Ga0210002_1014818	All Organisms → cellular organisms → Bacteria → Proteobacteria	1226	Open in IMG/M
3300027637\|Ga0209818_1029429	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1243	Open in IMG/M
3300027646\|Ga0209466_1009422	All Organisms → cellular organisms → Bacteria	2068	Open in IMG/M
3300027647\|Ga0214468_1187983	All Organisms → cellular organisms → Bacteria → Proteobacteria	515	Open in IMG/M
3300027650\|Ga0256866_1158291	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300027654\|Ga0209799_1021705	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1408	Open in IMG/M
3300027691\|Ga0209485_1072139	All Organisms → cellular organisms → Bacteria → Proteobacteria	927	Open in IMG/M
3300027695\|Ga0209966_1015986	All Organisms → cellular organisms → Bacteria	1415	Open in IMG/M
3300027722\|Ga0209819_10001123	All Organisms → cellular organisms → Bacteria → Proteobacteria	8145	Open in IMG/M
3300027722\|Ga0209819_10101734	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1003	Open in IMG/M
3300027873\|Ga0209814_10007159	All Organisms → cellular organisms → Bacteria	4321	Open in IMG/M
3300027886\|Ga0209486_10584442	All Organisms → cellular organisms → Bacteria → Proteobacteria	706	Open in IMG/M
3300027909\|Ga0209382_10460227	All Organisms → cellular organisms → Bacteria → Proteobacteria	1407	Open in IMG/M
3300027909\|Ga0209382_12201934	All Organisms → cellular organisms → Bacteria → Proteobacteria	521	Open in IMG/M
3300027957\|Ga0209857_1000054	All Organisms → cellular organisms → Bacteria	22488	Open in IMG/M
3300027991\|Ga0247683_1021518	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	576	Open in IMG/M
3300028889\|Ga0247827_11076803	All Organisms → cellular organisms → Bacteria → Proteobacteria	551	Open in IMG/M
3300030606\|Ga0299906_10029907	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	4357	Open in IMG/M
3300030606\|Ga0299906_10834739	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300030619\|Ga0268386_10612381	All Organisms → cellular organisms → Bacteria → Proteobacteria	725	Open in IMG/M
3300031229\|Ga0299913_10736225	All Organisms → cellular organisms → Bacteria → Proteobacteria	962	Open in IMG/M
3300031720\|Ga0307469_11022644	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300031731\|Ga0307405_10264307	All Organisms → cellular organisms → Bacteria → Proteobacteria	1287	Open in IMG/M
3300031820\|Ga0307473_11196437	All Organisms → cellular organisms → Bacteria → Proteobacteria	564	Open in IMG/M
3300031824\|Ga0307413_10516457	All Organisms → cellular organisms → Bacteria → Proteobacteria	962	Open in IMG/M
3300031890\|Ga0306925_10405944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1460	Open in IMG/M
3300031910\|Ga0306923_11561477	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300032004\|Ga0307414_10948770	All Organisms → cellular organisms → Bacteria	790	Open in IMG/M
3300032005\|Ga0307411_11729733	All Organisms → cellular organisms → Bacteria → Proteobacteria	579	Open in IMG/M
3300032012\|Ga0310902_11131781	All Organisms → cellular organisms → Bacteria → Proteobacteria	549	Open in IMG/M
3300032076\|Ga0306924_10937944	All Organisms → cellular organisms → Bacteria	955	Open in IMG/M
3300032829\|Ga0335070_10170171	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2195	Open in IMG/M
3300033417\|Ga0214471_10135121	All Organisms → cellular organisms → Bacteria	2032	Open in IMG/M
3300033551\|Ga0247830_10077993	All Organisms → cellular organisms → Bacteria	2271	Open in IMG/M
3300034115\|Ga0364945_0145370	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300034148\|Ga0364927_0004000	All Organisms → cellular organisms → Bacteria	2761	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.68%
Host-Associated	Host-Associated	18.84%
Engineered	Engineered	0.48%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	54.59%
Aquatic	Environmental → Aquatic	26.09%
Plants	Host-Associated → Plants	18.84%
Solid Waste	Engineered → Solid Waste	0.48%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	53.14%
Sediment	Environmental → Aquatic → Sediment	14.49%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.59%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.28%
Marine	Environmental → Aquatic → Marine	5.80%
Freshwater	Environmental → Aquatic → Freshwater	5.31%
Floodplain	Environmental → Terrestrial → Floodplain	0.97%
Roots	Host-Associated → Plants → Roots	0.97%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.48%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.48%
Grass	Engineered → Solid Waste → Grass	0.48%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.71%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	14.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.66%
Loam	Environmental → Terrestrial → Soil → Loam	9.18%
Wetlands	Environmental → Aquatic → Marine → Wetlands	5.80%
Sediment	Environmental → Aquatic → Freshwater → Sediment	5.31%
Sand	Environmental → Terrestrial → Soil → Sand	4.83%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.35%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.93%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.93%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.97%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.97%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	0.48%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.48%
Composting	Engineered → Solid Waste → Grass → Composting	0.48%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.32%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	14.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.66%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.76%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	5.80%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.80%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	5.31%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	4.83%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.35%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.35%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.38%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.93%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.45%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.45%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.97%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.97%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	0.48%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.48%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.48%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.48%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.48%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.14%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	8.70%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.73%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	5.80%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	5.80%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.80%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	4.83%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	4.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.35%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.38%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	3.38%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.93%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.93%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.45%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.45%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.45%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.97%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.97%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.97%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.97%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.97%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.97%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.97%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.97%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.48%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	0.48%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.48%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.48%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.48%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.48%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.48%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.48%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.48%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090015	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
2140918013	Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)	Environmental	Open in IMG/M
2170459016	Litter degradation ZMR2	Engineered	Open in IMG/M
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300003987	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2	Environmental	Open in IMG/M
3300003992	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1	Environmental	Open in IMG/M
3300003995	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2	Environmental	Open in IMG/M
3300003996	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2	Environmental	Open in IMG/M
3300003997	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1	Environmental	Open in IMG/M
3300003999	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2	Environmental	Open in IMG/M
3300004013	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2	Environmental	Open in IMG/M
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004145	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009807	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10	Environmental	Open in IMG/M
3300009811	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30	Environmental	Open in IMG/M
3300009815	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10	Environmental	Open in IMG/M
3300009821	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011405	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2	Environmental	Open in IMG/M
3300011414	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300011437	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2	Environmental	Open in IMG/M
3300011438	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2	Environmental	Open in IMG/M
3300012143	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2	Environmental	Open in IMG/M
3300012146	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012941	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300014268	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1	Environmental	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300014865	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D	Environmental	Open in IMG/M
3300014877	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D	Environmental	Open in IMG/M
3300014883	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D	Environmental	Open in IMG/M
3300014884	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da	Environmental	Open in IMG/M
3300014885	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D	Environmental	Open in IMG/M
3300015252	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D	Environmental	Open in IMG/M
3300015255	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300019886	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025559	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025792	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026037	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026090	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental	Open in IMG/M
3300027056	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027209	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)	Environmental	Open in IMG/M
3300027561	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)	Environmental	Open in IMG/M
3300027577	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027647	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq	Environmental	Open in IMG/M
3300027650	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq	Environmental	Open in IMG/M
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)	Host-Associated	Open in IMG/M
3300027722	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027957	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)	Environmental	Open in IMG/M
3300027991	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300030606	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125	Environmental	Open in IMG/M
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300033417	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental	Open in IMG/M
3300034148	Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPICI_00374060	2088090015	Soil	MSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS
Iowa-Corn-GraphCirc_03519950	2140918013	Soil	MSQTDWAKIYAAMDMRVALKYQQLPKGEQIGKSPPQKTQTRAS
Iowa-Corn-GraphCirc_01123950	2140918013	Soil	MSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSQTKSA
2ZMR_03304350	2170459016	Switchgrass, Maize And Mischanthus Litter	MSQTDWAKIYAAMDKRLGLKYEQLPKGEQIGKWPQSETSQMKTS
INPgaii200_12099472	2228664022	Soil	MSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQTGNQQIKSS
F14TC_1001142371	3300000559	Soil	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKIS*
JGI1027J11758_130405542	3300000789	Soil	MSXPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS*
JGI25405J52794_100025662	3300003911	Tabebuia Heterophylla Rhizosphere	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0055471_100047373	3300003987	Natural And Restored Wetlands	MNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS*
Ga0055470_100090791	3300003992	Natural And Restored Wetlands	SMNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS*
Ga0055438_100844132	3300003995	Natural And Restored Wetlands	MSQIDWAKIYAAMDLRIVLKYEQLPEGEQVGKRPQAKNQPVKSS*
Ga0055467_100045044	3300003996	Natural And Restored Wetlands	IKSMNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS*
Ga0055466_100218782	3300003997	Natural And Restored Wetlands	MKQIDWAKIYASMDKRVTLKYQQLPSGEQVGKAQPQPTPAEKSF*
Ga0055469_102764521	3300003999	Natural And Restored Wetlands	MKAMDWAKIYAAMDKRIEVKYKQLPTGEQIGKKAYSGSSPAKKP*
Ga0055465_101989311	3300004013	Natural And Restored Wetlands	MDQNDWAKKYAAMDKRIEWKYEQLPVGEQVGKRPEAVDASERSSVTKDSAR*
Ga0055490_101877571	3300004052	Natural And Restored Wetlands	SQTDWAKLYSQMDKRIVVKYEQLPKGEQIGKRPPTGNQQAKPPARPATS*
Ga0055490_102355222	3300004052	Natural And Restored Wetlands	MSQTDWAKKYAAMDKRIVLKYERLPRGEQIGKRPPAGKAQERAS*
Ga0062593_1002273852	3300004114	Soil	MSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSRTKSA*
Ga0062593_1023149722	3300004114	Soil	MSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS*
Ga0055489_100573712	3300004145	Natural And Restored Wetlands	MSQTDWAKIYGEMDKRIIVKYEQLPQGEQVGKRPHPGAQQTKNS*
Ga0062589_1011905112	3300004156	Soil	MSQTDWAKIYAAMDMRVALKYQQLPKGEQIGKSPPQKTQTRAS*
Ga0063356_1003089372	3300004463	Arabidopsis Thaliana Rhizosphere	MSQTDWAKIYAAMDKRVELKYQHLPKGEQFGKPPVPNGQSRSS*
Ga0063356_1026156312	3300004463	Arabidopsis Thaliana Rhizosphere	MTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGNQGEKMP*
Ga0063356_1027374681	3300004463	Arabidopsis Thaliana Rhizosphere	GSMSQTDWAKTYATMDKRIILKYEQLPRGEQIGKPAQTGTQDKGKS*
Ga0063356_1050318391	3300004463	Arabidopsis Thaliana Rhizosphere	MSQTDWAKIYAAMDKRLELKYEQLPKGEQIGKRPQPKTSQTKIS*
Ga0063356_1052053272	3300004463	Arabidopsis Thaliana Rhizosphere	QTDWAKIYAAMDKRIELKYEQLPRGEQIGRRPPQKNRPRPS*
Ga0062592_1022280381	3300004480	Soil	SQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS*
Ga0062591_1002556631	3300004643	Soil	MSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKR
Ga0065704_102890152	3300005289	Switchgrass Rhizosphere	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAEKQQAKSS*
Ga0065707_100025366	3300005295	Switchgrass Rhizosphere	MSQIDWAKIYAAMDKRVELKYQQLPKGEQIGKRSPEKNQPRPS*
Ga0065707_109825611	3300005295	Switchgrass Rhizosphere	GHLNIEGERAMSQTDWAKIYAAMDKRIELKYQQLPKGEQIGKRPAQKNQPRPA*
Ga0066388_1000758272	3300005332	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQAKAS*
Ga0066388_1026811062	3300005332	Tropical Forest Soil	MNQIDWAKIYAEMDKRIVVKYEQLPNGEQIGKRTQAGNCQAKNS*
Ga0066388_1028032132	3300005332	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPNGEQIGKRPPTGKPQVKSS*
Ga0066388_1034839963	3300005332	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*AIIFATTKGEF
Ga0066388_1044676441	3300005332	Tropical Forest Soil	LQMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETEQVKAS*
Ga0066388_1045588521	3300005332	Tropical Forest Soil	PREVLQMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPPAETQQAKAS*
Ga0070680_1010615392	3300005336	Corn Rhizosphere	MSQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS*
Ga0070660_1018525062	3300005339	Corn Rhizosphere	MSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPNAGSQHEKKS*
Ga0070708_1012550722	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQAGNQQIKSS*
Ga0070662_1011707342	3300005457	Corn Rhizosphere	MSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS*
Ga0070707_1001256691	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MIKPDWAKIYAEMDNRIIVKYEQLPNGEQIGKRPQAGNNK*
Ga0066692_105689652	3300005555	Soil	MSQTDWAKIYAEMDKRIIVKYEHLPNGEQLGKRPQAGSQQIKSS*
Ga0066700_103665602	3300005559	Soil	MNQTDWAKIYAEMDKRIIVKYEHLPNGEQLGKRPQAGSQQIKSS*
Ga0066905_1017749131	3300005713	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQVKAS*
Ga0066905_1018097531	3300005713	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQ
Ga0066903_1039996351	3300005764	Tropical Forest Soil	AKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0066903_1059650252	3300005764	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGEQPEKNS*
Ga0081455_100882821	3300005937	Tabebuia Heterophylla Rhizosphere	MSATDWAKIYAKMDKRIVVKYEQLPNGEQVGKRPQAGQQAKKP*
Ga0081538_101169143	3300005981	Tabebuia Heterophylla Rhizosphere	MSQTDWAKIYAEMDKRIIVKYEQLPKGEQIGNRTQAETNK*
Ga0081538_101959522	3300005981	Tabebuia Heterophylla Rhizosphere	MSETDWAKIYAEMDKRIIVKYEQLPNGEQVGKRPQPRKGS*
Ga0075417_100025018	3300006049	Populus Rhizosphere	MSETDWAKIYAKMDERIVVKYEHLPKGEQIGKRPQAGNQQAKIS*
Ga0075428_1026907861	3300006844	Populus Rhizosphere	GLMSQTDWAKAYAAMDERIILKYEQLPRGEQISKALQAGSKDEKKS*
Ga0075421_1000229005	3300006845	Populus Rhizosphere	MSQTDWAKIYAAMGMRVALKYQQLPKGEQIGKSPPQKTQTRAS*
Ga0075421_1015229021	3300006845	Populus Rhizosphere	MSQTDWAKIYAAMDKRVILKYAQLPKGEQIGKRPAQQTQTKPS*
Ga0075421_1026942322	3300006845	Populus Rhizosphere	MSQTDWAKIYAAMDKRVVLKYAQLPKGEQIGKRPAQENAQAKAS*
Ga0075421_1027405571	3300006845	Populus Rhizosphere	MSQTDWAKAYAAMDERIILKYEQLPRGEQIGKALQAGSKDEKKS*
Ga0075430_1005340542	3300006846	Populus Rhizosphere	MSQIDWAKAYAAMDARIILKYERLPRGEQIGKAPQAGSQDEKKS*
Ga0075431_1006537272	3300006847	Populus Rhizosphere	MSQTDWAKAYAAMDVRIILKYEQLPRGEQIGKAPRAGSKDEKKS*
Ga0075433_104049572	3300006852	Populus Rhizosphere	MSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS*
Ga0075420_1002935292	3300006853	Populus Rhizosphere	MSETDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQAGNQQAKIS*
Ga0073934_101227953	3300006865	Hot Spring Sediment	MSQTDWAKLYAAMDARITLKYQQLPKGEQIGKRPQQQSKAS*
Ga0079217_101747922	3300006876	Agricultural Soil	MSQTDWAKAYAAMDERIILKYERLPRGEQIGKAPQAGSQDEKKS*
Ga0079217_112012752	3300006876	Agricultural Soil	MSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKQDLL*
Ga0079215_100370423	3300006894	Agricultural Soil	MSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKARPSLRNLWV*
Ga0079216_101456112	3300006918	Agricultural Soil	MSQTDWAKIYAVMDKRVELKYAQLPKGEQIGARPAQVKAQVKNLSG*
Ga0075419_103305482	3300006969	Populus Rhizosphere	MSQIDWAKAYAAMDARIILKYERLPRGEQIGKALQAGSKDEKKS*
Ga0079218_105655203	3300007004	Agricultural Soil	MTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGHEGEKMP*
Ga0079218_124377692	3300007004	Agricultural Soil	MSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPAQVKAQVKKS*
Ga0105106_100898601	3300009078	Freshwater Sediment	MSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEQKAF*
Ga0105098_100907402	3300009081	Freshwater Sediment	MSQTDWAKIYAEMDKRILVKYEQLPKGEQVGKPSPSEKNS*
Ga0105107_102847822	3300009087	Freshwater Sediment	MSQTDWAKIYAAMDKRLDLKYEQLPKGEQIGKRPQPKTSQTKIS*
Ga0075418_123945472	3300009100	Populus Rhizosphere	MSETDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQA
Ga0066709_1011953741	3300009137	Grasslands Soil	REVLQMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS*
Ga0105092_100131035	3300009157	Freshwater Sediment	MSQIDWAKIYAKMDKRILVKYEQLPNGEQIGKRPQTGNQQAKSS*
Ga0105092_100157724	3300009157	Freshwater Sediment	MSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKRPEKESKSA*
Ga0105092_102198813	3300009157	Freshwater Sediment	MSATDWAKIYAEMDKRIIVKYEQLPNGEQAGKRPQAGQQAKKP*
Ga0105092_102834112	3300009157	Freshwater Sediment	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPPAEKQQAKSS*
Ga0105092_108715501	3300009157	Freshwater Sediment	MSQTDWAKIYAAMDKRIAVKYEQLPNGEQIGKRPQAENQQAKSS*
Ga0075423_106985371	3300009162	Populus Rhizosphere	MSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAGNQQAKIS*
Ga0105340_11142092	3300009610	Soil	MSQTDWAKTYAAMDNRIVLKYEQLPNGEQIGKRPQPESQPAKIPEGE*
Ga0105340_11455122	3300009610	Soil	MSQTDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS*
Ga0105340_13984102	3300009610	Soil	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGKQQAKSS*
Ga0105061_10002895	3300009807	Groundwater Sand	MSERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS*
Ga0105084_10014433	3300009811	Groundwater Sand	MCQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES*
Ga0105070_10108322	3300009815	Groundwater Sand	MRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES*
Ga0105064_10390452	3300009821	Groundwater Sand	MSERDWAKIYALMDKRIVVKYEQLPNGEQIGKRPQAGNQPAKSS*
Ga0126304_109480882	3300010037	Serpentine Soil	MSQTDWAKTYAAMDKRIILKYEQLPRGEQVGNGPQSGSQEEKKSS*
Ga0126380_116351542	3300010043	Tropical Forest Soil	MSQIDWAKVYAEMDKRIVVKYEQLPKGEQIGKRPPAGNQPASPS*
Ga0126382_103390791	3300010047	Tropical Forest Soil	IYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0126382_108959491	3300010047	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLANGEQIGKRPPAGNEPVKAS*
Ga0126376_121220161	3300010359	Tropical Forest Soil	IDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0126376_122979642	3300010359	Tropical Forest Soil	MSQLDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQAKAS*
Ga0126381_1022257992	3300010376	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPPAGNQQANPS*
Ga0126381_1036838501	3300010376	Tropical Forest Soil	MSQIDWAKIYAKMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0126383_121165002	3300010398	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAEPQQVKDS*
Ga0134127_101521832	3300010399	Terrestrial Soil	MNQTDWAKIYAAMDKRIELKYEQLPKGEQIGRRPPQKNQPRPS*
Ga0134122_106307782	3300010400	Terrestrial Soil	SQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS*
Ga0137340_10220872	3300011405	Soil	MSQTDWAKIYAAMDKRIVVKYQQLPKGEQIGKRPPPGNQQGKNS*
Ga0137442_11064782	3300011414	Soil	MSQVDWAKKYAVMDKRLMLKYEQLPKGEQIGKKPTP
Ga0137423_10518352	3300011430	Soil	MSQTDWAKLYAAMDKRITLKYEQLPKGEQIGKGPEKERKNA*
Ga0137429_11294891	3300011437	Soil	MSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGEAPGTRK
Ga0137451_11865422	3300011438	Soil	MSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKQPELLQQNSNKPSQA*
Ga0137354_10340241	3300012143	Soil	MSQTDWAKIYAAMDKRIVVKYQQLPKGEQIGKRPPPGNQQGKN
Ga0137322_10643521	3300012146	Soil	MSQTDWAKIYAAMDKRIELKYEQLPKGEQIGKRQPQKNQPRPA*
Ga0137374_110903111	3300012204	Vadose Zone Soil	MSQTDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQAGNQQAKSS*
Ga0137376_100948562	3300012208	Vadose Zone Soil	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS*
Ga0137367_102325932	3300012353	Vadose Zone Soil	MSQTDWAKIYAKMDERIVVKYEQLPKGEQIGRRPQAGNRQAKSS*
Ga0137360_100125662	3300012361	Vadose Zone Soil	MSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQTGNQQIKSS*
Ga0162652_1000747922	3300012941	Soil	MSQPDWAKIYAKMDKRIVVKYEQLPRGEQIGKRPQAETQQAKSS*
Ga0137410_102626973	3300012944	Vadose Zone Soil	MSETDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS*
Ga0164303_111526601	3300012957	Soil	QPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS*
Ga0075309_10182812	3300014268	Natural And Restored Wetlands	MSQIDWAKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP*
Ga0075342_11930741	3300014320	Natural And Restored Wetlands	MSRTDWAKLYSQMDKRIVVKYEQLPKGEQIGKRPPTGNQQAKPPARPATS*
Ga0180078_10824691	3300014865	Soil	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGTQQAKSS*
Ga0180074_10069071	3300014877	Soil	MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKDV*
Ga0180086_11531681	3300014883	Soil	MTQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQSEKESKSS*
Ga0180104_10306671	3300014884	Soil	MSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKRPEKERKPA*
Ga0180104_10459263	3300014884	Soil	MSQSDWAKLYAAVDKRIILKYQQLPKGEQIGKRPEKESKSA*
Ga0180063_11449322	3300014885	Soil	MSQTDWSKKYAEMDKRIVLKYERLPNGEQIGKRPQTGKAEEKAS*
Ga0180075_10953611	3300015252	Soil	MRRGGLLVSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQPEKERKDV*
Ga0180077_10119043	3300015255	Soil	MSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKQLEKESKSS*
Ga0132256_1000500885	3300015372	Arabidopsis Rhizosphere	QSDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPVAGHQQTKSS*
Ga0132257_1000051257	3300015373	Arabidopsis Rhizosphere	MSQSDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPVAGHQQTKSS*
Ga0132255_1001073301	3300015374	Arabidopsis Rhizosphere	MSQTDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPQA
Ga0132255_1055412612	3300015374	Arabidopsis Rhizosphere	MSQTDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPQAGYQQAKNS*
Ga0182032_101395451	3300016357	Soil	MNKPDWAKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS
Ga0184638_10111711	3300018052	Groundwater Sediment	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS
Ga0184626_100029516	3300018053	Groundwater Sediment	MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKPA
Ga0184626_101230152	3300018053	Groundwater Sediment	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAKNQQAKSS
Ga0184626_104082992	3300018053	Groundwater Sediment	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAENQQAKSS
Ga0184623_100575382	3300018056	Groundwater Sediment	MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESKSS
Ga0184615_101065482	3300018059	Groundwater Sediment	MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKDV
Ga0184635_100103805	3300018072	Groundwater Sediment	MSEPDWAKIYAEMDKRILVKYEQLPNGEQIGKRPQAGNQRAKSS
Ga0184632_100066893	3300018075	Groundwater Sediment	MSLRDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKPA
Ga0184632_101779662	3300018075	Groundwater Sediment	VHSTKEVLPMSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS
Ga0184632_104120562	3300018075	Groundwater Sediment	VHSTKEVLPMSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGKRP
Ga0184625_101895142	3300018081	Groundwater Sediment	MSQTDWAKIYAGMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS
Ga0184629_101313792	3300018084	Groundwater Sediment	MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQPQKERKPA
Ga0190265_100299152	3300018422	Soil	MSEIDWAKTYAKMDKRIILKYEQLPQGEQIGKVLQAGSQEAKKS
Ga0190265_100327994	3300018422	Soil	MSQTDWAKTYAVMDERIILKYEELPKGEQIGKAPPAGSQDEKKS
Ga0190265_103657672	3300018422	Soil	MSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKARPSLRNLWV
Ga0190265_103733423	3300018422	Soil	MSQTDWAKTYAKMDKRIILKYEQLPKGEQIGKASQAGSQEAKKS
Ga0190265_117574142	3300018422	Soil	MMSQTDWAKIYAAMDKRVALKYQQLPKGEQIGKRPAQQTQTKPS
Ga0190265_119553672	3300018422	Soil	MSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEEKAS
Ga0190265_126700352	3300018422	Soil	MNQTDWAKIYAAMDKRVVIKYQQLPKGEQIGKRPAQQTQTKPS
Ga0190265_126731881	3300018422	Soil	MSQTDWAKTYAVMDKRITLKYEQLAKGEQIGEAPQTGSQDEKKS
Ga0190265_136007552	3300018422	Soil	MSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQPGKAGEKAS
Ga0190272_115376132	3300018429	Soil	MNQTDWAKIYAAMDKRVVMKYQQLPKGEQIGKRPAQQTQTKPS
Ga0190275_124773591	3300018432	Soil	MTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGNQGEKMP
Ga0190275_133291032	3300018432	Soil	MSQTDWAKTYAKMDKRIILKYEQLPKGEQIGKASQAGS
Ga0066667_107395001	3300018433	Grasslands Soil	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAEKQQAKSS
Ga0190264_103281862	3300019377	Soil	MSQTDWAKTYAAMDKRIILKYQQLPRGEQIGKTSQAGPEAKKT
Ga0137408_11526032	3300019789	Vadose Zone Soil	MSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS
Ga0193727_10410272	3300019886	Soil	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQVGKRPQAGNQQAKSS
Ga0210379_102104292	3300021081	Groundwater Sediment	MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQLEKESKSS
Ga0193719_104027701	3300021344	Soil	FLAPGPREVLLMSQTDWAKIYAKMDKRIVVKYEQLPKGEQVGKRPQAGNQQAKSS
Ga0209640_1000023831	3300025324	Soil	MSQIDWVKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP
Ga0210087_10009422	3300025559	Natural And Restored Wetlands	MNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS
Ga0210143_10794491	3300025792	Natural And Restored Wetlands	MIQTDWAKTYAAMDKRIELKYEQLPKGEQIGKQPQQQTSQTKSS
Ga0207660_106944542	3300025917	Corn Rhizosphere	MSQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS
Ga0207646_106218991	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MIKPDWAKIYAEMDNRIIVKYEQLPNGEQIGKRPQAGNNK
Ga0207706_107703282	3300025933	Corn Rhizosphere	MSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS
Ga0208655_10072132	3300026037	Natural And Restored Wetlands	MGQTDWAKLYAAMDKRIDLKYRQLPEGEQVGKRPEKEEKASESSRS
Ga0208912_10301201	3300026090	Natural And Restored Wetlands	MSPTDWAKTYAAMDNRIELKYQQLPKGEQTGKRPPPPEKR
Ga0256867_100219583	3300026535	Soil	MMSQTDWAKIYAAMDKRIELKYEQLPKGEQIGKRAETERPQGKD
Ga0209879_10268182	3300027056	Groundwater Sand	MSERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS
Ga0209875_10029084	3300027209	Groundwater Sand	ERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS
Ga0209875_10046112	3300027209	Groundwater Sand	MRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES
Ga0209887_10672132	3300027561	Groundwater Sand	MRQTDWAKTYVAMDNRIVLKYEQLPDGEQIGKRPQPES
Ga0209874_100015816	3300027577	Groundwater Sand	MRQTDWAKTNAAMDNRIVFKYEQLPDGEQIRKRPQPES
Ga0210002_10148183	3300027617	Arabidopsis Thaliana Rhizosphere	MSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRE
Ga0209818_10294292	3300027637	Agricultural Soil	MSQTDWAKIYAAMDKRVGLKYAQLRKGEQIGKRPPQQTKQDLL
Ga0209466_10094222	3300027646	Tropical Forest Soil	MSQIDWAKIYAKMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS
Ga0214468_11879831	3300027647	Soil	MSDSDWARIYAQMDKRIVLKYEQLPTGEQIGKRPQAAKEQNQKA
Ga0256866_11582912	3300027650	Soil	VSQTDWAKIYAEMDKRILLKYEQMPKGEQIGKRFQAEGEEAKRS
Ga0209799_10217052	3300027654	Tropical Forest Soil	MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS
Ga0209485_10721391	3300027691	Agricultural Soil	MSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPAQVKAQVKKS
Ga0209966_10159861	3300027695	Arabidopsis Thaliana Rhizosphere	MSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSRTKSA
Ga0209819_100011239	3300027722	Freshwater Sediment	MSQTDWAKIYAEMDKRILVKYEQLPKGEQVGKPSPSEKNS
Ga0209819_101017341	3300027722	Freshwater Sediment	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPPAEKQQAKSS
Ga0209814_100071594	3300027873	Populus Rhizosphere	MSETDWAKIYAKMDERIVVKYEHLPKGEQIGKRPQAGNQQAKIS
Ga0209486_105844421	3300027886	Agricultural Soil	MSQTDWAKAYAAMDERIILKYERLPRGEQIGKAPQAGNQDEKKS
Ga0209382_104602273	3300027909	Populus Rhizosphere	MSQTDWAKAYAAMDVRIILKYEQLPRGEQIGKAPQAGSKDEKKS
Ga0209382_122019341	3300027909	Populus Rhizosphere	MSQTDWAKIYAAMDKRVVLKYAQLPKGEQIGKRPAQENAQAKAS
Ga0209857_10000541	3300027957	Groundwater Sand	MRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQP
Ga0247683_10215181	3300027991	Soil	MSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKQPT
Ga0247827_110768032	3300028889	Soil	MSQTDWAKVYAAMDERIILKYEQLPRGEQIGKALLAGSKDEKKT
Ga0299906_100299073	3300030606	Soil	MSQIDWAKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP
Ga0299906_108347392	3300030606	Soil	DWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESKSS
Ga0268386_106123811	3300030619	Soil	MSESDWARIYAQMDKRIVLKYEQLPMGEQNGKRPQAAK
Ga0299913_107362252	3300031229	Soil	MNQMDWARIYAAMDKRIELKYQQLPQGEQIGKREQPPASQTKSA
Ga0307469_110226442	3300031720	Hardwood Forest Soil	MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAEKQQAKSS
Ga0307405_102643072	3300031731	Rhizosphere	MSQTDWAKTYAAMDGRIILKYEQLPRGEQIGKPPPAGSQGKGKP
Ga0307473_111964372	3300031820	Hardwood Forest Soil	MSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQ
Ga0307413_105164572	3300031824	Rhizosphere	MSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQTGSQNENKS
Ga0306925_104059443	3300031890	Soil	MNKPDWAKIYAEIYKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS
Ga0306923_115614772	3300031910	Soil	MNKPDWAKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNDQVRNS
Ga0307414_109487702	3300032004	Rhizosphere	MSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQAGSQDEKKS
Ga0307411_117297331	3300032005	Rhizosphere	MSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQAGSQNENKS
Ga0310902_111317812	3300032012	Soil	MSQTDWSKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS
Ga0306924_109379442	3300032076	Soil	MNKPDWVKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS
Ga0335070_101701712	3300032829	Soil	MTENFAMSQTDWVKKYAGMDSRITLKYEQLPQGEQIGKRPEVNTCQVKKS
Ga0214471_101351211	3300033417	Soil	MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESK
Ga0247830_100779933	3300033551	Soil	MSQTDWAKVYAAMDERIILKYEQLPRGEQIGKALQAGSKDEKKT
Ga0364945_0145370_409_543	3300034115	Sediment	MSQTDWAKIYAEMDKRIVVKYEQLPKGEQVGKRPQAGNQHAKSS
Ga0364927_0004000_2097_2243	3300034148	Sediment	MRRGGFFMSQTDWAKLYAAMDKRIILKYQQLPKGEQTGKRPEKESKSS

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F024052

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences