| Basic Information | |
|---|---|
| Family ID | F024039 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 207 |
| Average Sequence Length | 45 residues |
| Representative Sequence | NMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 207 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.49 % |
| % of genes near scaffold ends (potentially truncated) | 93.72 % |
| % of genes from short scaffolds (< 2000 bps) | 82.13 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (61.353 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.826 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.285 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 207 Family Scaffolds |
|---|---|---|
| PF13384 | HTH_23 | 22.22 |
| PF04488 | Gly_transf_sug | 7.25 |
| PF12804 | NTP_transf_3 | 5.80 |
| PF00535 | Glycos_transf_2 | 5.31 |
| PF01755 | Glyco_transf_25 | 4.83 |
| PF08241 | Methyltransf_11 | 4.83 |
| PF01583 | APS_kinase | 4.35 |
| PF13489 | Methyltransf_23 | 2.42 |
| PF13578 | Methyltransf_24 | 2.42 |
| PF01135 | PCMT | 2.42 |
| PF13542 | HTH_Tnp_ISL3 | 2.42 |
| PF05050 | Methyltransf_21 | 1.93 |
| PF12705 | PDDEXK_1 | 1.45 |
| PF09834 | DUF2061 | 0.97 |
| PF01467 | CTP_transf_like | 0.97 |
| PF01370 | Epimerase | 0.97 |
| PF00106 | adh_short | 0.48 |
| PF02627 | CMD | 0.48 |
| PF00107 | ADH_zinc_N | 0.48 |
| PF13620 | CarboxypepD_reg | 0.48 |
| PF05575 | V_cholerae_RfbT | 0.48 |
| PF06067 | DUF932 | 0.48 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.48 |
| PF05219 | DREV | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 207 Family Scaffolds |
|---|---|---|---|
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 7.25 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 4.83 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 4.35 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.42 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 2.42 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 2.42 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 2.42 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.48 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.51 % |
| Unclassified | root | N/A | 14.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02GIQG1 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300000756|JGI12421J11937_10013743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3071 | Open in IMG/M |
| 3300001850|RCM37_1086755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1797 | Open in IMG/M |
| 3300001850|RCM37_1172423 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300001851|RCM31_10100690 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300002375|B570J29617_1008317 | Not Available | 601 | Open in IMG/M |
| 3300002408|B570J29032_109497592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300002835|B570J40625_101704380 | Not Available | 512 | Open in IMG/M |
| 3300003499|JGI25930J51415_1080496 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300004054|Ga0063232_10117010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300004125|Ga0066182_10114952 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300004240|Ga0007787_10407307 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005517|Ga0070374_10526407 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005517|Ga0070374_10545874 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005584|Ga0049082_10030276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1891 | Open in IMG/M |
| 3300005584|Ga0049082_10189160 | Not Available | 707 | Open in IMG/M |
| 3300005584|Ga0049082_10190085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300005662|Ga0078894_10371211 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300005662|Ga0078894_10513045 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300005662|Ga0078894_10894015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300005662|Ga0078894_11494701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300005805|Ga0079957_1075542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1927 | Open in IMG/M |
| 3300005805|Ga0079957_1080029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1850 | Open in IMG/M |
| 3300005805|Ga0079957_1150147 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300005805|Ga0079957_1224392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300005940|Ga0073913_10025574 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300007171|Ga0102977_1031345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1670 | Open in IMG/M |
| 3300007177|Ga0102978_1047539 | All Organisms → Viruses → Predicted Viral | 4921 | Open in IMG/M |
| 3300007177|Ga0102978_1058735 | Not Available | 2184 | Open in IMG/M |
| 3300007177|Ga0102978_1086843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1085 | Open in IMG/M |
| 3300007212|Ga0103958_1212339 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300007544|Ga0102861_1173680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300007546|Ga0102874_1080211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1038 | Open in IMG/M |
| 3300007549|Ga0102879_1077716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
| 3300007559|Ga0102828_1189362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300007606|Ga0102923_1067408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
| 3300007634|Ga0102901_1084899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300007637|Ga0102906_1139111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300007639|Ga0102865_1081019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300007649|Ga0102912_1071416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300008108|Ga0114341_10360215 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300008108|Ga0114341_10403534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300008110|Ga0114343_1042771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1800 | Open in IMG/M |
| 3300008110|Ga0114343_1052856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1901 | Open in IMG/M |
| 3300008110|Ga0114343_1076204 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300008110|Ga0114343_1176907 | Not Available | 647 | Open in IMG/M |
| 3300008110|Ga0114343_1224745 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300008111|Ga0114344_1009208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7702 | Open in IMG/M |
| 3300008111|Ga0114344_1022394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2554 | Open in IMG/M |
| 3300008113|Ga0114346_1105977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
| 3300008113|Ga0114346_1163713 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300008117|Ga0114351_1156051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1249 | Open in IMG/M |
| 3300008117|Ga0114351_1321150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300008119|Ga0114354_1168540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300008120|Ga0114355_1086715 | Not Available | 1272 | Open in IMG/M |
| 3300008120|Ga0114355_1171103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300008120|Ga0114355_1225829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300008261|Ga0114336_1093373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300008261|Ga0114336_1174572 | Not Available | 927 | Open in IMG/M |
| 3300008264|Ga0114353_1052494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2313 | Open in IMG/M |
| 3300008953|Ga0104241_1014097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300008962|Ga0104242_1087404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300009026|Ga0102829_1269463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300009155|Ga0114968_10609981 | Not Available | 577 | Open in IMG/M |
| 3300009159|Ga0114978_10584389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300009161|Ga0114966_10155879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1482 | Open in IMG/M |
| 3300009161|Ga0114966_10265787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| 3300009161|Ga0114966_10481605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300009164|Ga0114975_10331093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300009181|Ga0114969_10354926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
| 3300009183|Ga0114974_10068106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2340 | Open in IMG/M |
| 3300009183|Ga0114974_10112835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1736 | Open in IMG/M |
| 3300009183|Ga0114974_10737669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300009184|Ga0114976_10415690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300009419|Ga0114982_1155509 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300010312|Ga0102883_1138549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300010354|Ga0129333_10017197 | Not Available | 6877 | Open in IMG/M |
| 3300010354|Ga0129333_10101519 | All Organisms → Viruses → Predicted Viral | 2658 | Open in IMG/M |
| 3300010354|Ga0129333_10470045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300010354|Ga0129333_10470047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300010354|Ga0129333_10588735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
| 3300010354|Ga0129333_10671127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300010370|Ga0129336_10283125 | Not Available | 925 | Open in IMG/M |
| 3300010370|Ga0129336_10633828 | Not Available | 569 | Open in IMG/M |
| 3300010388|Ga0136551_1053897 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300010885|Ga0133913_13457646 | Not Available | 1032 | Open in IMG/M |
| 3300011268|Ga0151620_1162184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300011268|Ga0151620_1209260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300012000|Ga0119951_1013050 | All Organisms → cellular organisms → Bacteria | 3275 | Open in IMG/M |
| 3300012667|Ga0157208_10002177 | All Organisms → cellular organisms → Bacteria | 3928 | Open in IMG/M |
| 3300012970|Ga0129338_1583156 | All Organisms → cellular organisms → Bacteria | 3003 | Open in IMG/M |
| 3300013004|Ga0164293_10056501 | All Organisms → cellular organisms → Bacteria | 3142 | Open in IMG/M |
| 3300013004|Ga0164293_10097953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2257 | Open in IMG/M |
| 3300013005|Ga0164292_10471860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 826 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10111361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1899 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10344517 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6 | 862 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10150897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1839 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10179523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
| 3300014050|Ga0119952_1037326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1420 | Open in IMG/M |
| 3300017761|Ga0181356_1077265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
| 3300017788|Ga0169931_10040924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5210 | Open in IMG/M |
| 3300019784|Ga0181359_1160150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300020074|Ga0194113_10290426 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300020172|Ga0211729_11290776 | Not Available | 1149 | Open in IMG/M |
| 3300020172|Ga0211729_11293051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300020183|Ga0194115_10475088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300020200|Ga0194121_10125264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1558 | Open in IMG/M |
| 3300020205|Ga0211731_10864312 | Not Available | 763 | Open in IMG/M |
| 3300020205|Ga0211731_11151637 | Not Available | 11215 | Open in IMG/M |
| 3300020487|Ga0208200_109679 | Not Available | 785 | Open in IMG/M |
| 3300020498|Ga0208050_1000418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6970 | Open in IMG/M |
| 3300020529|Ga0208233_1014075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300020530|Ga0208235_1028948 | Not Available | 666 | Open in IMG/M |
| 3300020543|Ga0208089_1014310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
| 3300020558|Ga0208362_1063937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300020568|Ga0208598_1011214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1414 | Open in IMG/M |
| 3300020571|Ga0208723_1054405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300021140|Ga0214168_1032040 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300021141|Ga0214163_1041602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1239 | Open in IMG/M |
| 3300021424|Ga0194117_10135669 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300021962|Ga0222713_10129640 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
| 3300021962|Ga0222713_10545779 | Not Available | 685 | Open in IMG/M |
| 3300021962|Ga0222713_10682524 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300022190|Ga0181354_1164977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300022752|Ga0214917_10015390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6644 | Open in IMG/M |
| 3300024289|Ga0255147_1003421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3726 | Open in IMG/M |
| 3300024289|Ga0255147_1020949 | Not Available | 1370 | Open in IMG/M |
| 3300024306|Ga0255148_1025452 | Not Available | 1116 | Open in IMG/M |
| 3300024351|Ga0255141_1000053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 43598 | Open in IMG/M |
| 3300024352|Ga0255142_1040132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300024357|Ga0255165_1016779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1396 | Open in IMG/M |
| 3300024496|Ga0255151_1011660 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300024500|Ga0255143_1037685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300024505|Ga0255150_1039850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300024865|Ga0256340_1002951 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Paludibacteraceae → Paludibacter → Paludibacter propionicigenes → Paludibacter propionicigenes WB4 | 3841 | Open in IMG/M |
| 3300024865|Ga0256340_1073477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300024866|Ga0255272_1098050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300025848|Ga0208005_1281132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 511 | Open in IMG/M |
| 3300027128|Ga0255099_1058154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300027131|Ga0255066_1038834 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300027133|Ga0255070_1045074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300027215|Ga0208166_1025813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300027218|Ga0208165_1012998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300027281|Ga0208440_1032617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
| 3300027320|Ga0208923_1025985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
| 3300027467|Ga0255154_1064372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300027503|Ga0255182_1050185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300027531|Ga0208682_1052062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| 3300027541|Ga0255158_1015617 | All Organisms → Viruses → Predicted Viral | 1777 | Open in IMG/M |
| 3300027547|Ga0209864_1015578 | Not Available | 870 | Open in IMG/M |
| 3300027600|Ga0255117_1038777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
| 3300027608|Ga0208974_1026769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1759 | Open in IMG/M |
| 3300027631|Ga0208133_1054983 | Not Available | 958 | Open in IMG/M |
| 3300027656|Ga0209357_1105912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300027659|Ga0208975_1011394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3041 | Open in IMG/M |
| 3300027679|Ga0209769_1238212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300027689|Ga0209551_1003383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5876 | Open in IMG/M |
| 3300027720|Ga0209617_10366042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300027754|Ga0209596_1200801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
| 3300027756|Ga0209444_10238261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300027759|Ga0209296_1121016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
| 3300027763|Ga0209088_10349147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300027772|Ga0209768_10007931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6167 | Open in IMG/M |
| 3300027797|Ga0209107_10015704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4316 | Open in IMG/M |
| 3300027797|Ga0209107_10476293 | Not Available | 558 | Open in IMG/M |
| 3300027808|Ga0209354_10213816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300027816|Ga0209990_10055587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2005 | Open in IMG/M |
| 3300027963|Ga0209400_1015705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4601 | Open in IMG/M |
| 3300027974|Ga0209299_1070056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
| 3300028113|Ga0255234_1076654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1049250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1873 | Open in IMG/M |
| 3300031758|Ga0315907_10538978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300031758|Ga0315907_11011737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300031786|Ga0315908_10688002 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031787|Ga0315900_10062737 | All Organisms → cellular organisms → Bacteria | 3830 | Open in IMG/M |
| 3300031787|Ga0315900_10158291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2081 | Open in IMG/M |
| 3300031857|Ga0315909_10127838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2133 | Open in IMG/M |
| 3300031857|Ga0315909_10162848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1818 | Open in IMG/M |
| 3300031857|Ga0315909_10272932 | Not Available | 1282 | Open in IMG/M |
| 3300031951|Ga0315904_10334022 | Not Available | 1403 | Open in IMG/M |
| 3300031951|Ga0315904_10432590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1182 | Open in IMG/M |
| 3300031951|Ga0315904_10454579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
| 3300031951|Ga0315904_10495910 | Not Available | 1078 | Open in IMG/M |
| 3300031951|Ga0315904_11480887 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031963|Ga0315901_10733264 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300031963|Ga0315901_11159648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300032050|Ga0315906_10069448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3591 | Open in IMG/M |
| 3300032050|Ga0315906_10190089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1943 | Open in IMG/M |
| 3300032050|Ga0315906_10328674 | Not Available | 1363 | Open in IMG/M |
| 3300032050|Ga0315906_10526333 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300032050|Ga0315906_11047008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300032050|Ga0315906_11281393 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032116|Ga0315903_10154465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2102 | Open in IMG/M |
| 3300032116|Ga0315903_10370442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300033996|Ga0334979_0649212 | Not Available | 555 | Open in IMG/M |
| 3300034023|Ga0335021_0175236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
| 3300034062|Ga0334995_0761833 | Not Available | 536 | Open in IMG/M |
| 3300034073|Ga0310130_0006204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4570 | Open in IMG/M |
| 3300034102|Ga0335029_0084526 | All Organisms → Viruses → Predicted Viral | 2264 | Open in IMG/M |
| 3300034118|Ga0335053_0473833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300034118|Ga0335053_0599679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300034121|Ga0335058_0051067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2418 | Open in IMG/M |
| 3300034284|Ga0335013_0197447 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300034356|Ga0335048_0163257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1263 | Open in IMG/M |
| 3300034356|Ga0335048_0378404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300034357|Ga0335064_0009445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4971 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.66% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.66% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.21% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.80% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.42% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.93% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.45% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.45% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.97% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.97% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.48% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.48% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.48% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.48% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002375 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020487 | Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020558 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020568 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027215 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027218 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027541 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_9168760 | 2035265000 | Freshwater | MRKQRTVDYFNNKYGLSLDDFDVADAFGIAHYSNEELTKR |
| JGI12421J11937_100137436 | 3300000756 | Freshwater And Sediment | MRKQRTVDYFNIKYGIKLDDFDVADSFGIAHYANKVLTER* |
| RCM37_10867554 | 3300001850 | Marine Plankton | KNKMRNIRKQRTVDYFNKMYGLSLSDFDVADSFGIAHYSNRVLTER* |
| RCM37_11724231 | 3300001850 | Marine Plankton | YKNKMRNIRKQRTVDWVKDKFDINLTDFDVADSFGIAYYANKVLTER* |
| RCM31_101006903 | 3300001851 | Marine Plankton | ETRKQRTVDYFNKKYNLNLLDFDVADSFGIAHYSNRVLTER* |
| B570J29617_10083172 | 3300002375 | Freshwater | MRKQRTVDYFNNKYKLLLTDFDVADAFGIAHYSNEVLTKR* |
| B570J29032_1094975923 | 3300002408 | Freshwater | RTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER* |
| B570J40625_1017043802 | 3300002835 | Freshwater | RNMRKQRTADYFNKKYKLDVVDFDVADSFGIAHYANKVLTER* |
| JGI25930J51415_10804961 | 3300003499 | Freshwater Lake | YKTQLRNMRKQRTVDYFNNKYGILLNDFDVADSFGIAHYANKVLTER* |
| Ga0063232_101170101 | 3300004054 | Freshwater Lake | ESWYKNQLRNMRKQRTADYFNKKYGLNIVDYDVADSFGIAHYSNQVLTKR* |
| Ga0066182_101149523 | 3300004125 | Freshwater Lake | RNMRKQRTADYFNKKYGIEIVDFDVADSFGIAHYGNQVLTKR* |
| Ga0007787_104073073 | 3300004240 | Freshwater Lake | NPGYADSWYKTQLRNMRKQRTVDYFNSKYSLTITDFDVADAFGIAHYANKVLTER* |
| Ga0070374_105264071 | 3300005517 | Freshwater Lake | QLRNMRKQRTVDYFNNKYKLEINDFDVADSFGIAYYANNVLTKR* |
| Ga0070374_105458743 | 3300005517 | Freshwater Lake | RTVDYFNLKYGLSIDDFDVADSFGIAHYSNQVLTKR* |
| Ga0049082_100302766 | 3300005584 | Freshwater Lentic | KQRTADYFNKKYGLEIVDFDVADSFGIAHYSNQVLTKR* |
| Ga0049082_101891603 | 3300005584 | Freshwater Lentic | WYQNQLRTMRKQRTVDYFNSKYNLALSDFDVADSFGIAHYANKVLTER* |
| Ga0049082_101900851 | 3300005584 | Freshwater Lentic | LRNMRKQRTADYFNKKYGLNIVDYDVADSFGIAHYSNQVLTKR* |
| Ga0078894_103712115 | 3300005662 | Freshwater Lake | ADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0078894_105130454 | 3300005662 | Freshwater Lake | QRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0078894_108940151 | 3300005662 | Freshwater Lake | NQLRNMRKQRTVDYFNKKYTLSLEDFDVADAFGIAHYSNTILTER* |
| Ga0078894_114947013 | 3300005662 | Freshwater Lake | ADSWYKTQLRNMRKQRTVDYFNSKYRLSLEDFDVADSFGIAHYANKVLTER* |
| Ga0079957_10755421 | 3300005805 | Lake | RKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER* |
| Ga0079957_10800291 | 3300005805 | Lake | KQRTADYFNKKYNLKLEDFDVADSFGIAYYANEVLTKR* |
| Ga0079957_11501471 | 3300005805 | Lake | QRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER* |
| Ga0079957_12243921 | 3300005805 | Lake | TVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER* |
| Ga0073913_100255743 | 3300005940 | Sand | DSWYKTQLRNMRKQRTVDYFNNKYKISLDDFDVADSFGIAHYANKVLTER* |
| Ga0102977_10313452 | 3300007171 | Freshwater Lake | MRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER* |
| Ga0102978_10475391 | 3300007177 | Freshwater Lake | LRFENPGYADSWYKNKMRQIRKQRTVDYFNKKYGLNLDDFDVADAFGIAHYSNTVLTER* |
| Ga0102978_10587351 | 3300007177 | Freshwater Lake | FENPGYADSWYKNKMRQIRKQRTVDYFNNKYNLSLEDFDVADAFGIAHYSNTVLTER* |
| Ga0102978_10868431 | 3300007177 | Freshwater Lake | ADSWYKAKMREIRKQRTVDYFNKKYNLSLDDFDVADAFGIAHYSNTVLTER* |
| Ga0103958_12123391 | 3300007212 | Freshwater Lake | MREIRKQRTVDYFNKKYNLDLDDFDVADAFGIAHYSNTVLTER* |
| Ga0102861_11736801 | 3300007544 | Estuarine | KLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0102874_10802111 | 3300007546 | Estuarine | NMRKQRTADYFNLKYNLLLNDFDVADSFGIAHYANKELTKR* |
| Ga0102879_10777161 | 3300007549 | Estuarine | NMRKQRTVDYFNSKYSINLDDFDVADSFGIAHYANKELTKR* |
| Ga0102828_11893621 | 3300007559 | Estuarine | VDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER* |
| Ga0102923_10674083 | 3300007606 | Estuarine | RKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0102901_10848991 | 3300007634 | Estuarine | VDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER* |
| Ga0102906_11391111 | 3300007637 | Estuarine | MRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0102865_10810191 | 3300007639 | Estuarine | RNMRKQRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER* |
| Ga0102912_10714163 | 3300007649 | Estuarine | KQRTVDYFNKKYNLSITDFDVADAFGIAHYSNEELTKR* |
| Ga0114341_103602151 | 3300008108 | Freshwater, Plankton | TVDYFNKKYKLSLTDFDVADSFGIAHYSNSILTER* |
| Ga0114341_104035341 | 3300008108 | Freshwater, Plankton | NMRKQRTVDYFNNKYNLSVTDFDVADAFGIAHYANKVLTER* |
| Ga0114343_10427711 | 3300008110 | Freshwater, Plankton | SWYKTQLRNMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER* |
| Ga0114343_10528561 | 3300008110 | Freshwater, Plankton | MRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER* |
| Ga0114343_10762041 | 3300008110 | Freshwater, Plankton | VDYFNKKYGLSITDFDVADAFGIAHYANKVLTER* |
| Ga0114343_11769071 | 3300008110 | Freshwater, Plankton | NQLRNMRKQRTVDYFNKKYGINLTDFDVADAFGIAHYANKVLTER* |
| Ga0114343_12247453 | 3300008110 | Freshwater, Plankton | LRNMRKQRTVDYFNSKYNLALSDFDVADSFGIAHYSNSILTER* |
| Ga0114344_100920810 | 3300008111 | Freshwater, Plankton | MRKQRTVDYFNKKYGLSLKDFDVADAFGIAHYANKVLTER* |
| Ga0114344_10223946 | 3300008111 | Freshwater, Plankton | QRTVDYFNKKYDLSLNDFDVADSFGIAHYANKVLTER* |
| Ga0114346_11059774 | 3300008113 | Freshwater, Plankton | RTADYFNKKYNLNISDFDVADSFGIAHYANKVLTER* |
| Ga0114346_11637131 | 3300008113 | Freshwater, Plankton | RVKNPGYADSWYKTQLRNMRKQRTVDYFNNKYNLSITDFDVADAFGIAHYTNKVLTER* |
| Ga0114351_11560511 | 3300008117 | Freshwater, Plankton | YADSWYKNKMRQIRKQRTVDYFNKKYNLELDDFDVADAFGIAHYSNTVLTER* |
| Ga0114351_13211501 | 3300008117 | Freshwater, Plankton | YAESWYKSQLRNMRKQRTVDYFNNKYGLSLNDFDVADSFGIAHYANKVLTER* |
| Ga0114354_11685403 | 3300008119 | Freshwater, Plankton | YADSWYKTQLRNMRKQRTVDYFNKKYDLSLKDFDVADSFGIAHYANKVLTER* |
| Ga0114355_10867151 | 3300008120 | Freshwater, Plankton | RKQRTVDYFNSKYNLELDDFDVADAFGIAHYSNKVLTER* |
| Ga0114355_11711031 | 3300008120 | Freshwater, Plankton | NMRKQRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER* |
| Ga0114355_12258291 | 3300008120 | Freshwater, Plankton | NPGYADSWYKTQLRNMRKQRTVDYFNSKYNLTITDFDVADAFGIAHYANKVLTER* |
| Ga0114336_10933734 | 3300008261 | Freshwater, Plankton | ADSWYQNQLRNMRKQRTVDYFNSKYNLALSDFDVADSFGIAHYSNSILTER* |
| Ga0114336_11745721 | 3300008261 | Freshwater, Plankton | RTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0114353_10524941 | 3300008264 | Freshwater, Plankton | RTVDYFNKKYGLSLKDFDVADAFGIAHYANKVLTER* |
| Ga0104241_10140972 | 3300008953 | Freshwater | QRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER* |
| Ga0104242_10874041 | 3300008962 | Freshwater | VDYFNNKYKLFLTDFDVADAFGIAHYSNEVLTKR* |
| Ga0102829_12694631 | 3300009026 | Estuarine | QNQLRNMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER* |
| Ga0114968_106099811 | 3300009155 | Freshwater Lake | RNMRKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER* |
| Ga0114978_105843892 | 3300009159 | Freshwater Lake | NMRKQRTVDYFNNKYKLEINDFDVADSFGIAYYANNVLTKR* |
| Ga0114966_101558795 | 3300009161 | Freshwater Lake | WYKNQLRNMRKQRTADYFNKKYGLEIADFDVADSFGIAHYSNQVLTKR* |
| Ga0114966_102657871 | 3300009161 | Freshwater Lake | TVDYFNKKYNLSLSDFDVADSFGIAHYSNSILTER* |
| Ga0114966_104816052 | 3300009161 | Freshwater Lake | KQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER* |
| Ga0114975_103310931 | 3300009164 | Freshwater Lake | MRKQRTVDYFNNKYGLSLDDFDVADAFGIAHYSNEELTKR* |
| Ga0114969_103549262 | 3300009181 | Freshwater Lake | WYQNQLRNMRKQRTVNYFNNKYNLSLTDFDVADSFGIAHYSNSILTER* |
| Ga0114974_100681061 | 3300009183 | Freshwater Lake | LRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0114974_101128351 | 3300009183 | Freshwater Lake | QRTVDYFNDKYNLSLDDFDVADSFGIAHYANKVLTER* |
| Ga0114974_107376691 | 3300009183 | Freshwater Lake | RNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0114976_104156901 | 3300009184 | Freshwater Lake | KNQLRNMRKQRTVDYFNKMYGLDLNDFDVADAFGIAHYSNEVLTKR* |
| Ga0114982_11555091 | 3300009419 | Deep Subsurface | VDYFNKKYSLNISDFDVADSFGIAHYANKVLTER* |
| Ga0102883_11385491 | 3300010312 | Estuarine | NMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER* |
| Ga0129333_1001719718 | 3300010354 | Freshwater To Marine Saline Gradient | PGYADSWYKNKMREIRKQRTVDYFNKKYNLSLEDFDVADSFGIAYYANEVLTKR* |
| Ga0129333_101015191 | 3300010354 | Freshwater To Marine Saline Gradient | QLRNMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER* |
| Ga0129333_104700454 | 3300010354 | Freshwater To Marine Saline Gradient | KAKMREIRKQRTVDYFNKKYNLRLDDFDVADAFGIAHYSNMVLTER* |
| Ga0129333_104700474 | 3300010354 | Freshwater To Marine Saline Gradient | KAKMREIRKQRTVDYFNKKYNLRLDDFDVADAFGIAHYSNTVLTER* |
| Ga0129333_105887352 | 3300010354 | Freshwater To Marine Saline Gradient | KQRTVDYFNKKYGLSITDFDVADAFGIAHYANKVLTER* |
| Ga0129333_106711271 | 3300010354 | Freshwater To Marine Saline Gradient | KQRTVDYFNKKYNLELDDFDVADAFGIAHYSNTVLTER* |
| Ga0129333_109520631 | 3300010354 | Freshwater To Marine Saline Gradient | LRFENPGHADSWYKAKMREIRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER* |
| Ga0129336_102831251 | 3300010370 | Freshwater To Marine Saline Gradient | DSWYKNKMREIRKQRTVDYFNKKYNLSLEDFDVADSFGIAYYANEVLTKR* |
| Ga0129336_106338283 | 3300010370 | Freshwater To Marine Saline Gradient | RFENPGHADSWYKAKMREIRKQRTVDYFNNKYNLQLDDFDVADAFGIAHYSNTVLTER* |
| Ga0136551_10538971 | 3300010388 | Pond Fresh Water | RNMRKQRTADYFNRKYDLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0133913_134576461 | 3300010885 | Freshwater Lake | MRKQRTADYFNTKYNLNVLDFDVADSFGIAHYANKVLTER* |
| Ga0151620_11621841 | 3300011268 | Freshwater | TVDYFNERYGLKIDDFDVADSFGIAHYANGVLTER* |
| Ga0151620_12092603 | 3300011268 | Freshwater | WYKNQLRNMRKQRTADYFNKKYGLEIIDFDVADSFGIAHYSNQVLTKR* |
| Ga0119951_10130507 | 3300012000 | Freshwater | ADSWYQNKLRNMRKQRTADYFNTKYNLNVLDFDVADSFGIAHYANKVLTER* |
| Ga0157208_100021771 | 3300012667 | Freshwater | GYAESWYKNQLRNMRKQRTCDYFNSKYGLNVSDFDVADSFGIAHYGNQVLTQR* |
| Ga0129338_15831568 | 3300012970 | Aqueous | LRFENPGYAESWYKAKMREIRKQRTVDYFNKKYNLELNDFDVADSFGIAYYANEVLTKR* |
| Ga0164293_100565011 | 3300013004 | Freshwater | RKQRTVDYFNSKYRLSLEDFDVADSFGIAHYANKVLTER* |
| Ga0164293_100979531 | 3300013004 | Freshwater | ADSWYKNQLRNMRKQRTADYFNRKYDLNVVDFDVADSFGIAHYANQMLTER* |
| Ga0164292_104718601 | 3300013005 | Freshwater | KQRTVDYFNSKYGLKIEDFDVADSMGIAYYANEVLTKR* |
| (restricted) Ga0172367_101113611 | 3300013126 | Freshwater | NIRKQRTVDYFNDKYKLKLVDFDVADSFGIAYYAMNNLTLCGR* |
| (restricted) Ga0172367_103445171 | 3300013126 | Freshwater | NIRKQRTVDYFNDKYKLKLVDFDVADSFGIAYYAMNNLTL* |
| (restricted) Ga0172372_101508971 | 3300013132 | Freshwater | WYKTKMREIRKQRTVDYFNNKYDLKLDDFDVADAFGIAHYSNTVLTER* |
| (restricted) Ga0172372_101795231 | 3300013132 | Freshwater | SWYKNKMREIRKQRTVDHFNNKYDLDLDDFDVADAFGIAHYSNSVLTER* |
| Ga0119952_10373261 | 3300014050 | Freshwater | MRKQRTADYFNRKYDLNVVDFDVADSFGIAHYANKVLTER* |
| Ga0181356_10772651 | 3300017761 | Freshwater Lake | YKNQLRNMRKQRTADYFNKKYGLEIVDFDVADSFGIAHYSNQVLTKR |
| Ga0169931_100409241 | 3300017788 | Freshwater | KDTLRFENPGHADSWYKTKMREIRKQRTVDYFNNKYDLKLDDFDVADAFGIAHYSNRVLTER |
| Ga0181359_11601502 | 3300019784 | Freshwater Lake | LRNMRKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER |
| Ga0194113_102904261 | 3300020074 | Freshwater Lake | YADSWYKNKMRQIRKQRTVDYFNNKYKLSLDDFDVADAFGIANYANKVLTER |
| Ga0211729_112907763 | 3300020172 | Freshwater | SWYKTQLRNMRKQRTVDYFNNKYGLALNDFDVADAFGIAHYSNTVLTER |
| Ga0211729_112930511 | 3300020172 | Freshwater | DSWYQNKLRNMRKQRTADYFNGKYNLNVVDFDVADSFGIAHYANKVLTER |
| Ga0194115_104750881 | 3300020183 | Freshwater Lake | MRQIRKQRTVDYFNNKYKLSLDDFDVADAFGIANYANKVLTER |
| Ga0194121_101252645 | 3300020200 | Freshwater Lake | LKLENPGYAESWYKNKMRNIRKQRTVDYFNYKYKLQLNDFDVADSFGIAYYANEVLTKR |
| Ga0211731_108643123 | 3300020205 | Freshwater | WYKTQLRNMRKQRTVDYFNSKYNLTITDFDVADSFGIAHYANKVLTER |
| Ga0211731_1115163718 | 3300020205 | Freshwater | WYKNQLRNMRKQRTADYFNKKYGLDVVDFDVADSFGIAHYANKVLTER |
| Ga0208200_1096791 | 3300020487 | Freshwater | MRKQRTVEYFNNKYNLTLSDFDVADAFGIAHYSNRILTER |
| Ga0208050_10004181 | 3300020498 | Freshwater | RKQRTADYFNKKHGLAIEDFDVADAFGIAYYAREVLTNK |
| Ga0208233_10140754 | 3300020529 | Freshwater | KQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER |
| Ga0208235_10289483 | 3300020530 | Freshwater | NMRKQRTVDYFNKKYKLSLTDFDVADAFGIAHYSNQVLTKR |
| Ga0208089_10143101 | 3300020543 | Freshwater | ADSWYKTQLRNMRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER |
| Ga0208362_10639373 | 3300020558 | Freshwater | GYADSWYKTQLRNMRKQRTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER |
| Ga0208598_10112141 | 3300020568 | Freshwater | RTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER |
| Ga0208723_10544052 | 3300020571 | Freshwater | KNPGYADSWYKTQLRNMRKQRTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER |
| Ga0214168_10320401 | 3300021140 | Freshwater | IRVKNPGYADSWYKTQLRNMRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER |
| Ga0214163_10416021 | 3300021141 | Freshwater | QLRNMRKQRTADYFNKKYGLEIIDFDVADSFGIAHYSNQVLTKR |
| Ga0194117_101356694 | 3300021424 | Freshwater Lake | FWYKNKMRQIRKQRTVDYFNNKYKLSLNDFDVADAFGIANYANKVLTER |
| Ga0222713_101296401 | 3300021962 | Estuarine Water | AAIRVKNPGYADSWYKTQLRNMRKQRTVDYFNKKYQLSITDFDVADAFGIAHYANKVLTE |
| Ga0222713_105457791 | 3300021962 | Estuarine Water | WYKNQLRNMRKQRTVDYFNKKYNLSITDFDVADSFGIAHYSNQVLTKR |
| Ga0222713_106825241 | 3300021962 | Estuarine Water | MRKQRTVDYFNKKYDLSLKDFDVADSFGIVHYANKVLTER |
| Ga0181354_11649772 | 3300022190 | Freshwater Lake | NMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER |
| Ga0214917_100153901 | 3300022752 | Freshwater | NKIREARKQRTADYFNKKYNLKIEDFDVADSFGIAYYANEVLTKR |
| Ga0255147_10034211 | 3300024289 | Freshwater | KLRFENPGHTDSWYKAKMREIRKQRTVDYFNNKYSLKLDDFDVADAFGIAHYSNTVLTER |
| Ga0255147_10209494 | 3300024289 | Freshwater | QRTVDYFNKKYNLNLEDFDVADSFGIAYYANEVLTKR |
| Ga0255148_10254523 | 3300024306 | Freshwater | ENPGYADSWYKNKMREIRKKRTVDYFNKKYNLSLEDFDVADSFGIAYYANEVLTKR |
| Ga0255141_10000531 | 3300024351 | Freshwater | FENPGHADSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0255142_10401321 | 3300024352 | Freshwater | SWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0255165_10167791 | 3300024357 | Freshwater | LRFENPGHADSWYKAKMREIRKQRTVDYFNNKYNLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0255151_10116603 | 3300024496 | Freshwater | ADSWYKNKMRQIRKQRTVDYFNKKYGLELEDFDVADAFGIAHYSNTVLTER |
| Ga0255143_10376851 | 3300024500 | Freshwater | LRFENPGHADSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0255150_10398501 | 3300024505 | Freshwater | DSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0256340_10029511 | 3300024865 | Freshwater | NMRKQRTADYFNKKYNLNLEDFDVADSFGIAYYANEVLTKR |
| Ga0256340_10734771 | 3300024865 | Freshwater | SWYKAKMREIRKQRTVDYFNNKYSLKLDDFDVADAFGIAHYSNTVLTER |
| Ga0255272_10980501 | 3300024866 | Freshwater | RKQRTVDYFNNKYNLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0208005_12811321 | 3300025848 | Aqueous | ENPGYADSWYKNKMRQIRKQRTVDYFNKKYNLELDDFDVADAFGIAHYSNTVLTER |
| Ga0255099_10581543 | 3300027128 | Freshwater | NMRKQRTANYFNDKYNIVVNDFDVADSFGIAHYANKVLTER |
| Ga0255066_10388341 | 3300027131 | Freshwater | QRTVDYFNKKYDLSLKDFDVADSFGIVHYANKVLTER |
| Ga0255070_10450741 | 3300027133 | Freshwater | WYQNKLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER |
| Ga0208166_10258131 | 3300027215 | Estuarine | SWYKNQLRNMRKQRTADYFNKKYGLQIVDFDVADSFGIAHYSNQVLTKR |
| Ga0208165_10129983 | 3300027218 | Estuarine | RTVDYFNKKYNLSITDFDVADAFGIAHYSNEELTKR |
| Ga0208440_10326174 | 3300027281 | Estuarine | ESWYKNQLRNMRKQRTADYFNKKYGLQIVDFDVADSFGIAHYANKVLTER |
| Ga0208923_10259851 | 3300027320 | Estuarine | MRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER |
| Ga0255154_10643724 | 3300027467 | Freshwater | ENPGHADSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0255182_10501854 | 3300027503 | Freshwater | LRFENPGHTDSWYKAKMREIRKQRTVDYFNNKYGLKLDDFDVADAFGIAHYSNTVLTER |
| Ga0208682_10520624 | 3300027531 | Estuarine | QNKLRNMRKQRTADYFNRKYDLNVVDFDVADSFGIAHYANKVLTER |
| Ga0255158_10156174 | 3300027541 | Freshwater | TVDYFNKKYNLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0209864_10155781 | 3300027547 | Sand | DSWYKTQLRNMRKQRTVDYFNNKYKISLDDFDVADSFGIAHYANKVLTER |
| Ga0255117_10387771 | 3300027600 | Freshwater | QRTVEYFNKKYSINLNDFDVADSFGIAHYANKVLTER |
| Ga0208974_10267693 | 3300027608 | Freshwater Lentic | QLRNMRKQRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER |
| Ga0208133_10549831 | 3300027631 | Estuarine | YADSWYKNQLRNMRKQRTADYFNTKYNLNVVDFDVADSFGIAHYANKVLTER |
| Ga0209357_11059122 | 3300027656 | Freshwater Lake | RNMRKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER |
| Ga0208975_10113946 | 3300027659 | Freshwater Lentic | QRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER |
| Ga0209769_12382121 | 3300027679 | Freshwater Lake | YKTQLRNMRKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER |
| Ga0209551_100338313 | 3300027689 | Freshwater Lake | WYKNQLRNMRKQRTADYFNKKYGLTVEDFDVADAFGIAYYAREVLTNK |
| Ga0209617_103660422 | 3300027720 | Freshwater And Sediment | DSWYQNQLRNMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER |
| Ga0209596_12008012 | 3300027754 | Freshwater Lake | WYQNQLRNMRKQRTVNYFNNKYNLSLTDFDVADSFGIAHYSNSILTER |
| Ga0209444_102382613 | 3300027756 | Freshwater Lake | RTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR |
| Ga0209296_11210163 | 3300027759 | Freshwater Lake | LRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER |
| Ga0209088_103491472 | 3300027763 | Freshwater Lake | KLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER |
| Ga0209768_100079311 | 3300027772 | Freshwater Lake | WYKNQLRNMRKQRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR |
| Ga0209107_100157049 | 3300027797 | Freshwater And Sediment | KQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER |
| Ga0209107_104762932 | 3300027797 | Freshwater And Sediment | DSWYKNQLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANEVLTDRT |
| Ga0209354_102138161 | 3300027808 | Freshwater Lake | KNQLRNMRKQRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR |
| Ga0209990_100555871 | 3300027816 | Freshwater Lake | KQRTVDYFNSKYNLTITDFDVADAFGIAHYANKVLTER |
| Ga0209400_10157051 | 3300027963 | Freshwater Lake | NQLRNMRKQRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR |
| Ga0209299_10700561 | 3300027974 | Freshwater Lake | SWYKNQLRNMRKQRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR |
| Ga0255234_10766541 | 3300028113 | Freshwater | LANPGYADSWYKNQLRNMRKQRTANYFNDKYNIVVNDFDVADSFGIAHYANKVLTER |
| (restricted) Ga0247835_10492504 | 3300028114 | Freshwater | MRKQRTVDYFNKKYNLSITDFDVADAFGIAHYANKVLTER |
| Ga0315907_105389783 | 3300031758 | Freshwater | QLRNMRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER |
| Ga0315907_110117371 | 3300031758 | Freshwater | YKNKMRQIRKQRTVDYFNKKYGLELDDFDVADAFGIAHYSNTVLTER |
| Ga0315908_106880023 | 3300031786 | Freshwater | TQLRNMRKQRTVDYFNKKYGLSLKDFDVADAFGIAHYANKVLTER |
| Ga0315900_100627378 | 3300031787 | Freshwater | NPGHADSWYKAKMREIRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER |
| Ga0315900_101582914 | 3300031787 | Freshwater | IRVKNPGYADSWYKTQLRNMRKQRTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER |
| Ga0315909_101278386 | 3300031857 | Freshwater | NMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER |
| Ga0315909_101628481 | 3300031857 | Freshwater | QLRNMRKQRTVDYFNNKYNLSLTDYDVADSFGIAHYANKVLTER |
| Ga0315909_102729324 | 3300031857 | Freshwater | IRKQRTVDYFNSKYNLELDDFDVADAFGIAHYSNKVLTER |
| Ga0315904_103340221 | 3300031951 | Freshwater | MREIRKQRTVDYFNSKYNLELDDFDVADAFGIAHYSNKVLTER |
| Ga0315904_104325904 | 3300031951 | Freshwater | KTQLRNMRKQRTADYFNKKYNLNISDFDVADSFGIAHYANKVLTER |
| Ga0315904_104545791 | 3300031951 | Freshwater | MRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER |
| Ga0315904_104959104 | 3300031951 | Freshwater | KAKMREIRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER |
| Ga0315904_114808872 | 3300031951 | Freshwater | HTDSWYKAKMREIRKQRTVDYFNNKYGLQLDDFDVADAFGIAHYSNTVLTER |
| Ga0315901_107332641 | 3300031963 | Freshwater | MRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER |
| Ga0315901_111596483 | 3300031963 | Freshwater | QLRNMRKQRTVDYFNKKYGLSITDFDVADAFGIAHYANKVLTER |
| Ga0315906_100694487 | 3300032050 | Freshwater | KQRTVDYFNTKYGLSLDDFDVADAFGIAHYSNTVLTER |
| Ga0315906_101900894 | 3300032050 | Freshwater | MRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER |
| Ga0315906_103286741 | 3300032050 | Freshwater | LRFENPGHADSWYKAKMREIRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER |
| Ga0315906_105263333 | 3300032050 | Freshwater | RTVDYFNKKYGLSVSDFDVADAFGIAHYANKVLTER |
| Ga0315906_110470081 | 3300032050 | Freshwater | QLRNMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER |
| Ga0315906_112813933 | 3300032050 | Freshwater | RKQRTVDYFNNKYNLLLTDYDVADSFGIAHYANKVLTER |
| Ga0315903_101544651 | 3300032116 | Freshwater | KLRNMRKQRTVDYFNSKYNLSITDFDVADAFGIAHYANKVLTER |
| Ga0315903_103704423 | 3300032116 | Freshwater | KQRTVDYFNSKYNLELDDFDVADAFGIAHYSNKVLTER |
| Ga0334979_0649212_3_152 | 3300033996 | Freshwater | SWYKTQLRNMRKQRTVEYFNNKYNLTLSDFDVADAFGIAHYSNRILTER |
| Ga0335021_0175236_1031_1153 | 3300034023 | Freshwater | MRKQRTADYFNNKYGLDIIDYDVADSFGIAYYANEVLTKR |
| Ga0334995_0761833_408_530 | 3300034062 | Freshwater | MRKQRTADYFNKKYGLSVIDFDVADSFGIAYYANEVLTKR |
| Ga0310130_0006204_3_173 | 3300034073 | Fracking Water | ENPGHADSWYKAKMREIRKQRTVDYFNKKYNLELDDFDVADAFGIAHYSNTVLTER |
| Ga0335029_0084526_105_227 | 3300034102 | Freshwater | MRKQRTVDYFNKKYSINLNDFDVADSFGIAHYANKVLTER |
| Ga0335053_0473833_634_744 | 3300034118 | Freshwater | RTADYFNKKYGLEIIDFDVADSFGIAHYSNQVLTKR |
| Ga0335053_0599679_480_602 | 3300034118 | Freshwater | MRKQRTVDYINDKYNLNLDDFDVADSFGIAHYANKVLTER |
| Ga0335058_0051067_2262_2384 | 3300034121 | Freshwater | MRKQRTADYFNKKHGLKIEDFDVADAFGIAYYAREVLTNK |
| Ga0335013_0197447_2_124 | 3300034284 | Freshwater | MRKQRTVDYFNSKYRLSLEDFDVADSFGIAHYANKVLTER |
| Ga0335048_0163257_1116_1262 | 3300034356 | Freshwater | WYKNQIRNMRKQRTVDYFNTKYGLSLTDFDVADSFGIAHYANKVLTER |
| Ga0335048_0378404_1_126 | 3300034356 | Freshwater | NMRKQRTVDYFNSKYRLSLEDFDVADSFGIAHYANKVLTER |
| Ga0335064_0009445_53_175 | 3300034357 | Freshwater | MRKQRTVDYFNSKYSLSLEDFDVADSFGIAHYANKVLTER |
| ⦗Top⦘ |