NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F024003

Metagenome / Metatranscriptome Family F024003

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024003
Family Type Metagenome / Metatranscriptome
Number of Sequences 208
Average Sequence Length 41 residues
Representative Sequence LIHAVEVAFESIHVSGPEPAERSQPGIHLLKWFRFQPVETAL
Number of Associated Samples 185
Number of Associated Scaffolds 208

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 18.75 %
% of genes near scaffold ends (potentially truncated) 99.04 %
% of genes from short scaffolds (< 2000 bps) 92.79 %
Associated GOLD sequencing projects 182
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.558 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.942 % of family members)
Environment Ontology (ENVO) Unclassified
(18.269 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.923 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.29%    β-sheet: 0.00%    Coil/Unstructured: 85.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 208 Family Scaffolds
PF08327AHSA1 41.35
PF00903Glyoxalase 40.38
PF10604Polyketide_cyc2 4.81
PF08818DUF1801 3.37
PF13564DoxX_2 2.40
PF12681Glyoxalase_2 2.40
PF08240ADH_N 0.48
PF00884Sulfatase 0.48
PF13376OmdA 0.48
PF07394DUF1501 0.48
PF01872RibD_C 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 208 Family Scaffolds
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 3.37
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 3.37
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 3.37
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.48
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.56 %
UnclassifiedrootN/A1.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_107099684All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300001359|A3035W6_1044717All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300001867|JGI12627J18819_10256402All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300002243|C687J29039_10208151All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium687Open in IMG/M
3300002245|JGIcombinedJ26739_100303422All Organisms → cellular organisms → Bacteria1481Open in IMG/M
3300002245|JGIcombinedJ26739_100890635All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300002916|JGI25389J43894_1062399All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300004022|Ga0055432_10223912All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300004081|Ga0063454_101916255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85522Open in IMG/M
3300004082|Ga0062384_101292477All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium534Open in IMG/M
3300004091|Ga0062387_101275392All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300004156|Ga0062589_101424216All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11677Open in IMG/M
3300004157|Ga0062590_101129447All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300004799|Ga0058863_11786214All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae816Open in IMG/M
3300005093|Ga0062594_100388379All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300005174|Ga0066680_10690673All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005186|Ga0066676_10298861All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300005332|Ga0066388_100426139All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1970Open in IMG/M
3300005332|Ga0066388_102159789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1003Open in IMG/M
3300005337|Ga0070682_101499612All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005365|Ga0070688_100067590All Organisms → cellular organisms → Bacteria2277Open in IMG/M
3300005450|Ga0066682_10817131All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005451|Ga0066681_10707934All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005454|Ga0066687_10745575All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005467|Ga0070706_101618659All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005549|Ga0070704_100318869All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300005554|Ga0066661_10560546All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005557|Ga0066704_10371583All Organisms → cellular organisms → Bacteria → Proteobacteria955Open in IMG/M
3300005559|Ga0066700_10816792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85626Open in IMG/M
3300005564|Ga0070664_102402272All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005569|Ga0066705_10847526All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005587|Ga0066654_10619306All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005591|Ga0070761_10977987All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium536Open in IMG/M
3300005618|Ga0068864_100264556All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300005713|Ga0066905_101356585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300005764|Ga0066903_104647689All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300006028|Ga0070717_11719102All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300006052|Ga0075029_101140900All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006059|Ga0075017_100913867All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300006102|Ga0075015_100030571All Organisms → cellular organisms → Bacteria2452Open in IMG/M
3300006162|Ga0075030_101435285All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006173|Ga0070716_100283096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1145Open in IMG/M
3300006176|Ga0070765_100007927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7225Open in IMG/M
3300006237|Ga0097621_100426636All Organisms → cellular organisms → Bacteria → Acidobacteria1191Open in IMG/M
3300006358|Ga0068871_100074606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2798Open in IMG/M
3300006791|Ga0066653_10568886All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300006796|Ga0066665_10565972All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300006797|Ga0066659_10567354All Organisms → cellular organisms → Bacteria → Proteobacteria918Open in IMG/M
3300006797|Ga0066659_11703061All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006844|Ga0075428_101474031All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300009171|Ga0105101_10531728All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300009628|Ga0116125_1089890All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300009630|Ga0116114_1027246All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300009759|Ga0116101_1173358All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010043|Ga0126380_10836048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85757Open in IMG/M
3300010048|Ga0126373_10432319All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300010048|Ga0126373_13024234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85524Open in IMG/M
3300010105|Ga0127470_1081232All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010366|Ga0126379_10591028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1194Open in IMG/M
3300010376|Ga0126381_100313266All Organisms → cellular organisms → Bacteria2154Open in IMG/M
3300010379|Ga0136449_104653782All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium502Open in IMG/M
3300010398|Ga0126383_12446975All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300010403|Ga0134123_11712661All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300011083|Ga0138560_1181413All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium536Open in IMG/M
3300011087|Ga0138570_1187966All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300011120|Ga0150983_12495327All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300011120|Ga0150983_15657776All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300011271|Ga0137393_10554916All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300012198|Ga0137364_10310273All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1172Open in IMG/M
3300012205|Ga0137362_10832795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium790Open in IMG/M
3300012205|Ga0137362_11188444All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300012208|Ga0137376_11380408All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012209|Ga0137379_11688709All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium530Open in IMG/M
3300012231|Ga0137465_1004620All Organisms → cellular organisms → Bacteria → Proteobacteria3911Open in IMG/M
3300012349|Ga0137387_10912493All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300012351|Ga0137386_10309459All Organisms → cellular organisms → Bacteria1137Open in IMG/M
3300012351|Ga0137386_10433345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium947Open in IMG/M
3300012357|Ga0137384_10079123All Organisms → cellular organisms → Bacteria2732Open in IMG/M
3300012359|Ga0137385_10203797Not Available1726Open in IMG/M
3300012360|Ga0137375_11129480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300012469|Ga0150984_117979095All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012582|Ga0137358_10239454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1236Open in IMG/M
3300012923|Ga0137359_11631728All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium532Open in IMG/M
3300012929|Ga0137404_10708520All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300012929|Ga0137404_11354474All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300012931|Ga0153915_11310794All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300012955|Ga0164298_10202511All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300012977|Ga0134087_10455919All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300012986|Ga0164304_10490548All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300012988|Ga0164306_11082323All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300013104|Ga0157370_10169793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2028Open in IMG/M
3300013297|Ga0157378_10977213All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300013308|Ga0157375_13025310All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300014154|Ga0134075_10381588All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300014166|Ga0134079_10114367All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300014169|Ga0181531_10860894All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300014199|Ga0181535_10733631All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300014493|Ga0182016_10585729All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300014658|Ga0181519_11007766All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium517Open in IMG/M
3300014745|Ga0157377_10490866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85856Open in IMG/M
3300015051|Ga0137414_1233403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1951Open in IMG/M
3300016371|Ga0182034_11325683All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300016387|Ga0182040_10391243All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300016404|Ga0182037_10481964All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300016750|Ga0181505_11203478All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300017934|Ga0187803_10317975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300017934|Ga0187803_10454811All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium523Open in IMG/M
3300017936|Ga0187821_10077729All Organisms → cellular organisms → Bacteria → Proteobacteria1207Open in IMG/M
3300017973|Ga0187780_10851426Not Available661Open in IMG/M
3300018001|Ga0187815_10154245All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300018034|Ga0187863_10108035All Organisms → cellular organisms → Bacteria1558Open in IMG/M
3300018038|Ga0187855_10013320All Organisms → cellular organisms → Bacteria5481Open in IMG/M
3300018062|Ga0187784_10273522All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300018062|Ga0187784_10296260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1313Open in IMG/M
3300018064|Ga0187773_10389518All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300018086|Ga0187769_10682928All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae776Open in IMG/M
3300018090|Ga0187770_11414659Not Available565Open in IMG/M
3300018090|Ga0187770_11760438All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium507Open in IMG/M
3300019787|Ga0182031_1414057All Organisms → cellular organisms → Bacteria1753Open in IMG/M
3300020001|Ga0193731_1091836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae786Open in IMG/M
3300020059|Ga0193745_1085812All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300020579|Ga0210407_11025908All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300020583|Ga0210401_11637271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85501Open in IMG/M
3300021080|Ga0210382_10407083All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300021088|Ga0210404_10540272All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300021171|Ga0210405_11113942All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300021178|Ga0210408_10608402All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300021374|Ga0213881_10444515All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300021401|Ga0210393_10633682All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300021401|Ga0210393_10759975All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300021401|Ga0210393_11659119All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium506Open in IMG/M
3300021402|Ga0210385_10394507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1039Open in IMG/M
3300021404|Ga0210389_10662860All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300021406|Ga0210386_11819980All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300021432|Ga0210384_11618706All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300021444|Ga0213878_10567217All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300021478|Ga0210402_11459152All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300021479|Ga0210410_10045073All Organisms → cellular organisms → Bacteria → Proteobacteria3839Open in IMG/M
3300021479|Ga0210410_11422940All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300021559|Ga0210409_10209308All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300021559|Ga0210409_11489742All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300021560|Ga0126371_12717897All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300021861|Ga0213853_10504675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae859Open in IMG/M
3300022557|Ga0212123_10410341All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300022731|Ga0224563_1024803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85542Open in IMG/M
3300022881|Ga0224545_1020186All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300023056|Ga0233357_1041952All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300025912|Ga0207707_10295143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1402Open in IMG/M
3300025922|Ga0207646_10598228All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300025931|Ga0207644_11806024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85511Open in IMG/M
3300025939|Ga0207665_11170792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300025939|Ga0207665_11676468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85503Open in IMG/M
3300025944|Ga0207661_10459690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1160Open in IMG/M
3300026075|Ga0207708_11489508All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300026295|Ga0209234_1296621All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300026315|Ga0209686_1190056All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300026326|Ga0209801_1297781All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300026327|Ga0209266_1145168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium969Open in IMG/M
3300026515|Ga0257158_1072074All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300026557|Ga0179587_10261287All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300026557|Ga0179587_10962509All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300026887|Ga0207805_1011912All Organisms → cellular organisms → Bacteria → Proteobacteria925Open in IMG/M
3300026911|Ga0209620_1020563All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300027117|Ga0209732_1094766All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300027161|Ga0208368_106643All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300027277|Ga0209846_1065478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85545Open in IMG/M
3300027678|Ga0209011_1130189All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300027706|Ga0209581_1253783All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300027783|Ga0209448_10014348All Organisms → cellular organisms → Bacteria2567Open in IMG/M
3300027867|Ga0209167_10377318All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300027889|Ga0209380_10887211All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium501Open in IMG/M
3300027911|Ga0209698_10209722All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300027911|Ga0209698_10261746All Organisms → cellular organisms → Bacteria1379Open in IMG/M
3300027911|Ga0209698_10679986All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300028776|Ga0302303_10044008All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300028874|Ga0302155_10494921All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium519Open in IMG/M
3300030494|Ga0310037_10438585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85536Open in IMG/M
3300030509|Ga0302183_10087357All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300030618|Ga0311354_10751098All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300031236|Ga0302324_102716370All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300031247|Ga0265340_10050782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2010Open in IMG/M
3300031474|Ga0170818_100993898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae836Open in IMG/M
3300031543|Ga0318516_10474198All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300031545|Ga0318541_10222933All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300031708|Ga0310686_107951703All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031708|Ga0310686_115311795All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium526Open in IMG/M
3300031731|Ga0307405_10388518All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300031740|Ga0307468_101163141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85692Open in IMG/M
3300031740|Ga0307468_102334375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85520Open in IMG/M
3300031754|Ga0307475_10216595All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1532Open in IMG/M
3300031770|Ga0318521_10726020All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300031793|Ga0318548_10095794All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300031794|Ga0318503_10076110All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300031820|Ga0307473_10414868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae886Open in IMG/M
3300031910|Ga0306923_10897614All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300031910|Ga0306923_11500280All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300031942|Ga0310916_10672142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300031946|Ga0310910_10325700All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300031946|Ga0310910_11309684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium → Rhizomicrobium electricum559Open in IMG/M
3300031954|Ga0306926_11556240All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300031962|Ga0307479_10090394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2969Open in IMG/M
3300032051|Ga0318532_10359517All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium517Open in IMG/M
3300032059|Ga0318533_10845431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300032261|Ga0306920_103493624All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300032783|Ga0335079_10226225All Organisms → cellular organisms → Bacteria2066Open in IMG/M
3300032892|Ga0335081_11288732All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300033134|Ga0335073_11523437All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300034819|Ga0373958_0001725All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2969Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.17%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.37%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.37%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.92%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.44%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.44%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.44%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.44%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.44%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.48%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.48%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.48%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.48%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.48%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.48%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.48%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.48%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.48%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.48%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.48%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.48%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.48%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.48%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.48%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.48%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.48%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.48%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001359Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002243Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010105Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011083Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011087Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026887Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes)EnvironmentalOpen in IMG/M
3300026911Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027161Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10709968433300000955SoilMYAVEMPFERIDVSGPELTERSQPGIHFLQRFRLQPV
A3035W6_104471713300001359PermafrostLIQAVEVAFERIHVSGPEPAKRSQPGRDLLKWFGFQPVETA
JGI12627J18819_1025640213300001867Forest SoilLTIDAVEVAFERIYVSGPEPAEGXQPGIELLKWFRFQSI
C687J29039_1020815123300002243SoilLIHAVEVAFESIHVSGPEPAERSQPGIHLLKRFWL
JGIcombinedJ26739_10030342213300002245Forest SoilVFHAVEVPFQRIHVIGPEAAELIQPGIHLLKWFRFQPVETA
JGIcombinedJ26739_10089063523300002245Forest SoilMRRLIHALLILVHAVEVTFESIDVSGPEAAELGQPGVHLLKWFRFQTIETALCVH
JGI25389J43894_106239913300002916Grasslands SoilERIDVSGPEPTELSQPGIRLLKRFWLQSAEAALCVHRRASWVS*
Ga0055432_1022391213300004022Natural And Restored WetlandsLIHVVEVAFEIIYVSGPEPAERSQPGIHLLKWFWLQSVEAA
Ga0063454_10191625523300004081SoilMAFERIDVSGPESTERRQPGIHFLKWFRFQPVDTALCVDGGF
Ga0062384_10129247713300004082Bog Forest SoilVAFEGIQVSGPEPAELCQPGIHLLKWFRSQPVETALCGYSGFH
Ga0062387_10127539213300004091Bog Forest SoilMHAVEVAFQSIYVRDPKPPERSQPGFQLLKRFRFQPVEAPLCVHCG
Ga0062589_10142421613300004156SoilMHAVEVAYERIDVRGPELPERRQPGIQLLKWFRRQPVKAALSVD
Ga0062590_10112944723300004157SoilMAFESIHMSGPEVAERCQPGIHLLKWFYFQPVETALCVHSTFHKTG
Ga0058863_1178621433300004799Host-AssociatedMLHAVKVAFESIYVSGPESAERVQPGIHLLKWFRFQPVETALCVHRGF
Ga0062594_10038837933300005093SoilMAFESVDVSRPKLTEGSQPLIDLLKLFGFQPVNAALCVHG
Ga0066680_1069067313300005174SoilLIHAVEVAFERIHVSGPELTERSQPGIHLLKWFRLQSVETAL
Ga0066676_1029886113300005186SoilMHAVEVAFESIHVSRPEPAERSQPGSDLLKWFRFQPVETAL
Ga0066388_10042613913300005332Tropical Forest SoilLIHAVEVAFEGIYVSGPEAAELRQPRIDLTKGFWPEPVKTALCIHR
Ga0066388_10215978933300005332Tropical Forest SoilLLHAVEVAFERIEVSGPKPTERSQPGIHLVKWFRFQSVET
Ga0070682_10149961223300005337Corn RhizosphereVAFESIDVSGPELTELSQPGIHLLKRLGLQSIQAPLCVHRGFDET
Ga0070688_10006759063300005365Switchgrass RhizosphereMAFERIDVRGPELAERREPGIQLAKGFRSQPVETALCVHR
Ga0066682_1081713113300005450SoilMHAVEVAFQSIDVSGPKPAELSQPHIHLLKRPWFQPVETALCVHRGF
Ga0066681_1070793423300005451SoilVTFESIHVRRPEPAERSEPGMHLLKRFWLQPVETALCIHR
Ga0066687_1074557513300005454SoilLIHAVEVAFESIHVSGPEPAERSQPGIHLLKWFRFQPVETAL
Ga0070706_10161865923300005467Corn, Switchgrass And Miscanthus RhizosphereVAFESIDVSGPELTERRQPGIHLLKWFRFQSVETALRVHRGF
Ga0070704_10031886933300005549Corn, Switchgrass And Miscanthus RhizosphereVIHAVEVAFERIHMTGPETAERSQPGLELLKWFRFQPIETTLCVH
Ga0066661_1056054613300005554SoilVAFESIYVSGPEPTERSQPGIHLLKWFRFQSVETALCVHRGFYET
Ga0066704_1037158313300005557SoilVAFERIDVSGPELAELRQPGIHLLEGFWLQAVEPALCVHRG
Ga0066700_1081679223300005559SoilLIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQPVETALCV
Ga0070664_10240227223300005564Corn RhizosphereLIHAVEVAFESIYVSGPEPTERSQPGIQLLKWFGFQPVETALCVYRG
Ga0066705_1084752623300005569SoilLIHVVKVPFERIHVSGPEPAERSQPGIHLLKRFWLQPVETAL
Ga0066654_1061930613300005587SoilLIHVVEVAFESIHVSGPEPTERSQPGIHLLKWFRFQPVETALCVHRG
Ga0070761_1097798723300005591SoilMLLMIHAIEVAFESIQVSGPEPAEPSQPGIQLLKWFRFQP
Ga0068864_10026455613300005618Switchgrass RhizosphereVIHAIEVAFESIQVDRPDPTERSEPRIHLLQWSRFQPVDTALCVH
Ga0066905_10135658513300005713Tropical Forest SoilLIHAVEVAFKRIYVSGPEAAERSEPGIDLLEWFRFQAV
Ga0066903_10464768913300005764Tropical Forest SoilMHEVEVAFQSINVGRPEPTELGEPVVDLLQRFGLQPVETALRV
Ga0070717_1171910223300006028Corn, Switchgrass And Miscanthus RhizosphereVIHTIKVAFESIHVGGPEPTELSQPGIDLPKRFRFQAVETA
Ga0075029_10114090023300006052WatershedsMHAVEVAFESIYMSGPEAAELGQPGIQLLKWFRVQPVETALCVHRG
Ga0075017_10091386713300006059WatershedsVAFESIYVSGPEPTERSQPGIHLLKWFRFQSVETALCVH
Ga0075015_10003057153300006102WatershedsMRSLIHAVEVAFESIYMSRPEPTERTQPGIDLLKWFRFQPVET
Ga0075030_10143528513300006162WatershedsVAFESIYVSGPEPAERSQPGIHLLKWFRFQPVETALC
Ga0070716_10028309633300006173Corn, Switchgrass And Miscanthus RhizosphereMAFKRIQMSGPETAKLSQPGIQLLKWFRVQAVETALCVHRGF
Ga0070765_100007927113300006176SoilMAFESIHVGGPEPPERRQPRIHLLKWFRFQPVETPLRV
Ga0097621_10042663633300006237Miscanthus RhizosphereMAFERIHMSGPEAAEGGQPGIHRLKGFRFQPVEAALGIHHRFDKTG
Ga0068871_10007460663300006358Miscanthus RhizosphereVIHAIEVAFESIQVDRPDPTERSEPRIHLLQWSRFQPV
Ga0066653_1056888623300006791SoilVAFQSIHVSGPELAERSQPGVYLQKWFWLQPVETALCVHRGFH
Ga0066665_1056597213300006796SoilLIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQPVE
Ga0066659_1056735433300006797SoilLIHAVEVAFESIHMIGPEPSEPIEPGIHLLKWFRF
Ga0066659_1170306113300006797SoilLIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQPVETA
Ga0075428_10147403113300006844Populus RhizosphereMAFESINVSGPEVTKRSQPGVKLLQRFVFQLVETTLSVHGAL
Ga0105101_1053172823300009171Freshwater SedimentLIHAVEVAFESIHVSGPEPTEGSQPGSDLLKWFRFQPVETALCV
Ga0116125_108989033300009628PeatlandMILVTIHAVEVPFQSIYVSGPEPAELIQPGIDLLKWFRSQPVK
Ga0116114_102724613300009630PeatlandLIHAVEVAFECIYVNGPEPAELSQPGIHLLKWRRSQPVET
Ga0116101_117335823300009759PeatlandMHTVKMAFECIDVSGPEPAELSQPRIELLEWSRFQPVETALCVH
Ga0126380_1083604813300010043Tropical Forest SoilVAFERIYVSGPELTERSQPGIHLLKWFRFQSVETPL
Ga0126373_1043231913300010048Tropical Forest SoilMYAVEVALKGIHVSGPEAPKLSQPGIDLLQWSGFQPVETALR
Ga0126373_1302423413300010048Tropical Forest SoilLVEVAFESIYVSGPEPPERSQPGVHLLKWLWLQSVETALSV
Ga0127470_108123213300010105Grasslands SoilVVEVAFESIQMSGPGPAERSQPGIHLLKWFRFEPVET
Ga0126379_1059102833300010366Tropical Forest SoilMAFESIYVSRPEPAEWSKPGIDLFKWFRFQPVEAALCVHGGFYET
Ga0126381_10031326613300010376Tropical Forest SoilLIHELEVAFESIQVNGPELAELRQPRVHLLKWFGFETVK
Ga0136449_10465378223300010379Peatlands SoilLFDAVEVAFESVYVSGPEAAELREPVIHLLKWFRFQPVETP
Ga0126383_1244697513300010398Tropical Forest SoilLVEVPFERIDVSGPELTERSKPGIHFLKWLRFQPVETALRV
Ga0134123_1171266113300010403Terrestrial SoilMAFESIHVSGPEPTEGSQPSSDLLKWFRLQSVETALGVYSG
Ga0138560_118141313300011083Peatlands SoilLIHAVEVAFESIDVSGPEPTERSQPSIHLLKWFRFQSVETALCVHR
Ga0138570_118796613300011087Peatlands SoilLIHAVKVAFESIYVRGPEPAERSQPGFDLLKWFRFQPVETALSV
Ga0150983_1249532713300011120Forest SoilLIHAVEVAFESIYVSGPEPAERSQPGIQLLKWFRF
Ga0150983_1565777613300011120Forest SoilMLLRIHPIEVAFESIQVSGPEAAEPGQPGIQFLKWFRFQPVETAL
Ga0137393_1055491633300011271Vadose Zone SoilMIHAVEVAFESIHVSGPEPAEPGQPGIQLLKWFRFQPVETALR
Ga0137364_1031027313300012198Vadose Zone SoilLIHAVEVAFERIHVSRPEPAERSQPGSDLLKWFRFQ
Ga0137362_1083279513300012205Vadose Zone SoilVAFESIQVSGPEPAERSQPGIDLLKWFRFQPVETA
Ga0137362_1118844413300012205Vadose Zone SoilVAFQSIQVSGPEPAERSQPGIHLLKWFRFQSVETALC
Ga0137376_1138040813300012208Vadose Zone SoilMAFESIHVSGPEPAERSQPGIHLLKRFRFQSLETALCVHRG
Ga0137379_1168870913300012209Vadose Zone SoilVVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQPVETALC
Ga0137465_100462073300012231SoilLIHAVEVAFERIDVSGPELAERRQPGIHLPKWFGSQ
Ga0137387_1091249323300012349Vadose Zone SoilLIDAVEVAFEGIYVSGPEPTELRQPGIQLLKWFRFQPVETALCVH
Ga0137386_1030945933300012351Vadose Zone SoilLHTVEVPFQRIHVSGPEPAELLKPGIHLLKWSWLQPVETALCVH
Ga0137386_1043334513300012351Vadose Zone SoilVAFESIYMSGPEPTERSQPGIQLLKRFWLQSVETAL
Ga0137384_1007912313300012357Vadose Zone SoilLIHAVEVTFESIHVSGPEPTERRQPGSDLLKWFRFQSVETAL
Ga0137385_1020379713300012359Vadose Zone SoilLIHAVEVAFESIYVSGPEPTELSHPGIYFRKWFRFQSVETALC
Ga0137375_1112948023300012360Vadose Zone SoilVVQVPFESIYVSGPESTERSQPGIHLLKWFWLQLVETALCVH
Ga0150984_11797909523300012469Avena Fatua RhizosphereMHAIEVAFESLHVSGPEPAERSEPGLHLLKWLRFQAVETALCVHGG
Ga0137358_1023945413300012582Vadose Zone SoilVAFESIYVIGPNPAELNQPVIHLLKWFRFQPVETALC
Ga0137359_1163172823300012923Vadose Zone SoilMAFESIYVSGPKPAELSQPGIELLKWFRFQPVETALCVH
Ga0137404_1070852033300012929Vadose Zone SoilLIHAVEVAFESIYASGPEPTEGNQPGNHLLKWFWLQSVETAL
Ga0137404_1135447433300012929Vadose Zone SoilVALESIEMSGPEPAERSQPGIHFLKWFWLQAVETALGVHGGLH
Ga0153915_1131079433300012931Freshwater WetlandsLIHAVEVAFESIYVSGQEPPERSQPGSDLLKWFRFQSVET
Ga0164298_1020251113300012955SoilMLHAVKVAFESIYVSGPESAERVQPGIHLLKWFRF
Ga0134087_1045591923300012977Grasslands SoilLTIHAVEVAFESIQVSGPKPAELSQPHIDLLKRFRSQPIETPLCVHRG
Ga0164304_1049054833300012986SoilLITVHAVEVAFESVDVSGPEAAKLSQPGIQFLKWFRFQAV
Ga0164306_1108232323300012988SoilLIHAVEVAFESIHVSGPEPAERSQPGVNLLKWFGFQPIETALCI
Ga0157370_1016979353300013104Corn RhizosphereMLHAVKVAFESIYVSGPESAERVQPGIHLLKWFRFQPVETALCVHRGFH
Ga0157378_1097721313300013297Miscanthus RhizosphereLIHSVEVAFESIYVSGPELTEWSQPVIDLLKWFGSQPVETALRVHS*
Ga0157375_1302531023300013308Miscanthus RhizosphereLIHPVEVAFESIYVSGPEPPERSQPRIDLLERFRSQPVETALRV
Ga0134075_1038158813300014154Grasslands SoilLIHAVEVAFERIHVSRPEPTERSQPGSDLLKWFRFQSVETALGVHRG
Ga0134079_1011436713300014166Grasslands SoilLSHAVEVAFESIHMSEPEPTELRQPGIHLLQWFGLQAVETA
Ga0181531_1086089423300014169BogMGAVEVAFESIYMSGPEPAERGQPVVHRLKWFRSQSI
Ga0181535_1073363123300014199BogMAPIHAIKVAFESIHVSGPKASELSQPRIHLSKWF
Ga0182016_1058572923300014493BogVAFEGIDVRGPEAAELSQPGIDFLKSFRFQPVETALCV
Ga0181519_1100776613300014658BogLIHAVEVSFQSIYVSGPEPTEGSQPGIDLLKWFRLQSIETALSV
Ga0157377_1049086613300014745Miscanthus RhizosphereMAFERIDVSGPELAERRQPGVDFLEWFGFQPVETALC
Ga0137414_123340343300015051Vadose Zone SoilMAFESIYVSGPETAELSQPRIDFLKWFRFQPVEAALCIYR*
Ga0182034_1132568313300016371SoilMALESVHVSGPESAERSQPGIHLLKSLRLQPVETPLCVHLGFHET
Ga0182040_1039124313300016387SoilVAFESIYVSRPEPTELSQPGIHLLKWFRFQSIEAALCIHG
Ga0182037_1048196413300016404SoilMLHAIEIAFKSIYVTGPEPTELSQPGIQLLKRCWFQAVEAAL
Ga0181505_1120347813300016750PeatlandVAFESIDVSGPEAAERSQPVIHLLKRFWLQTVETAL
Ga0187803_1031797523300017934Freshwater SedimentVVEVAFESIYVSGPEPTERSQPVIDLLKWFWLQSVETALCVH
Ga0187803_1045481113300017934Freshwater SedimentVAFESIYVSRPEPAERSQPGIDLLKRSWLQPVETAL
Ga0187821_1007772913300017936Freshwater SedimentMHAIEVAFESIDVNRPEPAELGQPGIHLPKWFRFQPVETTLRI
Ga0187780_1085142613300017973Tropical PeatlandMHAVEMAFESVYVSGPEPAELSQPGIHLLKSFWLQPVET
Ga0187815_1015424513300018001Freshwater SedimentVVEVAFESISASGPGPTERGQPDIHLMKWFRFQPVEAPPFK
Ga0187863_1010803513300018034PeatlandVRRLAHAALIHIHSVEVAFESIHVGRPEPAELCQPGIHLLKWFRFQSIETALCVHC
Ga0187855_1001332013300018038PeatlandVIHAVEVAFESIHVSGPEPAEWSQPGIHLLKGFRFQPVETALCVH
Ga0187784_1027352243300018062Tropical PeatlandMIHAFEVAFESIYVSRPEPAERSQPGIHLLKWLRFQPVE
Ga0187784_1029626033300018062Tropical PeatlandLIHPIKVAFQSVYVSRPEPAELSQPGIHLLKSFWLQ
Ga0187773_1038951813300018064Tropical PeatlandLIHAVEVTFESIHVSGPEPTERSQPSVDLLKRFRLQPVKT
Ga0187769_1068292813300018086Tropical PeatlandMHAIEVAFESIHVSGPEPAELSQPVIHLLKWFRFQPVETALCVHSG
Ga0187770_1141465913300018090Tropical PeatlandLTHAVEVAFESIYMSGPEPAERSQPGIHLLKRFWLQPVETAL
Ga0187770_1176043813300018090Tropical PeatlandVAFESIYMSGPEPAERSQPGIHLLKRFWLQPVETAL
Ga0182031_141405753300019787BogVAFEGIDVRGPEAAELSQPGIDFLKSFRFQPVETALC
Ga0193731_109183633300020001SoilLIHAIEVALESIHVRGPDPTERSQPVIQLLKWFGSQPVETALCV
Ga0193745_108581213300020059SoilMQPVQVALERIYMSGPEPPERCQPGIELLKTFRFQ
Ga0210407_1102590823300020579SoilVIHAVQVALESIYVSGPEPAERSQPGIDLLKWFRFQPVKAALCVHRG
Ga0210401_1163727113300020583SoilVVEVAFESIDVSGPEPAERSQPGIHLLKWFRFQPVETALRGHR
Ga0210382_1040708323300021080Groundwater SedimentMHTVEVAFESIHVSGPEPTERGQPGSDLLKWFRFQPVETALCVH
Ga0210404_1054027213300021088SoilMQTLIHAVEVAFESIQMSGPEPAELSQPSIHLLKWFRFQPVETALCVHR
Ga0210405_1111394213300021171SoilVAFQSIHVSGPEPAERSQPGFDLLKWFRLHSVETA
Ga0210408_1060840213300021178SoilLSHAVEVAFKSIYVSGPEPAELSQPGIQLLKWFRSQPVETALCV
Ga0213881_1044451513300021374Exposed RockLIYAVEVAFESIYVSGPEPAERSQPGVYLLKWFRF
Ga0210393_1063368213300021401SoilLIHAVEVAFESIHMSGPEATELSQPGIDLLKWFRFQPVEAALCVH
Ga0210393_1075997533300021401SoilMFHAVEVSFESIYVSRPEPTERSQPGVDLLKRFRFHPVETAL
Ga0210393_1165911913300021401SoilLIHAVEVAFESIYVSGPEPTERSQPGIDLLKWFRFQPVETA
Ga0210385_1039450713300021402SoilLHAVEVAFESIYMSGPEPTERSQPSIDLLKRFRFQP
Ga0210389_1066286013300021404SoilLVHPIKVAFESIHVSRPEPAETGQPGIQLLEWFRLQLVETA
Ga0210386_1181998013300021406SoilLIHAVEVSFESIHVSGPKATEPSQPGIQLFEWFRFQ
Ga0210384_1161870623300021432SoilLNFFDVPHAVEVAFESIYVSGPEPAEWSQPGIQLLKRFR
Ga0213878_1056721723300021444Bulk SoilMLHTVEVAFERIYVSGPEPTERRQPGVQLLKRLKLQPVE
Ga0210402_1145915223300021478SoilMIHAVEVAFEGIHVRRPEPAERSQPGIHLLKWFRLQPIETALCVHR
Ga0210410_1004507363300021479SoilLIHAVEVAFESIYVSGPEPTERSQPGIHFLKGFRFQ
Ga0210410_1142294023300021479SoilMRRLIHAVEVAFESVQMSGPESAELSQPGIHLLKWFRLQPVETALCV
Ga0210409_1020930813300021559SoilLIHAVEVAFESIYVSRPEPTERSQPGIDLVKWGRFQPVETALC
Ga0210409_1148974223300021559SoilMHAVKVAFESIDVSGPEAAELSQPGVHLLKWFRSQ
Ga0126371_1271789723300021560Tropical Forest SoilMAFESIHVSRPEPPELSQPGIELLKWPRFEAVKTAL
Ga0213853_1050467513300021861WatershedsLIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRLQPVEA
Ga0212123_1041034113300022557Iron-Sulfur Acid SpringMRTLIHAVEVAFESIQMSGPEPAELSQPGIHLLKWFRLQPVETAL
Ga0224563_102480323300022731SoilMSGPKSTELSQPVIHLLKWSRFEPVEAALRVHRGFHETG
Ga0224545_102018613300022881SoilLIHVIHAVEVAFESIYVSGPEPAERSQPGIDLLKWFRFQPVEAAL
Ga0233357_104195223300023056SoilMRTLSHAVEVPFESIQVSGPEPAERSQPGIQLLERFRFQP
Ga0207707_1029514343300025912Corn RhizosphereMLHAVKVAFESIYVSGPESAERVQPGIHLLKWFRFQPVETALCV
Ga0207646_1059822813300025922Corn, Switchgrass And Miscanthus RhizosphereLIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQSVETA
Ga0207644_1180602423300025931Switchgrass RhizosphereVALESIHVSGPEATELSEPHIQLSKWSRLQAVETALRV
Ga0207665_1117079213300025939Corn, Switchgrass And Miscanthus RhizosphereLNFFGVPHAVEVAFESIYMSGPEPPEWSQPSIQLLK
Ga0207665_1167646813300025939Corn, Switchgrass And Miscanthus RhizosphereVIDAVEVTFERIEASGPEPAERSQPGVHLLQWFRFQSVDTTLC
Ga0207661_1045969013300025944Corn RhizosphereMLHAVKVAFESIYVSGPESAERIQPGIHLLKWFRFQPVETALCVHRG
Ga0207708_1148950813300026075Corn, Switchgrass And Miscanthus RhizosphereLVHAIEVALEPIDMTGPEPTERIQPGIQFLKWFWLQSVKA
Ga0209234_129662123300026295Grasslands SoilLIHAVEVAFERIDVSGPEPTELSQPGIRLLKRFWLQSA
Ga0209686_119005613300026315SoilLIHAVEVAFESIYVSGPEPTERSQLGIHLLKWFRF
Ga0209801_129778123300026326SoilLIHAVEVAFESIHVSGPEPAERSQPGSDLLKWFRFQSVET
Ga0209266_114516813300026327SoilLIHAVEVAFESIYVSGPEPTERSQPGSDLLKWFRFQP
Ga0257158_107207413300026515SoilLIHAVEVAFESIYMSGPEPTELSQPGIQLLKWFWLQ
Ga0179587_1026128743300026557Vadose Zone SoilVAFKSIEVSGPEPTKRSQPGIDLLKRLRLQPVETALCV
Ga0179587_1096250913300026557Vadose Zone SoilLIHAVEVAFESIYVSGPEPTERSQPGIQLLKWFGFQSVETA
Ga0207805_101191213300026887Tropical Forest SoilMPFERVYVGGPEPSKRSQPFIHLLKRFGLQAVETALRVYCRF
Ga0209620_102056313300026911Forest SoilMAFESVHVNGPETPERSQPGIHLLKWFRSQPVETP
Ga0209732_109476623300027117Forest SoilVWVYVRIYAVEVAFESIYVSGPEPAERRQPHIHLLK
Ga0208368_10664323300027161Forest SoilLIHAVEVAFEGIHVSGPEPAERSQPGIDLLKWFRFQPVETALCVHCR
Ga0209846_106547813300027277Groundwater SandMAFESIHVSGPEPTERSQPGSDLLKWFRFQSVETALCVHRG
Ga0209011_113018923300027678Forest SoilLIHAVEVAFESIYVSGPEPTERSQPGIDLLKWFRFQP
Ga0209581_125378313300027706Surface SoilMVEVVFKSIHMSGPESAERSQPGIYLLKWFRLQPV
Ga0209448_1001434853300027783Bog Forest SoilMRSLPHTVEVAFESIYVRGPEPAELSQPRIYLLKWFRFQPV
Ga0209167_1037731813300027867Surface SoilVAFESIQVSGPESAEWSQPHIDLLKWFRFQPVETALCVHRGFYET
Ga0209380_1088721123300027889SoilLNFFGVPHAVEVALERIHVSGPEPAERSQPGIDLLKWFRFQPVETALC
Ga0209698_1020972243300027911WatershedsVIHVIHVIHAVEVAFESIYARGPEPAEWSQPRIHFLKWF
Ga0209698_1026174613300027911WatershedsLIHAVEVAFESIYVSGPEPAERSQPGIDLLKWFRFQPVE
Ga0209698_1067998613300027911WatershedsVAFESIYVSGPEPTERSQPGSDLLKWFRFQTVETALCVH
Ga0302303_1004400813300028776PalsaLIDAIEVAFESIYVSGPEPTERSQPGIHLLKWLRFQSVETA
Ga0302155_1049492113300028874BogMLYTVKVAFESVDVRGPEAAEAGQPGIQLLKRFRLQPVE
Ga0310037_1043858523300030494Peatlands SoilLIHAVEVTFESIYVSGPEPAELSQPGIHLLKWFRFQPVETALCV
Ga0302183_1008735713300030509PalsaMAFESIQVCGPEPTERSQPGIHLLKWFRFQSVETALCVHRGFHET
Ga0311354_1075109833300030618PalsaMFFGVIHVVEVAFERIYVSGPEPAERSQPGIHLLQWFRL
Ga0302324_10271637023300031236PalsaMAFKRIYVNRPEPPEGSQPGIYLLKWFRFQPVEPALRVHR
Ga0265340_1005078213300031247RhizosphereLIHAVEVAFESIQVSGPEPAERSQPGIHFLKWLGF
Ga0170818_10099389833300031474Forest SoilMPDAVEVAFESIQVRGPEPAEPSQPGIHLLKGFRSQPVETALC
Ga0318516_1047419813300031543SoilVAFESIYVSRPAPTERSQPGIHLLKWFRFQSIEAALCIHGGLHET
Ga0318541_1022293313300031545SoilVVQIALECIDMCGPEPSERRQPRLHLLKWFRFQAVETAL
Ga0310686_10795170323300031708SoilVFFYRFWQIHAVEVTFESIQVGGPEAAKLSHPGFDFLKWFGFQPV
Ga0310686_11531179513300031708SoilLIHTIFIHAIEVAFESVHVSRPEAAELSQPRIHLSQWFRLQPVETALS
Ga0307405_1038851833300031731RhizosphereLIHAVEVAFESIYMSGPKPAERSQPGIHLLKWFRFQSVE
Ga0307468_10116314113300031740Hardwood Forest SoilLIHSVEVAFESIYVSGPELTEWSQPVIDLLKWFGSQPIETALRV
Ga0307468_10233437513300031740Hardwood Forest SoilMRTLIHAVEVAFESIQVSGPEPAEWSQPGIHLLKWFRFQTVESAL
Ga0307475_1021659513300031754Hardwood Forest SoilMAFESVHMNGPETPERSQPGIHLLKWFRSQPIETPLCVH
Ga0318521_1072602013300031770SoilMLDAVEVAFESIHVSGPEPAERSQPGIDLLKWFRFQPVETT
Ga0318548_1009579433300031793SoilVAFESIYVSRPEPTELSQPGIHLLKWFRFQSIEAALCIHGGLHE
Ga0318503_1007611033300031794SoilMLDAVEVAFESIHVSGPEPAERSQPGIDLLKWFRFQPVETTLSVHPG
Ga0307473_1041486833300031820Hardwood Forest SoilMRMLIHAVEVAFESIQVSGPEPAELSQPGIHLLKWFRFQPVETALC
Ga0306923_1089761413300031910SoilLLDAVEVAFESIHVSGPEPAERSQPGIDLLKWFRFQPVETA
Ga0306923_1150028023300031910SoilLIHAVEVAFESIYVGRPEPTELGQPGIDLLKWFRSQPVETALCVH
Ga0310916_1067214213300031942SoilLIFFGVPHAVEVALKSIYVSGPKPAERSQPGIHLLEWFWLQPVETPL
Ga0310910_1032570013300031946SoilVAFESIYVSRPEPTELSQPGIHLLKWFRFQSIEAALCI
Ga0310910_1130968413300031946SoilLLQAVEVAFESIYVIGPEAAERSEPGIQLLKWLGFQPVETALCIHCRFHK
Ga0306926_1155624033300031954SoilVAFESIYVSRPEPTELSQPGIHLLKWFRFQSIEAAL
Ga0307479_1009039483300031962Hardwood Forest SoilLIHAVEVAFKSIQVSGPEPTELSQPGIEFLQWLRSQAVKTALCVHC
Ga0318532_1035951723300032051SoilMQAVEVAFESVDVNGPKPAELLQPGIHLLKWFRFQPVETALC
Ga0318533_1084543113300032059SoilVAEVAFESIYVSGLEPMERSQPRIDLPKWLWLQSVET
Ga0306920_10349362423300032261SoilMLHAIEIAFKSIYVTGPEPTELSQPGIQLLKRCWFQA
Ga0335079_1022622513300032783SoilLIHAIEVTFESLDMSGPEPAELSQPAIHLLKWPWFQSVETALC
Ga0335081_1128873233300032892SoilMAFESIEMPGPKSAELRQPDIQLLKRFRFQPVETAL
Ga0335073_1152343713300033134SoilLLHTVEVALESIDVSGPETAELFQPGIDLLKWFWLQP
Ga0373958_0001725_2838_29693300034819Rhizosphere SoilMIHAIEVAFESIYVSGPEPAERCQPRIHLLEWFRFEAVQTALSI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.