| Basic Information | |
|---|---|
| Family ID | F024003 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 208 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LIHAVEVAFESIHVSGPEPAERSQPGIHLLKWFRFQPVETAL |
| Number of Associated Samples | 185 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.75 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 92.79 % |
| Associated GOLD sequencing projects | 182 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.558 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.942 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.269 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF08327 | AHSA1 | 41.35 |
| PF00903 | Glyoxalase | 40.38 |
| PF10604 | Polyketide_cyc2 | 4.81 |
| PF08818 | DUF1801 | 3.37 |
| PF13564 | DoxX_2 | 2.40 |
| PF12681 | Glyoxalase_2 | 2.40 |
| PF08240 | ADH_N | 0.48 |
| PF00884 | Sulfatase | 0.48 |
| PF13376 | OmdA | 0.48 |
| PF07394 | DUF1501 | 0.48 |
| PF01872 | RibD_C | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 3.37 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 3.37 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 3.37 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.48 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.56 % |
| Unclassified | root | N/A | 1.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_107099684 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300001359|A3035W6_1044717 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300001867|JGI12627J18819_10256402 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300002243|C687J29039_10208151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 687 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100303422 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100890635 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300002916|JGI25389J43894_1062399 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300004022|Ga0055432_10223912 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300004081|Ga0063454_101916255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 522 | Open in IMG/M |
| 3300004082|Ga0062384_101292477 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 534 | Open in IMG/M |
| 3300004091|Ga0062387_101275392 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300004156|Ga0062589_101424216 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11 | 677 | Open in IMG/M |
| 3300004157|Ga0062590_101129447 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300004799|Ga0058863_11786214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 816 | Open in IMG/M |
| 3300005093|Ga0062594_100388379 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300005174|Ga0066680_10690673 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005186|Ga0066676_10298861 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300005332|Ga0066388_100426139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1970 | Open in IMG/M |
| 3300005332|Ga0066388_102159789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1003 | Open in IMG/M |
| 3300005337|Ga0070682_101499612 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005365|Ga0070688_100067590 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300005450|Ga0066682_10817131 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005451|Ga0066681_10707934 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005454|Ga0066687_10745575 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005467|Ga0070706_101618659 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005549|Ga0070704_100318869 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300005554|Ga0066661_10560546 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005557|Ga0066704_10371583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
| 3300005559|Ga0066700_10816792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 626 | Open in IMG/M |
| 3300005564|Ga0070664_102402272 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005569|Ga0066705_10847526 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005587|Ga0066654_10619306 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005591|Ga0070761_10977987 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 536 | Open in IMG/M |
| 3300005618|Ga0068864_100264556 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300005713|Ga0066905_101356585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300005764|Ga0066903_104647689 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300006028|Ga0070717_11719102 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006052|Ga0075029_101140900 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006059|Ga0075017_100913867 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006102|Ga0075015_100030571 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
| 3300006162|Ga0075030_101435285 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006173|Ga0070716_100283096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1145 | Open in IMG/M |
| 3300006176|Ga0070765_100007927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7225 | Open in IMG/M |
| 3300006237|Ga0097621_100426636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300006358|Ga0068871_100074606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2798 | Open in IMG/M |
| 3300006791|Ga0066653_10568886 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006796|Ga0066665_10565972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300006797|Ga0066659_10567354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300006797|Ga0066659_11703061 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006844|Ga0075428_101474031 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300009171|Ga0105101_10531728 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300009628|Ga0116125_1089890 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300009630|Ga0116114_1027246 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300009759|Ga0116101_1173358 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010043|Ga0126380_10836048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 757 | Open in IMG/M |
| 3300010048|Ga0126373_10432319 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300010048|Ga0126373_13024234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 524 | Open in IMG/M |
| 3300010105|Ga0127470_1081232 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010366|Ga0126379_10591028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1194 | Open in IMG/M |
| 3300010376|Ga0126381_100313266 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300010379|Ga0136449_104653782 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 502 | Open in IMG/M |
| 3300010398|Ga0126383_12446975 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010403|Ga0134123_11712661 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300011083|Ga0138560_1181413 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 536 | Open in IMG/M |
| 3300011087|Ga0138570_1187966 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300011120|Ga0150983_12495327 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300011120|Ga0150983_15657776 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300011271|Ga0137393_10554916 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300012198|Ga0137364_10310273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1172 | Open in IMG/M |
| 3300012205|Ga0137362_10832795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 790 | Open in IMG/M |
| 3300012205|Ga0137362_11188444 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012208|Ga0137376_11380408 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012209|Ga0137379_11688709 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 530 | Open in IMG/M |
| 3300012231|Ga0137465_1004620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3911 | Open in IMG/M |
| 3300012349|Ga0137387_10912493 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012351|Ga0137386_10309459 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300012351|Ga0137386_10433345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 947 | Open in IMG/M |
| 3300012357|Ga0137384_10079123 | All Organisms → cellular organisms → Bacteria | 2732 | Open in IMG/M |
| 3300012359|Ga0137385_10203797 | Not Available | 1726 | Open in IMG/M |
| 3300012360|Ga0137375_11129480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012469|Ga0150984_117979095 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012582|Ga0137358_10239454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1236 | Open in IMG/M |
| 3300012923|Ga0137359_11631728 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 532 | Open in IMG/M |
| 3300012929|Ga0137404_10708520 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012929|Ga0137404_11354474 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012931|Ga0153915_11310794 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012955|Ga0164298_10202511 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300012977|Ga0134087_10455919 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012986|Ga0164304_10490548 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300012988|Ga0164306_11082323 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300013104|Ga0157370_10169793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2028 | Open in IMG/M |
| 3300013297|Ga0157378_10977213 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300013308|Ga0157375_13025310 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300014154|Ga0134075_10381588 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300014166|Ga0134079_10114367 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300014169|Ga0181531_10860894 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300014199|Ga0181535_10733631 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300014493|Ga0182016_10585729 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300014658|Ga0181519_11007766 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 517 | Open in IMG/M |
| 3300014745|Ga0157377_10490866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 856 | Open in IMG/M |
| 3300015051|Ga0137414_1233403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1951 | Open in IMG/M |
| 3300016371|Ga0182034_11325683 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300016387|Ga0182040_10391243 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300016404|Ga0182037_10481964 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300016750|Ga0181505_11203478 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300017934|Ga0187803_10317975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300017934|Ga0187803_10454811 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 523 | Open in IMG/M |
| 3300017936|Ga0187821_10077729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1207 | Open in IMG/M |
| 3300017973|Ga0187780_10851426 | Not Available | 661 | Open in IMG/M |
| 3300018001|Ga0187815_10154245 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300018034|Ga0187863_10108035 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300018038|Ga0187855_10013320 | All Organisms → cellular organisms → Bacteria | 5481 | Open in IMG/M |
| 3300018062|Ga0187784_10273522 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300018062|Ga0187784_10296260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1313 | Open in IMG/M |
| 3300018064|Ga0187773_10389518 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300018086|Ga0187769_10682928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 776 | Open in IMG/M |
| 3300018090|Ga0187770_11414659 | Not Available | 565 | Open in IMG/M |
| 3300018090|Ga0187770_11760438 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 507 | Open in IMG/M |
| 3300019787|Ga0182031_1414057 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300020001|Ga0193731_1091836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 786 | Open in IMG/M |
| 3300020059|Ga0193745_1085812 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300020579|Ga0210407_11025908 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300020583|Ga0210401_11637271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 501 | Open in IMG/M |
| 3300021080|Ga0210382_10407083 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021088|Ga0210404_10540272 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021171|Ga0210405_11113942 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021178|Ga0210408_10608402 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300021374|Ga0213881_10444515 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300021401|Ga0210393_10633682 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300021401|Ga0210393_10759975 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300021401|Ga0210393_11659119 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 506 | Open in IMG/M |
| 3300021402|Ga0210385_10394507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1039 | Open in IMG/M |
| 3300021404|Ga0210389_10662860 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300021406|Ga0210386_11819980 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300021432|Ga0210384_11618706 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300021444|Ga0213878_10567217 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300021478|Ga0210402_11459152 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300021479|Ga0210410_10045073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3839 | Open in IMG/M |
| 3300021479|Ga0210410_11422940 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300021559|Ga0210409_10209308 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300021559|Ga0210409_11489742 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021560|Ga0126371_12717897 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300021861|Ga0213853_10504675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 859 | Open in IMG/M |
| 3300022557|Ga0212123_10410341 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300022731|Ga0224563_1024803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 542 | Open in IMG/M |
| 3300022881|Ga0224545_1020186 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300023056|Ga0233357_1041952 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300025912|Ga0207707_10295143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1402 | Open in IMG/M |
| 3300025922|Ga0207646_10598228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300025931|Ga0207644_11806024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 511 | Open in IMG/M |
| 3300025939|Ga0207665_11170792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300025939|Ga0207665_11676468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 503 | Open in IMG/M |
| 3300025944|Ga0207661_10459690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1160 | Open in IMG/M |
| 3300026075|Ga0207708_11489508 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300026295|Ga0209234_1296621 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026315|Ga0209686_1190056 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026326|Ga0209801_1297781 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300026327|Ga0209266_1145168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300026515|Ga0257158_1072074 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300026557|Ga0179587_10261287 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300026557|Ga0179587_10962509 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300026887|Ga0207805_1011912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300026911|Ga0209620_1020563 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027117|Ga0209732_1094766 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027161|Ga0208368_106643 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300027277|Ga0209846_1065478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 545 | Open in IMG/M |
| 3300027678|Ga0209011_1130189 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300027706|Ga0209581_1253783 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027783|Ga0209448_10014348 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300027867|Ga0209167_10377318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300027889|Ga0209380_10887211 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 501 | Open in IMG/M |
| 3300027911|Ga0209698_10209722 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300027911|Ga0209698_10261746 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300027911|Ga0209698_10679986 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300028776|Ga0302303_10044008 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300028874|Ga0302155_10494921 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 519 | Open in IMG/M |
| 3300030494|Ga0310037_10438585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 536 | Open in IMG/M |
| 3300030509|Ga0302183_10087357 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300030618|Ga0311354_10751098 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300031236|Ga0302324_102716370 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031247|Ga0265340_10050782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2010 | Open in IMG/M |
| 3300031474|Ga0170818_100993898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 836 | Open in IMG/M |
| 3300031543|Ga0318516_10474198 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031545|Ga0318541_10222933 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300031708|Ga0310686_107951703 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031708|Ga0310686_115311795 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 526 | Open in IMG/M |
| 3300031731|Ga0307405_10388518 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300031740|Ga0307468_101163141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 692 | Open in IMG/M |
| 3300031740|Ga0307468_102334375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-85 | 520 | Open in IMG/M |
| 3300031754|Ga0307475_10216595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1532 | Open in IMG/M |
| 3300031770|Ga0318521_10726020 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031793|Ga0318548_10095794 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300031794|Ga0318503_10076110 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031820|Ga0307473_10414868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 886 | Open in IMG/M |
| 3300031910|Ga0306923_10897614 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300031910|Ga0306923_11500280 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031942|Ga0310916_10672142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300031946|Ga0310910_10325700 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300031946|Ga0310910_11309684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium → Rhizomicrobium electricum | 559 | Open in IMG/M |
| 3300031954|Ga0306926_11556240 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300031962|Ga0307479_10090394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2969 | Open in IMG/M |
| 3300032051|Ga0318532_10359517 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 517 | Open in IMG/M |
| 3300032059|Ga0318533_10845431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300032261|Ga0306920_103493624 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032783|Ga0335079_10226225 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300032892|Ga0335081_11288732 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300033134|Ga0335073_11523437 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300034819|Ga0373958_0001725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2969 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.37% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.44% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.44% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.44% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.48% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.48% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.48% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.48% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.48% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.48% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.48% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.48% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.48% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.48% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.48% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.48% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.48% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011083 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1070996843 | 3300000955 | Soil | MYAVEMPFERIDVSGPELTERSQPGIHFLQRFRLQPV |
| A3035W6_10447171 | 3300001359 | Permafrost | LIQAVEVAFERIHVSGPEPAKRSQPGRDLLKWFGFQPVETA |
| JGI12627J18819_102564021 | 3300001867 | Forest Soil | LTIDAVEVAFERIYVSGPEPAEGXQPGIELLKWFRFQSI |
| C687J29039_102081512 | 3300002243 | Soil | LIHAVEVAFESIHVSGPEPAERSQPGIHLLKRFWL |
| JGIcombinedJ26739_1003034221 | 3300002245 | Forest Soil | VFHAVEVPFQRIHVIGPEAAELIQPGIHLLKWFRFQPVETA |
| JGIcombinedJ26739_1008906352 | 3300002245 | Forest Soil | MRRLIHALLILVHAVEVTFESIDVSGPEAAELGQPGVHLLKWFRFQTIETALCVH |
| JGI25389J43894_10623991 | 3300002916 | Grasslands Soil | ERIDVSGPEPTELSQPGIRLLKRFWLQSAEAALCVHRRASWVS* |
| Ga0055432_102239121 | 3300004022 | Natural And Restored Wetlands | LIHVVEVAFEIIYVSGPEPAERSQPGIHLLKWFWLQSVEAA |
| Ga0063454_1019162552 | 3300004081 | Soil | MAFERIDVSGPESTERRQPGIHFLKWFRFQPVDTALCVDGGF |
| Ga0062384_1012924771 | 3300004082 | Bog Forest Soil | VAFEGIQVSGPEPAELCQPGIHLLKWFRSQPVETALCGYSGFH |
| Ga0062387_1012753921 | 3300004091 | Bog Forest Soil | MHAVEVAFQSIYVRDPKPPERSQPGFQLLKRFRFQPVEAPLCVHCG |
| Ga0062589_1014242161 | 3300004156 | Soil | MHAVEVAYERIDVRGPELPERRQPGIQLLKWFRRQPVKAALSVD |
| Ga0062590_1011294472 | 3300004157 | Soil | MAFESIHMSGPEVAERCQPGIHLLKWFYFQPVETALCVHSTFHKTG |
| Ga0058863_117862143 | 3300004799 | Host-Associated | MLHAVKVAFESIYVSGPESAERVQPGIHLLKWFRFQPVETALCVHRGF |
| Ga0062594_1003883793 | 3300005093 | Soil | MAFESVDVSRPKLTEGSQPLIDLLKLFGFQPVNAALCVHG |
| Ga0066680_106906731 | 3300005174 | Soil | LIHAVEVAFERIHVSGPELTERSQPGIHLLKWFRLQSVETAL |
| Ga0066676_102988611 | 3300005186 | Soil | MHAVEVAFESIHVSRPEPAERSQPGSDLLKWFRFQPVETAL |
| Ga0066388_1004261391 | 3300005332 | Tropical Forest Soil | LIHAVEVAFEGIYVSGPEAAELRQPRIDLTKGFWPEPVKTALCIHR |
| Ga0066388_1021597893 | 3300005332 | Tropical Forest Soil | LLHAVEVAFERIEVSGPKPTERSQPGIHLVKWFRFQSVET |
| Ga0070682_1014996122 | 3300005337 | Corn Rhizosphere | VAFESIDVSGPELTELSQPGIHLLKRLGLQSIQAPLCVHRGFDET |
| Ga0070688_1000675906 | 3300005365 | Switchgrass Rhizosphere | MAFERIDVRGPELAERREPGIQLAKGFRSQPVETALCVHR |
| Ga0066682_108171311 | 3300005450 | Soil | MHAVEVAFQSIDVSGPKPAELSQPHIHLLKRPWFQPVETALCVHRGF |
| Ga0066681_107079342 | 3300005451 | Soil | VTFESIHVRRPEPAERSEPGMHLLKRFWLQPVETALCIHR |
| Ga0066687_107455751 | 3300005454 | Soil | LIHAVEVAFESIHVSGPEPAERSQPGIHLLKWFRFQPVETAL |
| Ga0070706_1016186592 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAFESIDVSGPELTERRQPGIHLLKWFRFQSVETALRVHRGF |
| Ga0070704_1003188693 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VIHAVEVAFERIHMTGPETAERSQPGLELLKWFRFQPIETTLCVH |
| Ga0066661_105605461 | 3300005554 | Soil | VAFESIYVSGPEPTERSQPGIHLLKWFRFQSVETALCVHRGFYET |
| Ga0066704_103715831 | 3300005557 | Soil | VAFERIDVSGPELAELRQPGIHLLEGFWLQAVEPALCVHRG |
| Ga0066700_108167922 | 3300005559 | Soil | LIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQPVETALCV |
| Ga0070664_1024022722 | 3300005564 | Corn Rhizosphere | LIHAVEVAFESIYVSGPEPTERSQPGIQLLKWFGFQPVETALCVYRG |
| Ga0066705_108475262 | 3300005569 | Soil | LIHVVKVPFERIHVSGPEPAERSQPGIHLLKRFWLQPVETAL |
| Ga0066654_106193061 | 3300005587 | Soil | LIHVVEVAFESIHVSGPEPTERSQPGIHLLKWFRFQPVETALCVHRG |
| Ga0070761_109779872 | 3300005591 | Soil | MLLMIHAIEVAFESIQVSGPEPAEPSQPGIQLLKWFRFQP |
| Ga0068864_1002645561 | 3300005618 | Switchgrass Rhizosphere | VIHAIEVAFESIQVDRPDPTERSEPRIHLLQWSRFQPVDTALCVH |
| Ga0066905_1013565851 | 3300005713 | Tropical Forest Soil | LIHAVEVAFKRIYVSGPEAAERSEPGIDLLEWFRFQAV |
| Ga0066903_1046476891 | 3300005764 | Tropical Forest Soil | MHEVEVAFQSINVGRPEPTELGEPVVDLLQRFGLQPVETALRV |
| Ga0070717_117191022 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VIHTIKVAFESIHVGGPEPTELSQPGIDLPKRFRFQAVETA |
| Ga0075029_1011409002 | 3300006052 | Watersheds | MHAVEVAFESIYMSGPEAAELGQPGIQLLKWFRVQPVETALCVHRG |
| Ga0075017_1009138671 | 3300006059 | Watersheds | VAFESIYVSGPEPTERSQPGIHLLKWFRFQSVETALCVH |
| Ga0075015_1000305715 | 3300006102 | Watersheds | MRSLIHAVEVAFESIYMSRPEPTERTQPGIDLLKWFRFQPVET |
| Ga0075030_1014352851 | 3300006162 | Watersheds | VAFESIYVSGPEPAERSQPGIHLLKWFRFQPVETALC |
| Ga0070716_1002830963 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFKRIQMSGPETAKLSQPGIQLLKWFRVQAVETALCVHRGF |
| Ga0070765_10000792711 | 3300006176 | Soil | MAFESIHVGGPEPPERRQPRIHLLKWFRFQPVETPLRV |
| Ga0097621_1004266363 | 3300006237 | Miscanthus Rhizosphere | MAFERIHMSGPEAAEGGQPGIHRLKGFRFQPVEAALGIHHRFDKTG |
| Ga0068871_1000746066 | 3300006358 | Miscanthus Rhizosphere | VIHAIEVAFESIQVDRPDPTERSEPRIHLLQWSRFQPV |
| Ga0066653_105688862 | 3300006791 | Soil | VAFQSIHVSGPELAERSQPGVYLQKWFWLQPVETALCVHRGFH |
| Ga0066665_105659721 | 3300006796 | Soil | LIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQPVE |
| Ga0066659_105673543 | 3300006797 | Soil | LIHAVEVAFESIHMIGPEPSEPIEPGIHLLKWFRF |
| Ga0066659_117030611 | 3300006797 | Soil | LIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQPVETA |
| Ga0075428_1014740311 | 3300006844 | Populus Rhizosphere | MAFESINVSGPEVTKRSQPGVKLLQRFVFQLVETTLSVHGAL |
| Ga0105101_105317282 | 3300009171 | Freshwater Sediment | LIHAVEVAFESIHVSGPEPTEGSQPGSDLLKWFRFQPVETALCV |
| Ga0116125_10898903 | 3300009628 | Peatland | MILVTIHAVEVPFQSIYVSGPEPAELIQPGIDLLKWFRSQPVK |
| Ga0116114_10272461 | 3300009630 | Peatland | LIHAVEVAFECIYVNGPEPAELSQPGIHLLKWRRSQPVET |
| Ga0116101_11733582 | 3300009759 | Peatland | MHTVKMAFECIDVSGPEPAELSQPRIELLEWSRFQPVETALCVH |
| Ga0126380_108360481 | 3300010043 | Tropical Forest Soil | VAFERIYVSGPELTERSQPGIHLLKWFRFQSVETPL |
| Ga0126373_104323191 | 3300010048 | Tropical Forest Soil | MYAVEVALKGIHVSGPEAPKLSQPGIDLLQWSGFQPVETALR |
| Ga0126373_130242341 | 3300010048 | Tropical Forest Soil | LVEVAFESIYVSGPEPPERSQPGVHLLKWLWLQSVETALSV |
| Ga0127470_10812321 | 3300010105 | Grasslands Soil | VVEVAFESIQMSGPGPAERSQPGIHLLKWFRFEPVET |
| Ga0126379_105910283 | 3300010366 | Tropical Forest Soil | MAFESIYVSRPEPAEWSKPGIDLFKWFRFQPVEAALCVHGGFYET |
| Ga0126381_1003132661 | 3300010376 | Tropical Forest Soil | LIHELEVAFESIQVNGPELAELRQPRVHLLKWFGFETVK |
| Ga0136449_1046537822 | 3300010379 | Peatlands Soil | LFDAVEVAFESVYVSGPEAAELREPVIHLLKWFRFQPVETP |
| Ga0126383_124469751 | 3300010398 | Tropical Forest Soil | LVEVPFERIDVSGPELTERSKPGIHFLKWLRFQPVETALRV |
| Ga0134123_117126611 | 3300010403 | Terrestrial Soil | MAFESIHVSGPEPTEGSQPSSDLLKWFRLQSVETALGVYSG |
| Ga0138560_11814131 | 3300011083 | Peatlands Soil | LIHAVEVAFESIDVSGPEPTERSQPSIHLLKWFRFQSVETALCVHR |
| Ga0138570_11879661 | 3300011087 | Peatlands Soil | LIHAVKVAFESIYVRGPEPAERSQPGFDLLKWFRFQPVETALSV |
| Ga0150983_124953271 | 3300011120 | Forest Soil | LIHAVEVAFESIYVSGPEPAERSQPGIQLLKWFRF |
| Ga0150983_156577761 | 3300011120 | Forest Soil | MLLRIHPIEVAFESIQVSGPEAAEPGQPGIQFLKWFRFQPVETAL |
| Ga0137393_105549163 | 3300011271 | Vadose Zone Soil | MIHAVEVAFESIHVSGPEPAEPGQPGIQLLKWFRFQPVETALR |
| Ga0137364_103102731 | 3300012198 | Vadose Zone Soil | LIHAVEVAFERIHVSRPEPAERSQPGSDLLKWFRFQ |
| Ga0137362_108327951 | 3300012205 | Vadose Zone Soil | VAFESIQVSGPEPAERSQPGIDLLKWFRFQPVETA |
| Ga0137362_111884441 | 3300012205 | Vadose Zone Soil | VAFQSIQVSGPEPAERSQPGIHLLKWFRFQSVETALC |
| Ga0137376_113804081 | 3300012208 | Vadose Zone Soil | MAFESIHVSGPEPAERSQPGIHLLKRFRFQSLETALCVHRG |
| Ga0137379_116887091 | 3300012209 | Vadose Zone Soil | VVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQPVETALC |
| Ga0137465_10046207 | 3300012231 | Soil | LIHAVEVAFERIDVSGPELAERRQPGIHLPKWFGSQ |
| Ga0137387_109124932 | 3300012349 | Vadose Zone Soil | LIDAVEVAFEGIYVSGPEPTELRQPGIQLLKWFRFQPVETALCVH |
| Ga0137386_103094593 | 3300012351 | Vadose Zone Soil | LHTVEVPFQRIHVSGPEPAELLKPGIHLLKWSWLQPVETALCVH |
| Ga0137386_104333451 | 3300012351 | Vadose Zone Soil | VAFESIYMSGPEPTERSQPGIQLLKRFWLQSVETAL |
| Ga0137384_100791231 | 3300012357 | Vadose Zone Soil | LIHAVEVTFESIHVSGPEPTERRQPGSDLLKWFRFQSVETAL |
| Ga0137385_102037971 | 3300012359 | Vadose Zone Soil | LIHAVEVAFESIYVSGPEPTELSHPGIYFRKWFRFQSVETALC |
| Ga0137375_111294802 | 3300012360 | Vadose Zone Soil | VVQVPFESIYVSGPESTERSQPGIHLLKWFWLQLVETALCVH |
| Ga0150984_1179790952 | 3300012469 | Avena Fatua Rhizosphere | MHAIEVAFESLHVSGPEPAERSEPGLHLLKWLRFQAVETALCVHGG |
| Ga0137358_102394541 | 3300012582 | Vadose Zone Soil | VAFESIYVIGPNPAELNQPVIHLLKWFRFQPVETALC |
| Ga0137359_116317282 | 3300012923 | Vadose Zone Soil | MAFESIYVSGPKPAELSQPGIELLKWFRFQPVETALCVH |
| Ga0137404_107085203 | 3300012929 | Vadose Zone Soil | LIHAVEVAFESIYASGPEPTEGNQPGNHLLKWFWLQSVETAL |
| Ga0137404_113544743 | 3300012929 | Vadose Zone Soil | VALESIEMSGPEPAERSQPGIHFLKWFWLQAVETALGVHGGLH |
| Ga0153915_113107943 | 3300012931 | Freshwater Wetlands | LIHAVEVAFESIYVSGQEPPERSQPGSDLLKWFRFQSVET |
| Ga0164298_102025111 | 3300012955 | Soil | MLHAVKVAFESIYVSGPESAERVQPGIHLLKWFRF |
| Ga0134087_104559192 | 3300012977 | Grasslands Soil | LTIHAVEVAFESIQVSGPKPAELSQPHIDLLKRFRSQPIETPLCVHRG |
| Ga0164304_104905483 | 3300012986 | Soil | LITVHAVEVAFESVDVSGPEAAKLSQPGIQFLKWFRFQAV |
| Ga0164306_110823232 | 3300012988 | Soil | LIHAVEVAFESIHVSGPEPAERSQPGVNLLKWFGFQPIETALCI |
| Ga0157370_101697935 | 3300013104 | Corn Rhizosphere | MLHAVKVAFESIYVSGPESAERVQPGIHLLKWFRFQPVETALCVHRGFH |
| Ga0157378_109772131 | 3300013297 | Miscanthus Rhizosphere | LIHSVEVAFESIYVSGPELTEWSQPVIDLLKWFGSQPVETALRVHS* |
| Ga0157375_130253102 | 3300013308 | Miscanthus Rhizosphere | LIHPVEVAFESIYVSGPEPPERSQPRIDLLERFRSQPVETALRV |
| Ga0134075_103815881 | 3300014154 | Grasslands Soil | LIHAVEVAFERIHVSRPEPTERSQPGSDLLKWFRFQSVETALGVHRG |
| Ga0134079_101143671 | 3300014166 | Grasslands Soil | LSHAVEVAFESIHMSEPEPTELRQPGIHLLQWFGLQAVETA |
| Ga0181531_108608942 | 3300014169 | Bog | MGAVEVAFESIYMSGPEPAERGQPVVHRLKWFRSQSI |
| Ga0181535_107336312 | 3300014199 | Bog | MAPIHAIKVAFESIHVSGPKASELSQPRIHLSKWF |
| Ga0182016_105857292 | 3300014493 | Bog | VAFEGIDVRGPEAAELSQPGIDFLKSFRFQPVETALCV |
| Ga0181519_110077661 | 3300014658 | Bog | LIHAVEVSFQSIYVSGPEPTEGSQPGIDLLKWFRLQSIETALSV |
| Ga0157377_104908661 | 3300014745 | Miscanthus Rhizosphere | MAFERIDVSGPELAERRQPGVDFLEWFGFQPVETALC |
| Ga0137414_12334034 | 3300015051 | Vadose Zone Soil | MAFESIYVSGPETAELSQPRIDFLKWFRFQPVEAALCIYR* |
| Ga0182034_113256831 | 3300016371 | Soil | MALESVHVSGPESAERSQPGIHLLKSLRLQPVETPLCVHLGFHET |
| Ga0182040_103912431 | 3300016387 | Soil | VAFESIYVSRPEPTELSQPGIHLLKWFRFQSIEAALCIHG |
| Ga0182037_104819641 | 3300016404 | Soil | MLHAIEIAFKSIYVTGPEPTELSQPGIQLLKRCWFQAVEAAL |
| Ga0181505_112034781 | 3300016750 | Peatland | VAFESIDVSGPEAAERSQPVIHLLKRFWLQTVETAL |
| Ga0187803_103179752 | 3300017934 | Freshwater Sediment | VVEVAFESIYVSGPEPTERSQPVIDLLKWFWLQSVETALCVH |
| Ga0187803_104548111 | 3300017934 | Freshwater Sediment | VAFESIYVSRPEPAERSQPGIDLLKRSWLQPVETAL |
| Ga0187821_100777291 | 3300017936 | Freshwater Sediment | MHAIEVAFESIDVNRPEPAELGQPGIHLPKWFRFQPVETTLRI |
| Ga0187780_108514261 | 3300017973 | Tropical Peatland | MHAVEMAFESVYVSGPEPAELSQPGIHLLKSFWLQPVET |
| Ga0187815_101542451 | 3300018001 | Freshwater Sediment | VVEVAFESISASGPGPTERGQPDIHLMKWFRFQPVEAPPFK |
| Ga0187863_101080351 | 3300018034 | Peatland | VRRLAHAALIHIHSVEVAFESIHVGRPEPAELCQPGIHLLKWFRFQSIETALCVHC |
| Ga0187855_100133201 | 3300018038 | Peatland | VIHAVEVAFESIHVSGPEPAEWSQPGIHLLKGFRFQPVETALCVH |
| Ga0187784_102735224 | 3300018062 | Tropical Peatland | MIHAFEVAFESIYVSRPEPAERSQPGIHLLKWLRFQPVE |
| Ga0187784_102962603 | 3300018062 | Tropical Peatland | LIHPIKVAFQSVYVSRPEPAELSQPGIHLLKSFWLQ |
| Ga0187773_103895181 | 3300018064 | Tropical Peatland | LIHAVEVTFESIHVSGPEPTERSQPSVDLLKRFRLQPVKT |
| Ga0187769_106829281 | 3300018086 | Tropical Peatland | MHAIEVAFESIHVSGPEPAELSQPVIHLLKWFRFQPVETALCVHSG |
| Ga0187770_114146591 | 3300018090 | Tropical Peatland | LTHAVEVAFESIYMSGPEPAERSQPGIHLLKRFWLQPVETAL |
| Ga0187770_117604381 | 3300018090 | Tropical Peatland | VAFESIYMSGPEPAERSQPGIHLLKRFWLQPVETAL |
| Ga0182031_14140575 | 3300019787 | Bog | VAFEGIDVRGPEAAELSQPGIDFLKSFRFQPVETALC |
| Ga0193731_10918363 | 3300020001 | Soil | LIHAIEVALESIHVRGPDPTERSQPVIQLLKWFGSQPVETALCV |
| Ga0193745_10858121 | 3300020059 | Soil | MQPVQVALERIYMSGPEPPERCQPGIELLKTFRFQ |
| Ga0210407_110259082 | 3300020579 | Soil | VIHAVQVALESIYVSGPEPAERSQPGIDLLKWFRFQPVKAALCVHRG |
| Ga0210401_116372711 | 3300020583 | Soil | VVEVAFESIDVSGPEPAERSQPGIHLLKWFRFQPVETALRGHR |
| Ga0210382_104070832 | 3300021080 | Groundwater Sediment | MHTVEVAFESIHVSGPEPTERGQPGSDLLKWFRFQPVETALCVH |
| Ga0210404_105402721 | 3300021088 | Soil | MQTLIHAVEVAFESIQMSGPEPAELSQPSIHLLKWFRFQPVETALCVHR |
| Ga0210405_111139421 | 3300021171 | Soil | VAFQSIHVSGPEPAERSQPGFDLLKWFRLHSVETA |
| Ga0210408_106084021 | 3300021178 | Soil | LSHAVEVAFKSIYVSGPEPAELSQPGIQLLKWFRSQPVETALCV |
| Ga0213881_104445151 | 3300021374 | Exposed Rock | LIYAVEVAFESIYVSGPEPAERSQPGVYLLKWFRF |
| Ga0210393_106336821 | 3300021401 | Soil | LIHAVEVAFESIHMSGPEATELSQPGIDLLKWFRFQPVEAALCVH |
| Ga0210393_107599753 | 3300021401 | Soil | MFHAVEVSFESIYVSRPEPTERSQPGVDLLKRFRFHPVETAL |
| Ga0210393_116591191 | 3300021401 | Soil | LIHAVEVAFESIYVSGPEPTERSQPGIDLLKWFRFQPVETA |
| Ga0210385_103945071 | 3300021402 | Soil | LHAVEVAFESIYMSGPEPTERSQPSIDLLKRFRFQP |
| Ga0210389_106628601 | 3300021404 | Soil | LVHPIKVAFESIHVSRPEPAETGQPGIQLLEWFRLQLVETA |
| Ga0210386_118199801 | 3300021406 | Soil | LIHAVEVSFESIHVSGPKATEPSQPGIQLFEWFRFQ |
| Ga0210384_116187062 | 3300021432 | Soil | LNFFDVPHAVEVAFESIYVSGPEPAEWSQPGIQLLKRFR |
| Ga0213878_105672172 | 3300021444 | Bulk Soil | MLHTVEVAFERIYVSGPEPTERRQPGVQLLKRLKLQPVE |
| Ga0210402_114591522 | 3300021478 | Soil | MIHAVEVAFEGIHVRRPEPAERSQPGIHLLKWFRLQPIETALCVHR |
| Ga0210410_100450736 | 3300021479 | Soil | LIHAVEVAFESIYVSGPEPTERSQPGIHFLKGFRFQ |
| Ga0210410_114229402 | 3300021479 | Soil | MRRLIHAVEVAFESVQMSGPESAELSQPGIHLLKWFRLQPVETALCV |
| Ga0210409_102093081 | 3300021559 | Soil | LIHAVEVAFESIYVSRPEPTERSQPGIDLVKWGRFQPVETALC |
| Ga0210409_114897422 | 3300021559 | Soil | MHAVKVAFESIDVSGPEAAELSQPGVHLLKWFRSQ |
| Ga0126371_127178972 | 3300021560 | Tropical Forest Soil | MAFESIHVSRPEPPELSQPGIELLKWPRFEAVKTAL |
| Ga0213853_105046751 | 3300021861 | Watersheds | LIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRLQPVEA |
| Ga0212123_104103411 | 3300022557 | Iron-Sulfur Acid Spring | MRTLIHAVEVAFESIQMSGPEPAELSQPGIHLLKWFRLQPVETAL |
| Ga0224563_10248032 | 3300022731 | Soil | MSGPKSTELSQPVIHLLKWSRFEPVEAALRVHRGFHETG |
| Ga0224545_10201861 | 3300022881 | Soil | LIHVIHAVEVAFESIYVSGPEPAERSQPGIDLLKWFRFQPVEAAL |
| Ga0233357_10419522 | 3300023056 | Soil | MRTLSHAVEVPFESIQVSGPEPAERSQPGIQLLERFRFQP |
| Ga0207707_102951434 | 3300025912 | Corn Rhizosphere | MLHAVKVAFESIYVSGPESAERVQPGIHLLKWFRFQPVETALCV |
| Ga0207646_105982281 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LIHAVEVAFESIYVSGPEPTERSQPGIHLLKWFRFQSVETA |
| Ga0207644_118060242 | 3300025931 | Switchgrass Rhizosphere | VALESIHVSGPEATELSEPHIQLSKWSRLQAVETALRV |
| Ga0207665_111707921 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LNFFGVPHAVEVAFESIYMSGPEPPEWSQPSIQLLK |
| Ga0207665_116764681 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDAVEVTFERIEASGPEPAERSQPGVHLLQWFRFQSVDTTLC |
| Ga0207661_104596901 | 3300025944 | Corn Rhizosphere | MLHAVKVAFESIYVSGPESAERIQPGIHLLKWFRFQPVETALCVHRG |
| Ga0207708_114895081 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LVHAIEVALEPIDMTGPEPTERIQPGIQFLKWFWLQSVKA |
| Ga0209234_12966212 | 3300026295 | Grasslands Soil | LIHAVEVAFERIDVSGPEPTELSQPGIRLLKRFWLQSA |
| Ga0209686_11900561 | 3300026315 | Soil | LIHAVEVAFESIYVSGPEPTERSQLGIHLLKWFRF |
| Ga0209801_12977812 | 3300026326 | Soil | LIHAVEVAFESIHVSGPEPAERSQPGSDLLKWFRFQSVET |
| Ga0209266_11451681 | 3300026327 | Soil | LIHAVEVAFESIYVSGPEPTERSQPGSDLLKWFRFQP |
| Ga0257158_10720741 | 3300026515 | Soil | LIHAVEVAFESIYMSGPEPTELSQPGIQLLKWFWLQ |
| Ga0179587_102612874 | 3300026557 | Vadose Zone Soil | VAFKSIEVSGPEPTKRSQPGIDLLKRLRLQPVETALCV |
| Ga0179587_109625091 | 3300026557 | Vadose Zone Soil | LIHAVEVAFESIYVSGPEPTERSQPGIQLLKWFGFQSVETA |
| Ga0207805_10119121 | 3300026887 | Tropical Forest Soil | MPFERVYVGGPEPSKRSQPFIHLLKRFGLQAVETALRVYCRF |
| Ga0209620_10205631 | 3300026911 | Forest Soil | MAFESVHVNGPETPERSQPGIHLLKWFRSQPVETP |
| Ga0209732_10947662 | 3300027117 | Forest Soil | VWVYVRIYAVEVAFESIYVSGPEPAERRQPHIHLLK |
| Ga0208368_1066432 | 3300027161 | Forest Soil | LIHAVEVAFEGIHVSGPEPAERSQPGIDLLKWFRFQPVETALCVHCR |
| Ga0209846_10654781 | 3300027277 | Groundwater Sand | MAFESIHVSGPEPTERSQPGSDLLKWFRFQSVETALCVHRG |
| Ga0209011_11301892 | 3300027678 | Forest Soil | LIHAVEVAFESIYVSGPEPTERSQPGIDLLKWFRFQP |
| Ga0209581_12537831 | 3300027706 | Surface Soil | MVEVVFKSIHMSGPESAERSQPGIYLLKWFRLQPV |
| Ga0209448_100143485 | 3300027783 | Bog Forest Soil | MRSLPHTVEVAFESIYVRGPEPAELSQPRIYLLKWFRFQPV |
| Ga0209167_103773181 | 3300027867 | Surface Soil | VAFESIQVSGPESAEWSQPHIDLLKWFRFQPVETALCVHRGFYET |
| Ga0209380_108872112 | 3300027889 | Soil | LNFFGVPHAVEVALERIHVSGPEPAERSQPGIDLLKWFRFQPVETALC |
| Ga0209698_102097224 | 3300027911 | Watersheds | VIHVIHVIHAVEVAFESIYARGPEPAEWSQPRIHFLKWF |
| Ga0209698_102617461 | 3300027911 | Watersheds | LIHAVEVAFESIYVSGPEPAERSQPGIDLLKWFRFQPVE |
| Ga0209698_106799861 | 3300027911 | Watersheds | VAFESIYVSGPEPTERSQPGSDLLKWFRFQTVETALCVH |
| Ga0302303_100440081 | 3300028776 | Palsa | LIDAIEVAFESIYVSGPEPTERSQPGIHLLKWLRFQSVETA |
| Ga0302155_104949211 | 3300028874 | Bog | MLYTVKVAFESVDVRGPEAAEAGQPGIQLLKRFRLQPVE |
| Ga0310037_104385852 | 3300030494 | Peatlands Soil | LIHAVEVTFESIYVSGPEPAELSQPGIHLLKWFRFQPVETALCV |
| Ga0302183_100873571 | 3300030509 | Palsa | MAFESIQVCGPEPTERSQPGIHLLKWFRFQSVETALCVHRGFHET |
| Ga0311354_107510983 | 3300030618 | Palsa | MFFGVIHVVEVAFERIYVSGPEPAERSQPGIHLLQWFRL |
| Ga0302324_1027163702 | 3300031236 | Palsa | MAFKRIYVNRPEPPEGSQPGIYLLKWFRFQPVEPALRVHR |
| Ga0265340_100507821 | 3300031247 | Rhizosphere | LIHAVEVAFESIQVSGPEPAERSQPGIHFLKWLGF |
| Ga0170818_1009938983 | 3300031474 | Forest Soil | MPDAVEVAFESIQVRGPEPAEPSQPGIHLLKGFRSQPVETALC |
| Ga0318516_104741981 | 3300031543 | Soil | VAFESIYVSRPAPTERSQPGIHLLKWFRFQSIEAALCIHGGLHET |
| Ga0318541_102229331 | 3300031545 | Soil | VVQIALECIDMCGPEPSERRQPRLHLLKWFRFQAVETAL |
| Ga0310686_1079517032 | 3300031708 | Soil | VFFYRFWQIHAVEVTFESIQVGGPEAAKLSHPGFDFLKWFGFQPV |
| Ga0310686_1153117951 | 3300031708 | Soil | LIHTIFIHAIEVAFESVHVSRPEAAELSQPRIHLSQWFRLQPVETALS |
| Ga0307405_103885183 | 3300031731 | Rhizosphere | LIHAVEVAFESIYMSGPKPAERSQPGIHLLKWFRFQSVE |
| Ga0307468_1011631411 | 3300031740 | Hardwood Forest Soil | LIHSVEVAFESIYVSGPELTEWSQPVIDLLKWFGSQPIETALRV |
| Ga0307468_1023343751 | 3300031740 | Hardwood Forest Soil | MRTLIHAVEVAFESIQVSGPEPAEWSQPGIHLLKWFRFQTVESAL |
| Ga0307475_102165951 | 3300031754 | Hardwood Forest Soil | MAFESVHMNGPETPERSQPGIHLLKWFRSQPIETPLCVH |
| Ga0318521_107260201 | 3300031770 | Soil | MLDAVEVAFESIHVSGPEPAERSQPGIDLLKWFRFQPVETT |
| Ga0318548_100957943 | 3300031793 | Soil | VAFESIYVSRPEPTELSQPGIHLLKWFRFQSIEAALCIHGGLHE |
| Ga0318503_100761103 | 3300031794 | Soil | MLDAVEVAFESIHVSGPEPAERSQPGIDLLKWFRFQPVETTLSVHPG |
| Ga0307473_104148683 | 3300031820 | Hardwood Forest Soil | MRMLIHAVEVAFESIQVSGPEPAELSQPGIHLLKWFRFQPVETALC |
| Ga0306923_108976141 | 3300031910 | Soil | LLDAVEVAFESIHVSGPEPAERSQPGIDLLKWFRFQPVETA |
| Ga0306923_115002802 | 3300031910 | Soil | LIHAVEVAFESIYVGRPEPTELGQPGIDLLKWFRSQPVETALCVH |
| Ga0310916_106721421 | 3300031942 | Soil | LIFFGVPHAVEVALKSIYVSGPKPAERSQPGIHLLEWFWLQPVETPL |
| Ga0310910_103257001 | 3300031946 | Soil | VAFESIYVSRPEPTELSQPGIHLLKWFRFQSIEAALCI |
| Ga0310910_113096841 | 3300031946 | Soil | LLQAVEVAFESIYVIGPEAAERSEPGIQLLKWLGFQPVETALCIHCRFHK |
| Ga0306926_115562403 | 3300031954 | Soil | VAFESIYVSRPEPTELSQPGIHLLKWFRFQSIEAAL |
| Ga0307479_100903948 | 3300031962 | Hardwood Forest Soil | LIHAVEVAFKSIQVSGPEPTELSQPGIEFLQWLRSQAVKTALCVHC |
| Ga0318532_103595172 | 3300032051 | Soil | MQAVEVAFESVDVNGPKPAELLQPGIHLLKWFRFQPVETALC |
| Ga0318533_108454311 | 3300032059 | Soil | VAEVAFESIYVSGLEPMERSQPRIDLPKWLWLQSVET |
| Ga0306920_1034936242 | 3300032261 | Soil | MLHAIEIAFKSIYVTGPEPTELSQPGIQLLKRCWFQA |
| Ga0335079_102262251 | 3300032783 | Soil | LIHAIEVTFESLDMSGPEPAELSQPAIHLLKWPWFQSVETALC |
| Ga0335081_112887323 | 3300032892 | Soil | MAFESIEMPGPKSAELRQPDIQLLKRFRFQPVETAL |
| Ga0335073_115234371 | 3300033134 | Soil | LLHTVEVALESIDVSGPETAELFQPGIDLLKWFWLQP |
| Ga0373958_0001725_2838_2969 | 3300034819 | Rhizosphere Soil | MIHAIEVAFESIYVSGPEPAERCQPRIHLLEWFRFEAVQTALSI |
| ⦗Top⦘ |