| Basic Information | |
|---|---|
| Family ID | F023979 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 208 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FFETEDDYRRGDETLNAMPAGDTPGRRTSVTKYDVAIRMTS |
| Number of Associated Samples | 176 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.83 % |
| % of genes near scaffold ends (potentially truncated) | 48.56 % |
| % of genes from short scaffolds (< 2000 bps) | 48.56 % |
| Associated GOLD sequencing projects | 172 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.365 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.269 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.481 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF04029 | 2-ph_phosp | 6.25 |
| PF07883 | Cupin_2 | 5.29 |
| PF01872 | RibD_C | 2.88 |
| PF08241 | Methyltransf_11 | 1.92 |
| PF00291 | PALP | 1.44 |
| PF02082 | Rrf2 | 1.44 |
| PF00072 | Response_reg | 1.44 |
| PF01070 | FMN_dh | 1.44 |
| PF04134 | DCC1-like | 1.44 |
| PF00356 | LacI | 0.96 |
| PF03992 | ABM | 0.96 |
| PF03320 | FBPase_glpX | 0.96 |
| PF05988 | DUF899 | 0.96 |
| PF00005 | ABC_tran | 0.96 |
| PF01266 | DAO | 0.96 |
| PF13602 | ADH_zinc_N_2 | 0.96 |
| PF08031 | BBE | 0.48 |
| PF03459 | TOBE | 0.48 |
| PF05721 | PhyH | 0.48 |
| PF00903 | Glyoxalase | 0.48 |
| PF00282 | Pyridoxal_deC | 0.48 |
| PF01113 | DapB_N | 0.48 |
| PF13489 | Methyltransf_23 | 0.48 |
| PF00730 | HhH-GPD | 0.48 |
| PF13191 | AAA_16 | 0.48 |
| PF14378 | PAP2_3 | 0.48 |
| PF16861 | Carbam_trans_C | 0.48 |
| PF00462 | Glutaredoxin | 0.48 |
| PF11139 | SfLAP | 0.48 |
| PF07885 | Ion_trans_2 | 0.48 |
| PF14534 | DUF4440 | 0.48 |
| PF02687 | FtsX | 0.48 |
| PF13340 | DUF4096 | 0.48 |
| PF07690 | MFS_1 | 0.48 |
| PF11131 | PhrC_PhrF | 0.48 |
| PF13343 | SBP_bac_6 | 0.48 |
| PF14907 | NTP_transf_5 | 0.48 |
| PF01734 | Patatin | 0.48 |
| PF01042 | Ribonuc_L-PSP | 0.48 |
| PF04261 | Dyp_perox | 0.48 |
| PF05496 | RuvB_N | 0.48 |
| PF00532 | Peripla_BP_1 | 0.48 |
| PF06723 | MreB_Mbl | 0.48 |
| PF00202 | Aminotran_3 | 0.48 |
| PF06772 | LtrA | 0.48 |
| PF02580 | Tyr_Deacylase | 0.48 |
| PF01370 | Epimerase | 0.48 |
| PF13561 | adh_short_C2 | 0.48 |
| PF03795 | YCII | 0.48 |
| PF01979 | Amidohydro_1 | 0.48 |
| PF12680 | SnoaL_2 | 0.48 |
| PF13545 | HTH_Crp_2 | 0.48 |
| PF02080 | TrkA_C | 0.48 |
| PF02628 | COX15-CtaA | 0.48 |
| PF08327 | AHSA1 | 0.48 |
| PF04234 | CopC | 0.48 |
| PF12681 | Glyoxalase_2 | 0.48 |
| PF01553 | Acyltransferase | 0.48 |
| PF03972 | MmgE_PrpD | 0.48 |
| PF00857 | Isochorismatase | 0.48 |
| PF07508 | Recombinase | 0.48 |
| PF01545 | Cation_efflux | 0.48 |
| PF14342 | DUF4396 | 0.48 |
| PF07040 | DUF1326 | 0.48 |
| PF07452 | CHRD | 0.48 |
| PF13847 | Methyltransf_31 | 0.48 |
| PF00571 | CBS | 0.48 |
| PF04542 | Sigma70_r2 | 0.48 |
| PF06983 | 3-dmu-9_3-mt | 0.48 |
| PF00174 | Oxidored_molyb | 0.48 |
| PF03737 | RraA-like | 0.48 |
| PF00378 | ECH_1 | 0.48 |
| PF03476 | MOSC_N | 0.48 |
| PF11799 | IMS_C | 0.48 |
| PF13671 | AAA_33 | 0.48 |
| PF02417 | Chromate_transp | 0.48 |
| PF04066 | MrpF_PhaF | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 12.50 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.88 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.88 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.44 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 1.44 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 1.44 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 1.44 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.44 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.44 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 1.44 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 1.44 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 1.44 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.44 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 1.44 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.96 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.96 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.48 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.48 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.48 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.48 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.48 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.48 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.48 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.48 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.48 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.48 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.48 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.48 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.48 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.48 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.48 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.48 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.48 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.48 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.48 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.48 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.48 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.48 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.48 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.48 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.48 |
| COG1490 | D-aminoacyl-tRNA deacylase | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.48 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.48 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.48 |
| COG2212 | Multisubunit Na+/H+ antiporter, MnhF subunit | Inorganic ion transport and metabolism [P] | 0.48 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.48 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.48 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.48 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.48 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.48 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.48 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.48 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.48 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.37 % |
| All Organisms | root | All Organisms | 46.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5OHE3B02JN6FP | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 531 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0517996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 861 | Open in IMG/M |
| 3300000956|JGI10216J12902_115643981 | Not Available | 581 | Open in IMG/M |
| 3300003987|Ga0055471_10106933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani | 824 | Open in IMG/M |
| 3300004114|Ga0062593_100602669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1048 | Open in IMG/M |
| 3300004153|Ga0063455_100058911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1365 | Open in IMG/M |
| 3300004156|Ga0062589_102544065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300004157|Ga0062590_102000305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300004479|Ga0062595_100487755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300004643|Ga0062591_101645781 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005179|Ga0066684_10085717 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300005179|Ga0066684_11128192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300005338|Ga0068868_100586912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 986 | Open in IMG/M |
| 3300005343|Ga0070687_100757106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300005356|Ga0070674_100319978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1243 | Open in IMG/M |
| 3300005441|Ga0070700_101806517 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005445|Ga0070708_101697908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 587 | Open in IMG/M |
| 3300005445|Ga0070708_102276955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300005533|Ga0070734_10877164 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005538|Ga0070731_10593992 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
| 3300005546|Ga0070696_101935700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300005713|Ga0066905_101833402 | Not Available | 560 | Open in IMG/M |
| 3300005764|Ga0066903_102090340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. S2-4 | 1090 | Open in IMG/M |
| 3300005843|Ga0068860_100116834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2552 | Open in IMG/M |
| 3300005937|Ga0081455_10366790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter | 1011 | Open in IMG/M |
| 3300006028|Ga0070717_12097740 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006163|Ga0070715_10057829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1691 | Open in IMG/M |
| 3300006581|Ga0074048_10064178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2932 | Open in IMG/M |
| 3300006581|Ga0074048_10690251 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006581|Ga0074048_13198304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300009148|Ga0105243_11256112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300009162|Ga0075423_12003915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300009177|Ga0105248_12967869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300009545|Ga0105237_12208081 | Not Available | 560 | Open in IMG/M |
| 3300009553|Ga0105249_11361710 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300009553|Ga0105249_11772883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300009553|Ga0105249_12793193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300009789|Ga0126307_11389356 | Not Available | 569 | Open in IMG/M |
| 3300009789|Ga0126307_11678578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300010040|Ga0126308_10251211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1150 | Open in IMG/M |
| 3300010045|Ga0126311_10729160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 794 | Open in IMG/M |
| 3300010373|Ga0134128_11835236 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010373|Ga0134128_12341621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300010398|Ga0126383_13128968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300010403|Ga0134123_13208033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300011119|Ga0105246_10467808 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300012001|Ga0120167_1112596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300012209|Ga0137379_11779557 | Not Available | 511 | Open in IMG/M |
| 3300012210|Ga0137378_11086927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 714 | Open in IMG/M |
| 3300012350|Ga0137372_10273931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1318 | Open in IMG/M |
| 3300012357|Ga0137384_10873197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300012530|Ga0136635_10073479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300012685|Ga0137397_10474844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300012915|Ga0157302_10001646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4742 | Open in IMG/M |
| 3300012930|Ga0137407_11670511 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria | 607 | Open in IMG/M |
| 3300012938|Ga0162651_100095700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300012989|Ga0164305_11244726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300013772|Ga0120158_10107498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1655 | Open in IMG/M |
| 3300014272|Ga0075327_1089079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 928 | Open in IMG/M |
| 3300015372|Ga0132256_102329230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300015374|Ga0132255_100555837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1692 | Open in IMG/M |
| 3300016270|Ga0182036_11095869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300018031|Ga0184634_10353603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300018060|Ga0187765_11068724 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300018071|Ga0184618_10161579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300018429|Ga0190272_10455001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1069 | Open in IMG/M |
| 3300018469|Ga0190270_10037551 | All Organisms → cellular organisms → Bacteria | 3235 | Open in IMG/M |
| 3300018476|Ga0190274_12590178 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300018920|Ga0190273_11703599 | Not Available | 569 | Open in IMG/M |
| 3300019377|Ga0190264_10728995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
| 3300019767|Ga0190267_10471420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300020080|Ga0206350_10699128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 591 | Open in IMG/M |
| 3300021080|Ga0210382_10204886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
| 3300021972|Ga0193737_1057506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300022898|Ga0247745_1045430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 685 | Open in IMG/M |
| 3300025567|Ga0210076_1142658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300025792|Ga0210143_1016544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1295 | Open in IMG/M |
| 3300025908|Ga0207643_11069595 | Not Available | 521 | Open in IMG/M |
| 3300025916|Ga0207663_10983234 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025919|Ga0207657_11385408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. KC06 | 529 | Open in IMG/M |
| 3300025961|Ga0207712_10460599 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300025961|Ga0207712_11432271 | Not Available | 618 | Open in IMG/M |
| 3300026075|Ga0207708_10117163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2073 | Open in IMG/M |
| 3300026078|Ga0207702_11703731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300027993|Ga0247749_1019578 | Not Available | 717 | Open in IMG/M |
| 3300028589|Ga0247818_10685405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
| 3300028715|Ga0307313_10202866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300028719|Ga0307301_10035765 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300028787|Ga0307323_10070411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1243 | Open in IMG/M |
| 3300028796|Ga0307287_10128966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 959 | Open in IMG/M |
| 3300028799|Ga0307284_10309574 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300028803|Ga0307281_10218312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300028814|Ga0307302_10412584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300028824|Ga0307310_10399082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300028828|Ga0307312_10245286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1158 | Open in IMG/M |
| 3300028878|Ga0307278_10358812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300028884|Ga0307308_10522678 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Salinigranum | 569 | Open in IMG/M |
| 3300030904|Ga0308198_1087863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300031736|Ga0318501_10404622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300031740|Ga0307468_100146501 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300031831|Ga0318564_10385796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300031911|Ga0307412_11008067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300031939|Ga0308174_11788169 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031995|Ga0307409_101282494 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300032012|Ga0310902_10840975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300033550|Ga0247829_10616460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.40% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.48% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2119805009 | Soil microbial communities from sample at FACE Site NTS_007 Nevada Test Site | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_04515890 | 2067725004 | Soil | SSSSGNEDDYRAGDEILNAMPAGDTPGRRSDVAKYQVAYRMTR |
| FNTS007_06135970 | 2119805009 | Soil | EAEKSVVIVFFETEDDYRRGDAVLNAMPADETPGRRTSVARYDVALRMTV |
| cont_0749.00003540 | 2166559005 | Simulated | MAIVFFDNEDDYQTGDEFLSAMPTSDTPGRRTSVTKHEVAVRAMG |
| ICChiseqgaiiDRAFT_05179961 | 3300000033 | Soil | TEDDYRRGDEVLAAMPADQTPGQRASVTKYEVAVRATP* |
| ICChiseqgaiiDRAFT_24066811 | 3300000033 | Soil | LHDVATNSALAIVFFDSXDDXATGDAALSAMPAGDTPGRRTSVTKYDVVARMTS* |
| ICChiseqgaiiFebDRAFT_111286482 | 3300000363 | Soil | EAEKTQVILFFEDEDAYKRGDEVLNAMPAGDTPGQRTSVTRYDVVQRMTT* |
| JGI10216J12902_1025161583 | 3300000956 | Soil | GKALAVVFFDNEDDYAQGDAALSAMSPGDTPGTRVSVTKYDVVARRTV* |
| JGI10216J12902_1156439811 | 3300000956 | Soil | LVVLFFENEDDYRRGDETLNAMPASDTPGQRTSVAKYNVAMRMSD* |
| A10PFW1_119826681 | 3300001538 | Permafrost | VIVFFETEEDYQRGDEMLSAMPAGDTPGRRTSVTKYDVATRMTA* |
| C688J18823_100188885 | 3300001686 | Soil | MPFFGADDGYRRGDEALNAVPTGDTPGRRTSVTKYNVALRMSV* |
| Ga0055471_101069332 | 3300003987 | Natural And Restored Wetlands | FFDNEDDYRAGDEILNAMPAGDTPGRRSSVAKYQVAHRMTR* |
| Ga0063454_1001788102 | 3300004081 | Soil | FFGADDGYRRGDEALNAVPTGDTPGRRTSVTKYNVALRMSV* |
| Ga0062593_1006026691 | 3300004114 | Soil | VFFDSEDDYARGDEVLSAMPAGDTPGKRTSVTKYDVVTRMTP* |
| Ga0062593_1006754211 | 3300004114 | Soil | DKAVAILFFANDDDYQKGDEILNAMPASDTPGRRTSVTKYEVAMRMSG* |
| Ga0063455_1000589112 | 3300004153 | Soil | LFFDNEDDYRRGDEALNAMPAGDTPGKRTSVTKFDVAFRMAD* |
| Ga0062589_1025440652 | 3300004156 | Soil | DQSVVILFFENEDDYRQGDETLNAMPTTDTPGQRTSVTKYQVAFRMAGD* |
| Ga0062590_1016989351 | 3300004157 | Soil | DAAAGKALAVVFFDNEDDYAKGDAALNAMAPGDTPGTRVSVTKYDVVARRTV* |
| Ga0062590_1020003051 | 3300004157 | Soil | AEKSVVILFFETENDYAQGDAALSAMPASDTPGQRTSVGKYEVAFRMTD* |
| Ga0062595_1004877551 | 3300004479 | Soil | DAEKAVVVLFFDSEEDYRQGDEALNAMPAEDTPGKRSSVKKYDVVHRQTV* |
| Ga0062595_1006805492 | 3300004479 | Soil | ADNALVILFFETEDDYRRGDEMLNAMPAEDTPGRRVSAKKHDVAIRMTD* |
| Ga0062595_1008027711 | 3300004479 | Soil | VILFFENEADYKRGDEALDAMPASDTPGRRTSVSKYQVTLRMQS* |
| Ga0062595_1024387551 | 3300004479 | Soil | VIVFFDSEDDYARGDEVLSAMPAADTPGQRTSVTKYDVVTRMTP* |
| Ga0062591_1014741923 | 3300004643 | Soil | DAAAGKALAVVFFDNEDDYAKGDAALNAMAPGDTPGTRVSVTKYDVAARRTV* |
| Ga0062591_1016457813 | 3300004643 | Soil | FDSEEDYRQGDEALNAMPAEDTPGKRSSVKRYDVVHRQTV* |
| Ga0066679_105673442 | 3300005176 | Soil | VFFETEDDYRRGDEILSAMPAGDTPGRRTSVTKYDVATRMKS* |
| Ga0066688_104581721 | 3300005178 | Soil | IVFFETEEDYARGDEVLNAMPADDTPGRRSSVTKYEVATRMTV* |
| Ga0066684_100857171 | 3300005179 | Soil | DNEDDYRRGDEALNAMPAGDTPGKRTSVAKYQVAFRMAD* |
| Ga0066684_111281921 | 3300005179 | Soil | FFASEDDYRRGDETLNAMPAGDTPGRRTSVAKYDVAIRMTT* |
| Ga0066675_103920832 | 3300005187 | Soil | FETEDDYRRGDETLNAMPAGDTPGRRTSVTKYDVAIRMTS* |
| Ga0068868_1005869122 | 3300005338 | Miscanthus Rhizosphere | FFDSEEDYRQGDETLNAMPAGDTPGQRTGVAKYEVAVRMAV* |
| Ga0070687_1007571061 | 3300005343 | Switchgrass Rhizosphere | LFFDSEEDYRQGDETLNAMPAGDTPGQRSGVAKYEVAVRMAV* |
| Ga0070674_1003199781 | 3300005356 | Miscanthus Rhizosphere | FATEEDYRQGDAILSAMPADETPGERTSVTKYEVAVRASM* |
| Ga0070700_1018065171 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | EKSLVVIFFDDEDAYRRGDEILSAMPAGDTPGSRSGVAKYDVAIRMSL* |
| Ga0070708_1016979081 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SLVILFFDTEEDYQRGDEALNAMPAGDTPGTRTSVAKYQVAFRMTD* |
| Ga0070708_1022769552 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFENEDDYKRGDEALNAMPAGDTPGKRASVTKYDVAFRMTD* |
| Ga0070734_108771642 | 3300005533 | Surface Soil | FFDSEDDYRRGDATLDAMPAGDTPGRRTSVGKYDVVVHLKV* |
| Ga0070731_105939921 | 3300005538 | Surface Soil | DYRRADEALNAMPAGDTPGKRTSVAKYQVAFRMTD* |
| Ga0070696_1019357001 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AEKSLVILFFENEDDYEQGDKTLSAMPAGDTPGKRTSVAKYEVAFRMTD* |
| Ga0070693_1011773861 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AIVFFENEDEYRKGDEVLGSMDAGDTPGRRTGVTKYQVATRMTA* |
| Ga0066695_108093212 | 3300005553 | Soil | EDEYRKGDEILGGMPTGDTPGRRTGVTKYQVATRMTA* |
| Ga0066670_101140871 | 3300005560 | Soil | FFETEDDYRRGDETLNAMPAGDTPGRRTSVTKYDVAIRMTS* |
| Ga0066706_108505771 | 3300005598 | Soil | ETEDDYRRGDETLNAMPAGDTPGRRTSVTKYDVAIRMTS* |
| Ga0066905_1018334021 | 3300005713 | Tropical Forest Soil | VVMFFDNEADYARGDETLNAMPAGDTPGTRTSVGKYEVALRVTS* |
| Ga0066903_1020903401 | 3300005764 | Tropical Forest Soil | VIFFDNDEDYQRGDAMLSAMPAGDTPGSRTSVKKLDVAMRQTM* |
| Ga0068860_1001168341 | 3300005843 | Switchgrass Rhizosphere | DYNRGDEMLNAMPAGDTPGKRTSVTRHDVAHRMKS* |
| Ga0081455_103667901 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LVILFFETEEDYRRGDETLNAMPADETPGKRTSVTRYDVAVRMTR* |
| Ga0070717_120977402 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EDDYARGDAALSAMPAGDTPGTRTSVTKYNVAFRMAD* |
| Ga0066651_108187553 | 3300006031 | Soil | GEKSLVVVFFETEDDYRRGDEFLSSMPAGDTPGRRTSVTKYDVAIRMNS* |
| Ga0066652_1005464651 | 3300006046 | Soil | AIVIFDSEDDYRRGHEILDSMPSDNTPGKRTSVTKYDVATRMTS* |
| Ga0066652_1009976502 | 3300006046 | Soil | FFENEDDYRRGDEALSAMPGSDTPGRRTSVTKYDVAIRMSD* |
| Ga0070715_100578291 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KSLVVVIFETEDDYNRGDEMLNAMPAGDTPGKRTSVTRHDVAHRMKS* |
| Ga0075014_1008179691 | 3300006174 | Watersheds | SLVVLFFETEDDYRRGDQVLTAMPADDTPGRRTSVTRYDVAVRMTA* |
| Ga0097621_1017528531 | 3300006237 | Miscanthus Rhizosphere | ANEGDYQKGDEILGGMDTSDTPGTRTGVTKYDVAVRMTA* |
| Ga0074048_100641787 | 3300006581 | Soil | LVVVFFENEADYKTGDETLSAMPAGDTPGKRTSVAKYNVAFRMAD* |
| Ga0074048_106902513 | 3300006581 | Soil | FFDSEEDYRQGDAALNALPADDTPGKRSSVKKYDVVHRQTV* |
| Ga0074048_131983041 | 3300006581 | Soil | LVVVFFETEDDYRRGDEALNAMPAGDTPGERTSVAKYQVAFRMAD* |
| Ga0066653_103015741 | 3300006791 | Soil | SLVIIFFESEEDYRKGDEILSAMPADETPGRRTSVAKYDVATRMTS* |
| Ga0075428_1015778912 | 3300006844 | Populus Rhizosphere | DSEEDYRQGDETLNAMDAGETPGQRTGVAKYEVAMRMAT* |
| Ga0075428_1024403052 | 3300006844 | Populus Rhizosphere | SLVLIFFDTEEDYAKGDEILNAMPAGDTPGRRTSVTKYEVVARRSV* |
| Ga0075421_1000690387 | 3300006845 | Populus Rhizosphere | EDDYRQGDETLNAMPAGDTPGQRSSVTKYEVAMRMTP* |
| Ga0075430_1008272361 | 3300006846 | Populus Rhizosphere | DYATGDAALNAMPTGDTPGRRTSVRKYDVVGRMTA* |
| Ga0075420_1000912551 | 3300006853 | Populus Rhizosphere | YKRGDATLSAMPAGDTPGKRTSVTKYEVAIRMNA* |
| Ga0075434_1002751211 | 3300006871 | Populus Rhizosphere | EKSLAIVFFDSEDAYRRGDEILNAMPSGDTPGQRTSVRRYDVAIRMTP* |
| Ga0079215_100383703 | 3300006894 | Agricultural Soil | LAILFFDNEDDYARGDEMLNAMPAGDTPGRRTSVTKYDVATRMTT* |
| Ga0066709_1007715615 | 3300009137 | Grasslands Soil | ETEDDYRKGDEALNAMPACETPVRRSSVTKYDVAIRMKD* |
| Ga0066709_1035788332 | 3300009137 | Grasslands Soil | VLFFENEDDYRKGDEVLGGMPTEDTPGRRTSVTKYQVATRRTV* |
| Ga0114129_114918011 | 3300009147 | Populus Rhizosphere | RSLVILFFDNEDDYRQGDEILSAMPAGDTPGRRSGVAKYEVAHRMTAERQA* |
| Ga0105243_112561122 | 3300009148 | Miscanthus Rhizosphere | YKRGDEALNAMPAGDTPGNRSSVTKYQVAFRMAE* |
| Ga0111538_121799311 | 3300009156 | Populus Rhizosphere | VIVFFDNEDDYQRGDAVLSAMPAGDTPGQRTGVAKYDVAIRMAT* |
| Ga0075423_120039151 | 3300009162 | Populus Rhizosphere | MKSLVVLFFDTDDDYQRGDEALDAMPASDTPGKRTSVTKYQVAFRMTD* |
| Ga0105248_129678692 | 3300009177 | Switchgrass Rhizosphere | FFDNEADYADADAALSAMPSDETPGRRTSVAKYDVAMRMKA* |
| Ga0105237_122080812 | 3300009545 | Corn Rhizosphere | VVLYDAGAEKALVTLFFDSEEDYRSSDEVLNAMPADETPGRRASVTKYAVALRETL* |
| Ga0105238_100292381 | 3300009551 | Corn Rhizosphere | SVAIVFFDNEDDYAQGDVTLGAMPSDDTPGKRVSVGKYEVAARVSV* |
| Ga0105249_113617101 | 3300009553 | Switchgrass Rhizosphere | AVVVVFFDSEEDYRQGDEALNAMPAEDTPGKRSSVKKYDVVHRQTV* |
| Ga0105249_117728832 | 3300009553 | Switchgrass Rhizosphere | FDSEEDYRQGDETLNAMPAGDTPGQRSGVAKYEVAVRMAV* |
| Ga0105249_127931932 | 3300009553 | Switchgrass Rhizosphere | FFETEDDYKRGDEALNAMPAGDTPGKRTSVTKYQVAFRMTD* |
| Ga0126307_113893561 | 3300009789 | Serpentine Soil | EDDYRAGDEVLNAMPAGDTPGQRASVTKYDVAVRMAV* |
| Ga0126307_116785781 | 3300009789 | Serpentine Soil | LVILFFDNEDDYRRGDEALNAMPAGDTPGQRTSVAKYEVAVRMAE* |
| Ga0126307_117328822 | 3300009789 | Serpentine Soil | FFDNDEDYRRGDEVLSAMPAGETPGRRTSVRRYDVPMRMTM* |
| Ga0126313_1000172012 | 3300009840 | Serpentine Soil | VVLFFESEDDYKRGDEVLNAMPAGDTPGRRTSVTKYEVAARMTP* |
| Ga0126313_101836121 | 3300009840 | Serpentine Soil | ERSLVILFFETEDDYRRGDEVLSAMPAGDTPGRRTSVTKYDVAARMTT* |
| Ga0126308_102512111 | 3300010040 | Serpentine Soil | DDDYRRGDEALNAMPAGDTPGQRTSVAKYEVAMRMTE* |
| Ga0126314_102855792 | 3300010042 | Serpentine Soil | VVVFFDNEDDYRQGDEALSAMPAAETPGRRTSVTKYNVAFRMAE* |
| Ga0126311_107291603 | 3300010045 | Serpentine Soil | VILFFDNEDDYRRGDEALNAMPAGDTPGQRTSVAKYEVAMRMTE* |
| Ga0134088_106142161 | 3300010304 | Grasslands Soil | EQSLVILFFETEDDYRRGDETLNAMPAGDTPGRRTSVAKYDVALRMVADRQT* |
| Ga0134084_102513791 | 3300010322 | Grasslands Soil | EKSLVIVFFESEDDYRRGDEILSAMPADDTPGRRTSVAKYDVATRMSS* |
| Ga0134128_118352361 | 3300010373 | Terrestrial Soil | KSLVILFFETEADYQRGDEALNAMPAGDTPGKRTSVAKYQVAFRLTD* |
| Ga0134128_123416211 | 3300010373 | Terrestrial Soil | ADYKKGDAALNAMPAGETPGKRTSVTKYDVAIRMTD* |
| Ga0134126_116320921 | 3300010396 | Terrestrial Soil | AAGKALAVVFFDNEDDYAQGDAALSAMAPGDTPGTRISVTKYDVVARRTV* |
| Ga0126383_131289682 | 3300010398 | Tropical Forest Soil | ILFFENEDDYKRGDEALNAMPAADTPGTRTAVTKYEVAFRMTD* |
| Ga0134122_127551531 | 3300010400 | Terrestrial Soil | LVILFFETEDDYRRGDEMLNAMPAGDTPGRRLSAKKHDVAIRMTD* |
| Ga0134123_132080331 | 3300010403 | Terrestrial Soil | LVVVIFETDDDYNRADEIMNAMPAGDTPGKRTSVTRYDVAHRMKS* |
| Ga0105246_104678082 | 3300011119 | Miscanthus Rhizosphere | YDAGAEKALVTLFFDSEEDYRSSDEVLNAMPADETPGRRASVTKYAVALRETL* |
| Ga0105246_109082931 | 3300011119 | Miscanthus Rhizosphere | HDAAAGKALAVVFFDNEDDYAKGDAALNAMAPGDTPGTRVSVTKYDVVARRTV* |
| Ga0120167_11125961 | 3300012001 | Permafrost | DEDYQRGDEALRAMPAGDTPGQRTSVAKYQVAFRMTD* |
| Ga0120174_11419522 | 3300012008 | Permafrost | AEKSLAIVFFETEDDYKRGDEMLSAMPAGETPGRRTSVTKYDVATRMTA* |
| Ga0120152_10357531 | 3300012011 | Permafrost | PEAEKSLAIVFFETEDDYKRGDEMLSAMPAGDTPGRRTSVTKYDVATRMTV* |
| Ga0136634_103811193 | 3300012046 | Polar Desert Sand | MLHDPATDAALAVLFFDSEDDYATGDAALSAMPAGDTPGRRTSVTKYE |
| Ga0137374_100329111 | 3300012204 | Vadose Zone Soil | AEKSLVILFFETEDDYKRGDEVLNAMPADDTPGRRTSVAKFDVATRMTV* |
| Ga0137374_104002891 | 3300012204 | Vadose Zone Soil | AEKSLVILFFETEDDYKRGDEVLNAMPADDTPGRRTSVAKYDVATRMTV* |
| Ga0137379_110039012 | 3300012209 | Vadose Zone Soil | MFFETEDDYRRGDEVLNAMPAGDTPGRRTSVTKYDVATRMTV* |
| Ga0137379_117795572 | 3300012209 | Vadose Zone Soil | ENEDDYRLGDETLNAMPAGDTPGQRTSVTKYDVAIRMTA* |
| Ga0137378_110869273 | 3300012210 | Vadose Zone Soil | FDTDDDYRRGDEALNAMPAGDTPGKRASVTKYEVAFRMTD* |
| Ga0137372_102739311 | 3300012350 | Vadose Zone Soil | TEDDYERGDEALNAMPAGDTPGKRTSVTKYDVAVRMTN* |
| Ga0137371_111942901 | 3300012356 | Vadose Zone Soil | PEAEKSLVILFFETEDDYRRGDEMLNAMPAGDTPGRRTSVTKYNVATRMTS* |
| Ga0137384_108731972 | 3300012357 | Vadose Zone Soil | EKSLVILFFDTEDDYQRGDAALNAMPTGDTPGQRSSVTKYEVAFRMTD* |
| Ga0157327_10577612 | 3300012512 | Arabidopsis Rhizosphere | VFFDNEDDYARGDEILNAMPAGDTPGQRTGVTKYDVVTRMTP* |
| Ga0136635_100734791 | 3300012530 | Polar Desert Sand | LVIVFFENEDDYKTGDETLSAMPAGDTPGKRTSVGKYQVAFRVTE* |
| Ga0137397_104748443 | 3300012685 | Vadose Zone Soil | ETDDDYQRGDEALSAMPAGDTPGQRTSVAKYQVAFRMTG* |
| Ga0157302_1000164610 | 3300012915 | Soil | LFFGNEDDYRAGDEILNAMPAGDTPGRRSDVAKYQVAYRMTQ* |
| Ga0137394_111833681 | 3300012922 | Vadose Zone Soil | DTSLAIVFFETEDDYRRGDEILSAMPAGDTPGRRTSVTKYDVATRMKS* |
| Ga0137407_116705112 | 3300012930 | Vadose Zone Soil | FFDTEDDYRRGDEILNAMPAGDTPGQRKSVTKYDVAIRMTE* |
| Ga0162651_1000957001 | 3300012938 | Soil | VVVIFDNEDDYRKRDEILNAMPAGDTPGQRTSVAKYQVAFRMTD* |
| Ga0164300_103675681 | 3300012951 | Soil | LVLVFFDSEDDYRKGDEALSAMPAGDTPGRRTSVKKYELAARVTG* |
| Ga0164299_111772031 | 3300012958 | Soil | EDYRQGDAVLSAMPAGDTPGRRTSVTRYEVAVRRTA* |
| Ga0134087_103955542 | 3300012977 | Grasslands Soil | QALAIVFFENEDEYRKGDEILGGMPTGDTPGRRTGVTKYQVATRMTA* |
| Ga0164309_114651522 | 3300012984 | Soil | FFENEEDYRQGDAVLSAMPAGDTPGRRTSVTRYEVAVRRTA* |
| Ga0164305_103034271 | 3300012989 | Soil | IVFFENEEDYRQGDAVLSAMPAGDTPGRRTSVTRYEVAVRRTA* |
| Ga0164305_112447261 | 3300012989 | Soil | SLVILFFETEADYKQGDETLSAMPAGDTPGKRTSVTKYEVAFRMTD* |
| Ga0157372_134391282 | 3300013307 | Corn Rhizosphere | FFENEDAYKRGDVALSAMPAGETPGRRTSVATYNVALRMAD* |
| Ga0120158_101074986 | 3300013772 | Permafrost | YRRGDEALNAMPAGETPGSRSSVTKYDVAVRMTA* |
| Ga0134079_104415602 | 3300014166 | Grasslands Soil | VFFESEDDYRRGDEILSAMPADDTPGRRTSVAKYDVATRMSS* |
| Ga0075327_10890791 | 3300014272 | Natural And Restored Wetlands | YRRGDEALNAMPAGDTPGRRSSVARYDVAVRMSD* |
| Ga0157376_113125301 | 3300014969 | Miscanthus Rhizosphere | EDDYAKGDAALNAMDTGDTPGRRTSVTKYKVAGRMTA* |
| Ga0182006_12270422 | 3300015261 | Rhizosphere | VFFDSEDDYRTGDEFLNAMPASDTPGRRTSVTKHDVAVRVMG* |
| Ga0132256_1023292302 | 3300015372 | Arabidopsis Rhizosphere | LAILFFETDDDYRKGDAALNAMPADETPGSRSSVTKYDVAIRMTA* |
| Ga0132255_1005558373 | 3300015374 | Arabidopsis Rhizosphere | FFESEDDYRRGDEALNAMPAGDPPGQRSSVTKYSVAHRMATAPH* |
| Ga0182036_110958691 | 3300016270 | Soil | KSLVLLFFDNDDDYRRGDDALNAMPASDTPGQRTAVSKYQVAFRITD |
| Ga0187779_109975501 | 3300017959 | Tropical Peatland | NEDDYWKGDEVLGSMPASDTPGRRTSVTKHDVAVRVMA |
| Ga0184634_103536031 | 3300018031 | Groundwater Sediment | LFFETDDEYKRGDEALSAMPAADTPGRRTSVTKYQVAFRMAE |
| Ga0184621_100453703 | 3300018054 | Groundwater Sediment | KSLVILFFETEDDYRRGDEMLNAMPAGDTPGRRTSVTKYNVATRMTS |
| Ga0187765_110687241 | 3300018060 | Tropical Peatland | EMMVLHDGEAEKAVVVLFFDSDEDYRQGDEALNAMPADETPGRRSSVARYDVVIRETV |
| Ga0184618_101615791 | 3300018071 | Groundwater Sediment | KSLAILFFETEDDYKRGDEALNAMPAGDTPGQRTSVTKYDVAIRMSG |
| Ga0190272_104550013 | 3300018429 | Soil | SLVILFFDNEDDYKRGDETLNAMSAGDTPGERTSVTRYDVPIRMTV |
| Ga0066662_110890982 | 3300018468 | Grasslands Soil | SVAIVIFDSEDDYRRGHEILDSMPGDNTPGKRTSVTKYDVATRMTS |
| Ga0190270_100375516 | 3300018469 | Soil | DSEDDYRRGDEALNAMPTDDTPGQRTSVTKYDVAVRVSS |
| Ga0190270_113891152 | 3300018469 | Soil | VFFDTEDDYRQGDAVLSAMPTGDTPGRRVSVEKYEVPIRVTV |
| Ga0190274_121721133 | 3300018476 | Soil | VIVFFDNEDDYRKGDEALNAMPAGDTPGRRTSVEKFEVPIRMVN |
| Ga0190274_125901781 | 3300018476 | Soil | AEKSLVILFFDSEEDYRQGDETLNAMPAGDTPGQRSGVAKYKVAVRMDV |
| Ga0190273_117035992 | 3300018920 | Soil | DDYTRGDEALNAMPAGDTPGQRTSVAKYEVASRMTA |
| Ga0190264_107289952 | 3300019377 | Soil | FENEDDYRRGDEALSAMPTGDTPGKRTSVSKYEVAFRMTD |
| Ga0190267_104714201 | 3300019767 | Soil | ILFFDSEEDYRQGDEALNAMPATDTPGQRTSVKKYQVAVRMTD |
| Ga0193700_10415951 | 3300019873 | Soil | AERSGAIVFFETEEGYRRGDEILNAMPAGETPGQRKSVTKYDVAIRMTT |
| Ga0193741_10784622 | 3300019884 | Soil | ALAVLFFDSEDDYAAGDAALDAMPAGDTPGRRTSVTKYDVVARMTG |
| Ga0197907_109317911 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | QALAIVFFENEDEYRKGDEVLGSMDTGDTPGRRTGVTKYQVATRMTA |
| Ga0206350_106991281 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | EDDYRAGDEILNAMPAGDTPGRRSDVAKYQVAYRMTQ |
| Ga0210382_102048861 | 3300021080 | Groundwater Sediment | ADYKQGDDALNAMPAGDTPGKRASVTKYEVAFRMTD |
| Ga0193737_10575063 | 3300021972 | Soil | DEDYRRGDEALSAMPAGDTPGQRTSVAKYQVAFRMTG |
| Ga0247745_10454301 | 3300022898 | Soil | TEDDYRRGDEALNAMPGGDTPGKRTSVAKYQVAFRMTE |
| Ga0247751_10117483 | 3300023069 | Soil | VFFDNEDDYRQGDEALNAMPTGDTPGRRTSVTKYDVPVRMTS |
| Ga0210076_11426581 | 3300025567 | Natural And Restored Wetlands | LVFFETEDDYRRGDAALNAMPADETPGRRTSVKKYNVALRMTG |
| Ga0210143_10165441 | 3300025792 | Natural And Restored Wetlands | DYRRGDEALNAMPAGDTPGRRSSVARYDVAVRMSD |
| Ga0207688_106281912 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TEDDYTQGDAVLSAMPTGDTPGRRVSVEKYAVPVRRTA |
| Ga0207643_110695951 | 3300025908 | Miscanthus Rhizosphere | ILFFENEDDYKTGDETLSAMPASDTPGTRTSVAKYQVAFRMAD |
| Ga0207663_109832341 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VILFFDTEDDYERGDEALSAMPADETPGKRTSVAKYQVAFRMRD |
| Ga0207663_112065991 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLIFETEDDYRVGDEFLNAMPAGDTPGRRTSVTKYEVALRMASTHS |
| Ga0207660_105044522 | 3300025917 | Corn Rhizosphere | VVIFFDSEDDYVRGDEALNAMPAGETPGRRTSVAKYDVAIRESG |
| Ga0207657_113854081 | 3300025919 | Corn Rhizosphere | ILFFDNDDDYARGDAALNAMPIGDTPGRRASVTKYQVAFRMTD |
| Ga0207661_106189231 | 3300025944 | Corn Rhizosphere | VFFENEDEYRKGDEVLGSMDTGDTPGRRTGVTKYQVATRMTA |
| Ga0207712_104605992 | 3300025961 | Switchgrass Rhizosphere | VILFFDSEEDYRQGDETLNAMPAGDTPGQRSGVAKYEVAVRMAV |
| Ga0207712_114322712 | 3300025961 | Switchgrass Rhizosphere | PEGLKAKEIVVLYDAGAEKALVTLFFDSEEDYRSSDEVLNAMPADETPGRRASVTKYAVALRETL |
| Ga0207708_101171634 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VILFFDSEEDYRQGDETLNAMPAGDTPGQRSGVAKYDVAVRMAV |
| Ga0207702_108459112 | 3300026078 | Corn Rhizosphere | IVFFENEDEYRKGDEVLSSMDAGDTPGRRTGVTKYQVATRMTA |
| Ga0207702_117037311 | 3300026078 | Corn Rhizosphere | DSEEDYRQGDEALNAMPAEDTPGKRSSVKKYDVVHRQTV |
| Ga0207648_118575772 | 3300026089 | Miscanthus Rhizosphere | QAVVVVFFETEDDYRRGDEILSAMPAGETPGRRTSVNKYDVAARATP |
| Ga0209234_12435011 | 3300026295 | Grasslands Soil | PQADTSLAIVFFETEDDYRRGDEILSAMPAGDTPGRRTSVTKYDVATRMKS |
| Ga0209803_12285472 | 3300026332 | Soil | VILFFETDDDYKRGDEVLNAMPAGDTPGRRTSVTKYNVATRMTV |
| Ga0209059_11995952 | 3300026527 | Soil | AILFFDNDDDYKRGDDALNAMPTDDTPGRRTSVTKYDVAVRMTG |
| Ga0209874_10070321 | 3300027577 | Groundwater Sand | LVILFFETEDDYRHGDEVLNAMPADDTPGRRTSVTKYDVATRMTV |
| Ga0209068_103495831 | 3300027894 | Watersheds | VLFFETEDDYRRGDQVLTAMPADDTPGRRTSVTRYDVAVRMTA |
| Ga0247749_10195781 | 3300027993 | Soil | GNEDDYRAGDEILNAMPAGDTPGRRSDVAKYQVAYRTTQ |
| Ga0247818_106854052 | 3300028589 | Soil | FDSEEDYRQGDETLNAMPAGDTPGQRSGVAKYDVAVRMAV |
| Ga0247822_102060841 | 3300028592 | Soil | EILILHDAATDSALAIVFFDSDDDYATGDAALSAMPAGDTPGRRTSVTKYDVVARMTS |
| Ga0307313_102028661 | 3300028715 | Soil | DYQRGDAALSAMPAGDTPGQRTSVAKYQVAFRMTD |
| Ga0307311_102208311 | 3300028716 | Soil | VVLFFESEDDYRQGDETLNAMPAGDTPGQRSSVTKYEVAMRMTP |
| Ga0307301_100357651 | 3300028719 | Soil | LFFESDDDYQRGDEALNAMPASDTPGQRTSVAKYQVAFRMTD |
| Ga0307320_100613344 | 3300028771 | Soil | ESEDDYRQGDETLNAMPAGDTPGQRSSVTKYEVAVRMTP |
| Ga0307323_100704111 | 3300028787 | Soil | DMSLAILFFESEDDYATGDAALNAMPTADTPGQRTSVTKYDVVMRMVD |
| Ga0307287_101289663 | 3300028796 | Soil | VILFFETDDDYQRGDEALNAMPASDTPGQRTSVAKYQVAFRMTD |
| Ga0307284_103095743 | 3300028799 | Soil | ILFFDTDEDYQRGDAALSAMPAGDTPGQRTSVAKYQVAFRMTD |
| Ga0307281_102183121 | 3300028803 | Soil | FESEDDYRRGDEALNAMPTTDTPGQRTSVTKYQVAFRMAD |
| Ga0307305_104421091 | 3300028807 | Soil | IVFFETEDDYKRGDEMLSAMPAGDTPGRRSSVTKYDVATRMTA |
| Ga0307292_103604891 | 3300028811 | Soil | EKSLVILFFETEDDYRRGDEMLNAMPAGDTPGRRTSVTKYNVATRMTS |
| Ga0307302_104125842 | 3300028814 | Soil | ILFFDTDEDYQRGDAALSAMPADDTPGQRTSVAKYQVAFRMTD |
| Ga0307302_106785401 | 3300028814 | Soil | FESEDDYRQGDETLNAMPAGDTPGQRSSVTKYEVAMRMTP |
| Ga0307310_103990822 | 3300028824 | Soil | TDEDYKRGDEILNAMPAGDTPGKRTSVTRYDVAHRMKS |
| Ga0307312_102452861 | 3300028828 | Soil | VLFFETEADYKQGDDALNAMPAGDTPGKRASVTKYEVAFRMTD |
| Ga0307289_102776573 | 3300028875 | Soil | VAIVFFDNEDDYRQGDEALNAMPTGDTPGRRTSVTKYDVPVRMTS |
| Ga0307278_103588121 | 3300028878 | Soil | LVIVFFETDDDYQRGDEALSAMPAGDTPGQRTSVSKYQVAFRMTD |
| Ga0307308_105226782 | 3300028884 | Soil | AVVILFFETEDDYQRGDEILNAMPAGETPGQRKSVTKYDVAIRMTT |
| Ga0307308_105708082 | 3300028884 | Soil | VILFFGTEDDYRRGDETLNAMPAGDTPGRRTSVTKYNVATRMT |
| Ga0308202_11364111 | 3300030902 | Soil | SLVVVFFDSEDDYQRGDEALDAMPADDTPGRRTSVAKYDVAIRMTP |
| Ga0308198_10878632 | 3300030904 | Soil | SLVIVMFETDDDYRRGDEILSAMPAGDTPGKRTSVTKYDVGTRMKS |
| Ga0299913_103526791 | 3300031229 | Soil | AIVFFETEEDYERGDEVLSAMPADDTPGRRTSVARYDVALRMTP |
| Ga0170819_170144332 | 3300031469 | Forest Soil | ETEDEYRVGDEFLNAMPTGDTPGRRTSVTKYDVALRMTPTHT |
| Ga0310813_111050371 | 3300031716 | Soil | LAIVFFENEDEYRKGDEVLGSMDTGDTPGRRTGVTKYQVATRMTA |
| Ga0318501_104046222 | 3300031736 | Soil | VLPFFESEDDYQRGDEVLNAMPASDTPGRRTSVTRYEVAFRLSN |
| Ga0307468_1001465011 | 3300031740 | Hardwood Forest Soil | DAERSVVIIFFDSEEDYRRGDEILGAMPADETPGKRTGVQKYDVPLRMTM |
| Ga0318564_103857962 | 3300031831 | Soil | SLVVMFFDNEDDYALGDATLNAMPAGDTPGQRTGVAKYDVALRVTA |
| Ga0307412_110080671 | 3300031911 | Rhizosphere | EDDYAKGDAALNAMPAGDTPGRRSSVKKYDVAFRMAQ |
| Ga0308174_117881692 | 3300031939 | Soil | LVILFFETEADYQRGDEALNAMPAGDTPGKRTSVAKYQVAFRLTD |
| Ga0307409_1012824941 | 3300031995 | Rhizosphere | DAEKSVVVLFFDSEEDYRQGDETLSAMDAGDTPGQRTGVAKYEVAMRMAT |
| Ga0310902_108409751 | 3300032012 | Soil | SVVIVFFDNEDDYRTGDEALNAMPAGDTPGTRTSVAKYEVPIRMAT |
| Ga0335085_113596242 | 3300032770 | Soil | EDDYRRGDETLNAMPAGDTPGRRTSVQKYDVALRMSI |
| Ga0247829_106164601 | 3300033550 | Soil | SVVIVFFDSEDDYAKGDAALSAMPAGDTPGRRTSVKKYEVAFRMAE |
| Ga0247830_102485684 | 3300033551 | Soil | TDSALAIVFFDSDDDYATGDAALSAMPAGDTPGRRTSVTKYDVVARMTP |
| Ga0314864_0036898_1_138 | 3300033805 | Peatland | LVVVFFDNEDDYRKGDEFLSAMPAGDTPGRRSSVARYDVALRMTQ |
| Ga0314788_090871_2_136 | 3300034666 | Soil | VVVFFETEDDYRRGDEILSAMPAGETPGRRTSVNKYDVAARATP |
| ⦗Top⦘ |