NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F023977

Metagenome / Metatranscriptome Family F023977

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023977
Family Type Metagenome / Metatranscriptome
Number of Sequences 208
Average Sequence Length 47 residues
Representative Sequence SGKDRAYKAGRLKSRGAGRESEGFVVPEKACKITRWREGALL
Number of Associated Samples 196
Number of Associated Scaffolds 208

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.34 %
% of genes near scaffold ends (potentially truncated) 92.79 %
% of genes from short scaffolds (< 2000 bps) 94.71 %
Associated GOLD sequencing projects 194
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.923 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(6.731 % of family members)
Environment Ontology (ENVO) Unclassified
(24.038 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.058 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 0.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 208 Family Scaffolds
PF00078RVT_1 52.40
PF08388GIIM 17.31
PF13086AAA_11 0.96
PF13408Zn_ribbon_recom 0.48
PF01402RHH_1 0.48
PF01609DDE_Tnp_1 0.48
PF00850Hist_deacetyl 0.48
PF14706Tnp_DNA_bind 0.48
PF00696AA_kinase 0.48
PF00926DHBP_synthase 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 208 Family Scaffolds
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.96
COG01083,4-dihydroxy-2-butanone 4-phosphate synthaseCoenzyme transport and metabolism [H] 0.48
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.48
COG3293TransposaseMobilome: prophages, transposons [X] 0.48
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.48
COG5421TransposaseMobilome: prophages, transposons [X] 0.48
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.48
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.58 %
UnclassifiedrootN/A14.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918008|ConsensusfromContig326700Not Available770Open in IMG/M
3300000828|JGI12467J12023_1151678All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300001526|A105W1_1152238All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7615Open in IMG/M
3300001867|JGI12627J18819_10134789Not Available1010Open in IMG/M
3300002914|JGI25617J43924_10292404All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300003994|Ga0055435_10023607All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300004157|Ga0062590_100182523All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300004480|Ga0062592_100184550All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300004554|Ga0068959_1130745All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300004612|Ga0068961_1314222All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300004803|Ga0058862_12512859All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300004972|Ga0072325_1290329All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300005178|Ga0066688_10499513All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005187|Ga0066675_11114147All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005331|Ga0070670_100239149All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300005332|Ga0066388_104014417All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300005338|Ga0068868_101476725All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005367|Ga0070667_101559661All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005435|Ga0070714_101300521All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300005435|Ga0070714_102446934All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005444|Ga0070694_100698092All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300005468|Ga0070707_100968675All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300005542|Ga0070732_10567550All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7689Open in IMG/M
3300005602|Ga0070762_11263904Not Available512Open in IMG/M
3300005618|Ga0068864_100764371All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300006028|Ga0070717_11330133All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300006052|Ga0075029_101126792All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300006102|Ga0075015_100045560All Organisms → cellular organisms → Bacteria2057Open in IMG/M
3300006163|Ga0070715_10067531All Organisms → cellular organisms → Bacteria1588Open in IMG/M
3300006237|Ga0097621_101034788All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300006755|Ga0079222_12121224Not Available556Open in IMG/M
3300006800|Ga0066660_10493902All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300006800|Ga0066660_10817948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8759Open in IMG/M
3300006871|Ga0075434_101574533All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300009082|Ga0105099_10258375All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300009082|Ga0105099_10529415All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300009089|Ga0099828_10804085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli842Open in IMG/M
3300009093|Ga0105240_12676605Not Available515Open in IMG/M
3300009101|Ga0105247_10488755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli895Open in IMG/M
3300009131|Ga0115027_11343944Not Available579Open in IMG/M
3300009157|Ga0105092_10153064All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300009174|Ga0105241_11383421All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009176|Ga0105242_11120347Not Available802Open in IMG/M
3300009521|Ga0116222_1070772All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G71507Open in IMG/M
3300009552|Ga0116138_1074229All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300009621|Ga0116116_1196647All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300009629|Ga0116119_1159425All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300009640|Ga0116126_1187302Not Available673Open in IMG/M
3300009683|Ga0116224_10140249All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300009698|Ga0116216_10427774All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7802Open in IMG/M
3300009762|Ga0116130_1280957Not Available531Open in IMG/M
3300010046|Ga0126384_11716352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300010101|Ga0127481_1057118Not Available501Open in IMG/M
3300010360|Ga0126372_11536611Not Available703Open in IMG/M
3300010379|Ga0136449_100901274All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300010379|Ga0136449_101243038All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300010399|Ga0134127_13245811All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300010401|Ga0134121_13030984All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300010403|Ga0134123_10234331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens1586Open in IMG/M
3300011056|Ga0138538_1090844All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300011062|Ga0138582_1010183All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300011086|Ga0138564_1133934All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7798Open in IMG/M
3300011109|Ga0138539_1025985All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300011120|Ga0150983_15598578Not Available503Open in IMG/M
3300012089|Ga0153924_1062627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli729Open in IMG/M
3300012208|Ga0137376_11323068All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300012209|Ga0137379_11132891All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7688Open in IMG/M
3300012362|Ga0137361_10209840All Organisms → cellular organisms → Bacteria1764Open in IMG/M
3300012532|Ga0137373_10502068All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300012668|Ga0157216_10082102All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300012917|Ga0137395_10609701All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300012958|Ga0164299_10430026All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300013102|Ga0157371_10333854All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300013297|Ga0157378_11806656All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300014153|Ga0181527_1070036All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300014169|Ga0181531_10625982All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7667Open in IMG/M
3300014498|Ga0182019_11087863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300014501|Ga0182024_11181311All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7897Open in IMG/M
3300014884|Ga0180104_1019515All Organisms → Viruses → Predicted Viral1668Open in IMG/M
3300014968|Ga0157379_10713950All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300015083|Ga0167624_1038190All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300016750|Ga0181505_10176379All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300017821|Ga0187812_1034515All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300017930|Ga0187825_10435410Not Available507Open in IMG/M
3300017942|Ga0187808_10213727All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300017975|Ga0187782_10529115All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300017988|Ga0181520_10535108All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300018002|Ga0187868_1078369All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300018019|Ga0187874_10229446Not Available766Open in IMG/M
3300018025|Ga0187885_10092480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1479Open in IMG/M
3300018038|Ga0187855_10089570All Organisms → cellular organisms → Bacteria1867Open in IMG/M
3300018047|Ga0187859_10168770All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G71163Open in IMG/M
3300018058|Ga0187766_10991120Not Available598Open in IMG/M
3300018084|Ga0184629_10139152All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300018085|Ga0187772_10543907All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300018086|Ga0187769_10954818All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300018414|Ga0194135_10505575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sandaracinaceae → Sandaracinus → Sandaracinus amylolyticus801Open in IMG/M
3300018431|Ga0066655_10740805All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300018465|Ga0190269_10742963All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300018468|Ga0066662_10825863All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300018468|Ga0066662_11293944All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300018482|Ga0066669_12096161Not Available533Open in IMG/M
3300019999|Ga0193718_1018174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens1560Open in IMG/M
3300020080|Ga0206350_10877723All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300020579|Ga0210407_10622075All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300021086|Ga0179596_10525417All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300021168|Ga0210406_10784621All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300021403|Ga0210397_10806382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli725Open in IMG/M
3300021433|Ga0210391_10925690All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300022467|Ga0224712_10480487All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300022520|Ga0224538_1029964Not Available594Open in IMG/M
3300022718|Ga0242675_1062107All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7650Open in IMG/M
3300022849|Ga0224531_1003771All Organisms → cellular organisms → Bacteria5454Open in IMG/M
3300022883|Ga0247786_1008239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1915Open in IMG/M
3300023232|Ga0224516_1018045All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300023311|Ga0256681_11151272All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300024271|Ga0224564_1077063All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300025157|Ga0209399_10052848All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300025565|Ga0210110_1098002All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300025580|Ga0210138_1191814All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300025852|Ga0209124_10052245All Organisms → cellular organisms → Bacteria1700Open in IMG/M
3300025900|Ga0207710_10100803All Organisms → Viruses → Predicted Viral1362Open in IMG/M
3300025910|Ga0207684_10880582All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300025916|Ga0207663_10769206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium766Open in IMG/M
3300026041|Ga0207639_10219858All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300026078|Ga0207702_11354214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli706Open in IMG/M
3300026118|Ga0207675_100231982All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300026121|Ga0207683_10532382All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300026294|Ga0209839_10190601All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300027570|Ga0208043_1156779All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7591Open in IMG/M
3300027590|Ga0209116_1127404All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300027743|Ga0209593_10345276All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300027823|Ga0209490_10358586All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300027855|Ga0209693_10148211All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300027911|Ga0209698_10567007All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7875Open in IMG/M
3300027911|Ga0209698_10723402All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300027911|Ga0209698_10984254Not Available629Open in IMG/M
3300027965|Ga0209062_1077896All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300028562|Ga0302151_10040548All Organisms → cellular organisms → Bacteria1687Open in IMG/M
3300028762|Ga0302202_10162591All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300028776|Ga0302303_10106007All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300028800|Ga0265338_10334958All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300028813|Ga0302157_10122393All Organisms → cellular organisms → Bacteria1589Open in IMG/M
3300028860|Ga0302199_1188611All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300028906|Ga0308309_11385129All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300029636|Ga0222749_10530294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300029701|Ga0222748_1035826Not Available799Open in IMG/M
3300029908|Ga0311341_10185703All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300029911|Ga0311361_10026674All Organisms → cellular organisms → Bacteria10292Open in IMG/M
3300029911|Ga0311361_10509325All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300029943|Ga0311340_10833039All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300029953|Ga0311343_10213419All Organisms → cellular organisms → Bacteria → Proteobacteria1985Open in IMG/M
3300029955|Ga0311342_10131727All Organisms → cellular organisms → Bacteria2564Open in IMG/M
3300029999|Ga0311339_11022349Not Available772Open in IMG/M
3300030048|Ga0302273_1079208All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300030114|Ga0311333_11779160All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300030339|Ga0311360_11303813Not Available570Open in IMG/M
3300030399|Ga0311353_11003976All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300030687|Ga0302309_10309922All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300030762|Ga0265775_110488All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300030764|Ga0265720_1007426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli693Open in IMG/M
3300030824|Ga0265726_107326Not Available501Open in IMG/M
3300030855|Ga0075374_11361312All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031042|Ga0265749_103937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8553Open in IMG/M
3300031234|Ga0302325_12982404All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031236|Ga0302324_101520610All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300031261|Ga0302140_10018805All Organisms → cellular organisms → Bacteria8299Open in IMG/M
3300031366|Ga0307506_10095425All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300031446|Ga0170820_10831393All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7682Open in IMG/M
3300031544|Ga0318534_10434015Not Available753Open in IMG/M
3300031680|Ga0318574_10734334Not Available579Open in IMG/M
3300031708|Ga0310686_112809104All Organisms → cellular organisms → Bacteria4974Open in IMG/M
3300031716|Ga0310813_12350695All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031720|Ga0307469_11953587All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300031722|Ga0311351_10116548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2038Open in IMG/M
3300031723|Ga0318493_10142189All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300031726|Ga0302321_102231662All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos28G7637Open in IMG/M
3300031747|Ga0318502_10847560All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031862|Ga0315280_10326400All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300031902|Ga0302322_101487768All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300031942|Ga0310916_11349496Not Available585Open in IMG/M
3300031962|Ga0307479_10374491All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300031962|Ga0307479_10579329All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300032027|Ga0247536_101896All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300032053|Ga0315284_10414106All Organisms → cellular organisms → Bacteria1659Open in IMG/M
3300032177|Ga0315276_11030855All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300032515|Ga0348332_11723321All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300032782|Ga0335082_10261722All Organisms → cellular organisms → Bacteria1609Open in IMG/M
3300032782|Ga0335082_10491561All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300032783|Ga0335079_10754901All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300032805|Ga0335078_11248037All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300032828|Ga0335080_10390577All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300032828|Ga0335080_11654291All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300032892|Ga0335081_11654602All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300032892|Ga0335081_12189254Not Available583Open in IMG/M
3300032893|Ga0335069_10555188All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300032897|Ga0335071_10798905All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300033004|Ga0335084_12430669All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300033290|Ga0318519_10702985Not Available618Open in IMG/M
3300033405|Ga0326727_10651548All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300033419|Ga0316601_100643516All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300033475|Ga0310811_10368544All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300033557|Ga0316617_101519069All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300033823|Ga0334837_119027All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300033982|Ga0371487_0029255All Organisms → cellular organisms → Bacteria3547Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.25%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.33%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.37%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.40%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.92%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.92%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.44%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.44%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.44%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.44%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.44%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.44%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.48%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.48%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.48%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.48%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.48%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.48%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.48%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.48%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.48%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.48%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.48%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.48%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300000828Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate C) D5C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004554Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 51 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004612Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004972Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010101Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011056Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011062Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011086Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011109Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012089Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015083Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1C, Ice margin)EnvironmentalOpen in IMG/M
3300015164Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018414Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022520Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 20-24EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022849Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T100EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300023232Peat soil microbial communities from Stordalen Mire, Sweden - IR.F.S.T0EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025157Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes)EnvironmentalOpen in IMG/M
3300025565Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027823Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030048Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030762Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030764Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030824Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031042Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032027Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Bog_all_C_046484302140918008SoilGKDRAYKAGRLKSRGAGRESEGSVVPVKACKITRWREGALL
JGI12467J12023_115167813300000828SoilAEQERPYLAAMSGKDRAYKAGRLKTGGAGRESEGFVVPGKACNITRRREGTLL*
A105W1_115223813300001526PermafrostEQERPSPAAKSGKDRAYKAGRLKMRGAGRESEGFVVPEKACNTTRRREGTLL*
JGI12627J18819_1013478913300001867Forest SoilLSGKDRAYKAGWLKLRGARRESEGSILPRKARKITRRREGTLLWSRR
JGI25617J43924_1029240423300002914Grasslands SoilNAEQERPYSAVESDKDRGYKAGRRKARGAGRESEGFIVPMKACKTTRRREGALL*
Ga0055435_1002360713300003994Natural And Restored WetlandsAAESGKDRWYKAGRLKASGAGRESEGPIVPRKACKTTRRREGALL*
Ga0062590_10018252313300004157SoilEKSVEQERPYLAAGSGEDRAYKAGWLKSRGARRESEGFVVPVKARKTTRWREGALL*
Ga0062592_10018455013300004480SoilKDRAYKAGRLKTHGARRESERSEVPAKARKTTRWREGALL*
Ga0068959_113074513300004554Peatlands SoilVESDKDRGYKAGRLKSHGAGRESERPTVPEKACNKTRWREGALL*
Ga0068961_131422213300004612Peatlands SoilVEQERPYLAAKSGKDRAYKAGRLKSSGAGRESEGSVVPRKACKTTRRREGALL*
Ga0058862_1251285913300004803Host-AssociatedSGKDRAYKAGRLKSRGAGRESERPKVPRKACKTTRWREGALL*
Ga0072325_129032923300004972Peatlands SoilSGKDRAYKAGRLKSSGAGRESEGSVVPRKACKTTRRREGALL*
Ga0066688_1049951313300005178SoilSAEQERPYLAASQAKCRGYKAGRLKAYGAGRESEGLTVPKKACKITRWREGALL*
Ga0066675_1111414713300005187SoilAEQERPYLAAKSGKDRTYKAGWLKMDGAGRESEGSIVPAKACSKTRWREGALL*
Ga0070670_10023914913300005331Switchgrass RhizosphereAEQERPYLAAESGKDRWYKAGRLKASGAGRESEGPIVPRKACKTTRRREGALL*
Ga0066388_10401441723300005332Tropical Forest SoilRVGQVRAYKVGRLKVRGAGRESERPDVPVKACKTTRWREGALL*
Ga0068868_10147672513300005338Miscanthus RhizospherePYLAAGSGEDRAYKAGWLKSRGARRESEGFVVPVKARKTTRWREGALL*
Ga0070667_10155966113300005367Switchgrass RhizosphereVEQERPYLAAGSGEDRAYKAGWLKSRGARRESEGFVVPVKARKTTRWREGALL*
Ga0070714_10130052123300005435Agricultural SoilAALSGKDRAYKAGRLKSRGAGRESERSVVPMKARKTTRWREGALL*
Ga0070714_10244693413300005435Agricultural SoilNAEQERPYLAVGSDKDRAYKAGRPKANGAGRESEGFVVPEKACKTTRWREGALL*
Ga0070694_10069809223300005444Corn, Switchgrass And Miscanthus RhizosphereKDRAYKAGRLKSRGAGRESERSIVPVKVRNTTHWREGALL*
Ga0070707_10096867523300005468Corn, Switchgrass And Miscanthus RhizosphereGEDRAYKAGRLKSYGARRESERSEVPRKACKTTRWREGALL*
Ga0070732_1056755023300005542Surface SoilAYKAGRRKAHGAGRESEGFIVPGKACKKTRWREGALL*
Ga0070762_1126390413300005602SoilAEQERPYLAAKSGKDRAYKTGRLKAGGARRESEGFIVPRKACNTTRWREGALL*
Ga0068864_10076437113300005618Switchgrass RhizosphereGEDRAYKAGWLKSRGARRESEGFVVPVKARKTTRWREGALL*
Ga0070717_1133013313300006028Corn, Switchgrass And Miscanthus RhizosphereEQERPYLAAESGKDQAYKAGRLKAQGAGRESERSIVPGKACKTTRWREGALL*
Ga0075029_10112679223300006052WatershedsAEQERPSPAAKSGKDRAYKAGRLKASGAGRESEGFVVPRKACNTTRRREGTLL*
Ga0075015_10004556023300006102WatershedsMLVRQNREYKAGRLKTSGAGRETEGLVVPRKACKITRWREGALL*
Ga0070715_1006753123300006163Corn, Switchgrass And Miscanthus RhizosphereESGKDRWYKAGRLKASGAGRESEGPIVPRKACKTTRRREGALL*
Ga0097621_10103478823300006237Miscanthus RhizosphereSGKDRAYKAGRLKSRGAGRESEGFVVPEKACKITRWREGALL*
Ga0079222_1212122413300006755Agricultural SoilDRGYKAGRLKSRGARRESEGSAVPEKACKTTRWREGALL*
Ga0066660_1049390213300006800SoilAEQERPYLAAWSGKDRGYKAGRPKSRGAGRESEGFVVPGKACNTTRWREGTLL*
Ga0066660_1081794823300006800SoilEKSVEQERPYLAAKSGKDRGYKAGRLKSRGARRESEGSVVPVKARKTTRWREGTLL*
Ga0075434_10157453323300006871Populus RhizosphereRPYLAAKSGKDRAYKAGWRKARGARRESERSEVPKKACKTTRWREGALL*
Ga0105099_1025837523300009082Freshwater SedimentYKAGRLKSRGAGRESERPVIPRKARKTTRWREGALL*
Ga0105099_1052941513300009082Freshwater SedimentERPYLAAKSGKDRAYKAGRLKARGAGRESERPEVPKKARKTTRWREGALL*
Ga0099828_1080408513300009089Vadose Zone SoilDRAYKAGRRKAHGAGRESEGFVVPEKARNTTRWREGTLL*
Ga0099827_1096266913300009090Vadose Zone SoilLEKRDVEQERPYPVAKSGKDCGTRAGRLKPSRAGRESEGFVVPEKAARNRWREGALL*
Ga0105240_1267660513300009093Corn RhizosphereLAAWSGKDRGYKAGRWKSRGAGRESEGFVVPEKACNRTRWREGTLL*
Ga0105247_1048875523300009101Switchgrass RhizosphereAEQERPYLAAESGKDRWYKAGRLKASGAGRESEGPIVLRKACKTTRRREGALL*
Ga0115027_1134394413300009131WetlandAESGKDQAYKAGRLKSSGAGRESEGPEVPEKACKTTRWREGALL*
Ga0105092_1015306423300009157Freshwater SedimentERPYLAAKSGKDQAYKAGWLKSQGAGRESERPVVPVKACSTTRWRKGALL*
Ga0105241_1138342113300009174Corn RhizosphereAASGKDRAYKAGRLKSHGARRESERSEVPKKACKITRWREGALL*
Ga0105242_1112034713300009176Miscanthus RhizosphereQPVSGKDRGHKAGWLKARGAGRESEGLVVPTKACMTTRWREGALL*
Ga0116222_107077233300009521Peatlands SoilRAEQERPYLAAKSGKDRAYKTGRLKADGARRESEGFIVPRKACNTTRRREGALL*
Ga0116138_107422913300009552PeatlandKDRAYKAGRLKSRGAGRESERPVLPKKARKTTRWREGALL*
Ga0116116_119664713300009621PeatlandNAEQERPYLAAQSGKDRAYKTGRLKARGAGRESEGFKVPGKACKITRWREGTLL*
Ga0116119_115942513300009629PeatlandRPYLAAWSGKDREYKAGRSKSSGAGRESEGSVVPMKACKITRWREGALL*
Ga0116126_118730213300009640PeatlandKSAEQERPYLAAKSGRDRWYKAGRLKSSGARRESEGSAVPVKARKTTRWREGALL*
Ga0116224_1014024913300009683Peatlands SoilDRGYKAGRLKSRGAGRESEGPIVPEKACKTTRWREGALL*
Ga0116216_1042777413300009698Peatlands SoilRAYKTGRLKADGARRESEGFIVPRKACNTTRRREGALL*
Ga0116130_128095713300009762PeatlandEQERPYLAAWSGKDRWYKAGRLKSSGAGRESEGSAVPVKARKTTRWREGALL*
Ga0126384_1171635213300010046Tropical Forest SoilERPYLTAESGEDRGYKAGRLKSIGAGRESEGLIVPEKACKTTRSREGVLL*
Ga0127481_105711813300010101Grasslands SoilSGKDRAYKAGRLKSHGAGRESEGFVVPVKARSKTRWREGALL*
Ga0126372_1153661123300010360Tropical Forest SoilAAESGRDRAYKARWLKSHGAGRKSEGSIVPVKACSKTRRREGALL*
Ga0136449_10090127413300010379Peatlands SoilEKSVEQERPYLAAQSGEDRWYKAGRLKSSGAGRESEGFVVPVKACKTTRWREGTLL*
Ga0136449_10124303813300010379Peatlands SoilPYLAAKSGEDRGYKAGRLKSRGAGRESEGPIVPEKACKTTRWREGALL*
Ga0134127_1324581113300010399Terrestrial SoilAESGKDRAYKVGWPKARGARRESERSVIPVKACKTTRWREGTLL*
Ga0134121_1303098423300010401Terrestrial SoilAYKAGRLKARGAGRKSEGSIVPGKACSKTRWREGALL*
Ga0134123_1023433113300010403Terrestrial SoilYLAAKSGKDRAYKAGRLKARGAGRESERSVIPKKACKTTRWREGALL*
Ga0138538_109084413300011056Peatlands SoilRPYLAAKSGKDRAYKAGRLKSHGAGRESEGSVVPMKACSQTRWREGALL*
Ga0138582_101018313300011062Peatlands SoilKDRAYKAGRLKSSGAGRESEGLVVPRKACKITRWREGALL*
Ga0138564_113393413300011086Peatlands SoilYLAAKSGEDRGYKAGRLKSRGAGRESEGPIVPEKACKTTRWREGALL*
Ga0138539_102598523300011109Peatlands SoilYKAGRLKSHGAGRESEGSVVPMKACSQTRWREGALL*
Ga0150983_1559857813300011120Forest SoilSKVEQERPYLAAMSGKDRAYKAGRLKSGGAGRESEGFVVPMKECSKTLRREGALL*
Ga0153924_106262713300012089Attine Ant Fungus GardensRPYLAAESGKDRWYKAGRPKTSGAGRESEGLVVPRKACKTTRWREGALL*
Ga0137388_1165016723300012189Vadose Zone SoilLEKRDVEQERPFPVAKSGKDCGTRAGRLKPSRAGRESEGFVVPEKAARNRWREGALL*
Ga0137376_1132306813300012208Vadose Zone SoilAAMSGKDRAYKAGWLKSRGARRESEGSTVPEKACKITRWREGALL*
Ga0137379_1113289113300012209Vadose Zone SoilDRAYKAGRLKASGAGRKSEGFGIPEKACSKTRWREGALL*
Ga0137361_1020984033300012362Vadose Zone SoilAKIGVEQERPYLAALSGKDRAYKAGWLKSSGAGRESEGFVVPVKEFSKTLRREGALL*
Ga0137373_1050206813300012532Vadose Zone SoilERPYLAAWSGKDRGYKAGRLKSHGAGRESERSEVPKKACKTTRWREGALL*
Ga0157216_1008210213300012668Glacier Forefield SoilGKDRAYKAGWLKSHGAGRESEGFVVPMKARKITCWREGALL*
Ga0137395_1060970113300012917Vadose Zone SoilRAYQAGWLKAHGAKRESEGFTVPRKARKRTRWREGTLL*
Ga0164299_1043002623300012958SoilAWSGKDRAYKAGRLKTGGAGRESERSIVPEKACNTTRRREGALL*
Ga0157371_1033385413300013102Corn RhizosphereMARFERRTAEQERPYLAAWSGKDRAYKAGWLKAGGAGRESERSVVPRKACKTTRRREGTLL*
Ga0157378_1180665613300013297Miscanthus RhizosphereAAKSGKDRAYKAGRLKSHGAGRESEGFVVPEKACMITRRREGTLL*
Ga0181527_107003613300014153BogSSAEQERPYPAAESGKDRWYKAGRRKASGAGRESEGSIVPGKACNTTRWRKGTLL*
Ga0181531_1062598213300014169BogQERASPAAMSGKDRAYKAGRLKVRGAGRESEGFVVPEKACNTTRRREGTLLWSGL*
Ga0182019_1108786313300014498FenRPYLAAWSGKDRWYKAGRLKSSGAGRESEGSIVPRKACKITRWREGALL*
Ga0182024_1118131123300014501PermafrostPSPAAKSGKDRAYKAGRLKVRGAGRESEGFVVPMKACNTTRRREGTLL*
Ga0180104_101951523300014884SoilGKDRAYKAGRQKAHGAGRESERSIVPGKACNTTRCREGALL*
Ga0157379_1071395013300014968Switchgrass RhizosphereYKAGRLKASGAGRESEGPIVPRKACKTTRRREGALL*
Ga0167624_103819013300015083Glacier Forefield SoilNVEQERPYLAAKSGKDRAYKAGRLKARGARRESEGFIVPMKACKITRWREGALLGSCL*
Ga0167652_100862023300015164Glacier Forefield SoilVKLDLSGVEGDGTLEEKDAEQERPYPAAESGQDCGTRAERLKPSRAGRESEGFVVPKKAARNRWREGTLL*
Ga0181505_1017637913300016750PeatlandKSVEQERPYLAAWSGKDREYKAGRSKSSGAGRESEGSAVPMKARKTTRWREGALL
Ga0187812_103451533300017821Freshwater SedimentSDKDRGHKAGRRKACGARRESEGFIVPRKACKTTRRREGALL
Ga0187825_1043541013300017930Freshwater SedimentQSNVEQERPYLAALSGKDRAYKAGRLKSRGARRESERSEVPRKARKITRWREGALL
Ga0187808_1021372723300017942Freshwater SedimentLGKNSAEQERPYSAAESGKDRAYKAGWLKALGAERDSERSEVPRKACKITRWR
Ga0187782_1052911513300017975Tropical PeatlandMRNRRGPTLAAKSGEDRAYKAGRLKSHGARRESERPVLPKKARKTTRWREGALL
Ga0181520_1053510813300017988BogLAVKSDKDWGHKAGRLKAHEARRESEGFIVPKKACKTTRWREGTLL
Ga0187868_107836923300018002PeatlandGYKAGRLKSRGAGRESEGSVVPVKACKTTRWREGALL
Ga0187874_1022944623300018019PeatlandYKAGRLKSRGAGRESEGFVVPAKACKTTRWREGTLL
Ga0187885_1009248013300018025PeatlandNAEQERPYLAAQSGKDRAYKTGRLKARGAGRESEGFKVPGKACKITRWREGTLL
Ga0187855_1008957033300018038PeatlandLAAESGKDRAYKAGRQKSRGARRESERPEVPKKACKTTRWREGALL
Ga0187859_1016877023300018047PeatlandEQERPYLAAKSGKDRAYKTGRWKARGAGRESEGFIVPRKACNTTRRREGTLL
Ga0187766_1099112023300018058Tropical PeatlandDRWYKAGRLKSSGARRESEGSIVPMKACKTTRWREGALL
Ga0184629_1013915213300018084Groundwater SedimentKSGKDRAYKAGRRKAQGAGRESEGFIVPMKACKITRWREGALL
Ga0187772_1054390713300018085Tropical PeatlandDRGYKAGWLKARGARRESEGLVVPAKARKTTRWREGALL
Ga0187769_1095481813300018086Tropical PeatlandRPYLVAKSGKGRAYKAGRLKSHGTGRESEGSVVPGKARNITRWREGALL
Ga0194135_1050557523300018414WatershedsKIAEQERPSPAAMSGKDRAYKAGRRKVSGAGRESEGFVVPKKARNTTRRREGTLL
Ga0066655_1074080523300018431Grasslands SoilYKAGRLKTGGAGRESERSIVPEKACNTTRRREGALL
Ga0190269_1074296323300018465SoilYKAGWLKSRGARRESERPTVPRKARKTTRWREGALL
Ga0066662_1082586313300018468Grasslands SoilKAGWLKSWGAGRESEGFVVPMKECSKTLRREGALL
Ga0066662_1129394413300018468Grasslands SoilNSVEQERPYLAAKSGKDRAHKAGRRKAYGAGRESERPEVPRKARKTTRWREGALL
Ga0066669_1209616113300018482Grasslands SoilYLAAESGKDRAYKAGWLKSRGAGRESEGFVVPEKACSKTRWREGALL
Ga0193718_101817433300019999SoilAAESGKDRAYKAGRRKTRGAGRESERPEVPMKARKKTRWREGALL
Ga0206350_1087772313300020080Corn, Switchgrass And Miscanthus RhizosphereERPYLAAWSGKDRAYKAGWLKAGGAGRESERSVVPRKACKTTRRREGTLL
Ga0210407_1062207513300020579SoilAGESGKDRAYKAGRLKARGAGRESEGFIVPKKACSKTRWREGALL
Ga0179596_1052541713300021086Vadose Zone SoilKAGRLKASGAGRESEGPIVPRKACKTTRWREGALL
Ga0210406_1078462113300021168SoilRSNAEQERPYPAAKSGKDRAYKAGRLKARGAGRESERSTVPRKARKITRWREGALL
Ga0210397_1080638213300021403SoilYKAGRLKSSGAGRESEGSVIPMKACKTTRWREGALL
Ga0210391_1092569013300021433SoilEQERPYPAVKSDKDRRYKAGRLKSGGAGRDSEGFVVPAKACNKTRRREGTLL
Ga0224712_1048048723300022467Corn, Switchgrass And Miscanthus RhizosphereQSDAEQERPYLAAWSGKDRAYKAGRLKASGAGRESERSIVPEKACNTTRWREGALL
Ga0224538_102996413300022520SoilTLPGSQSGKDRAYKAGRLKTRGAGRESEGSVVPMKACNTTRRREGALL
Ga0242675_106210713300022718SoilENRAEQERPSPAAVSGKDRAYKAGRLKVPGAGRESEGFVVPGKACSKTRWREGALL
Ga0224531_100377173300022849SoilVEQERPYLAALSGKDRWYKVERLKSSGAGRESEGFIVPEKACKTTRWREGALL
Ga0247786_100823923300022883SoilMARFERRTAEQERPYLAAWSGKDRAYKAGWLKAGGAGRESERSVVPRKACKTTRRREGTL
Ga0224516_101804523300023232SoilIGETLPGSQSGKDRAYKAGRLKTRGAGRESEGSVVPMKACNTTRRREGALL
Ga0256681_1115127213300023311FreshwaterNAEQERPYPAALSGKDRAYKAGRLKAHGAGRESERPAVPAKARKTTRWREGALL
Ga0224564_107706323300024271SoilDRGYKAGRLKSRGAGRETEGFVVPEKARKITRWREGALL
Ga0209399_1005284823300025157Thermal SpringsRPSPAVKSGKDRTYKAGKSKADGAGRESEGFVVPEKARRTTRWREGALL
Ga0210110_109800213300025565Natural And Restored WetlandsSGKDRSYKAGRLKSGGARRESERSIVPGKACSKTRWREGALL
Ga0210138_119181423300025580Natural And Restored WetlandsKKSAEQERPYPAAESGKDRWYKAGRLKASGAGRESEGPIVPRKACKTTRRREGALL
Ga0209124_1005224523300025852Arctic Peat SoilVARLYKKRAEQERPYLAAKSGKDRAYKAGWPKSCGAGRESEGSVVPGKARKTTRWREGTL
Ga0207710_1010080313300025900Switchgrass RhizosphereKNKVEQERPYLAAESGKDRAYKAGWPKTSGAGRESERPVVPEKACKTTRWREGALL
Ga0207684_1088058213300025910Corn, Switchgrass And Miscanthus RhizosphereAYKAGRRKARGAGRESEGFIVPRKACNTTRRREGALL
Ga0207663_1076920613300025916Corn, Switchgrass And Miscanthus RhizosphereNRAEQERSYLAAWSGKDRAYKAGRLKASGAGRKSEGFIVPGKACSKTRWREGALL
Ga0207639_1021985823300026041Corn RhizosphereFERRTAEQERPYLAAWSGKDRAYKAGWLKAGGAGRESERSVVPRKACKTTRRREGTLL
Ga0207702_1135421413300026078Corn RhizosphereESGKDRWYKAGRLKASGAGRESEGPIVPRKACKTTRRREGALL
Ga0207675_10023198233300026118Switchgrass RhizospherePAAESGKDRGYKAGRLKAHGAGRESERSVVPRKACKTTRRREGALL
Ga0207683_1053238223300026121Miscanthus RhizosphereYLAAKSGKDRWYKAGWLKSSGAGRESEGSVVPEKARKITRWREGTLL
Ga0209839_1019060123300026294SoilNKAEQERPYLAAKSGKDRAYKAGWRKTRGARRESERPEVPGKACKITRWREGALL
Ga0208043_115677923300027570Peatlands SoilKSGKDRAYKTGRLKADGARRESEGFIVPRKACNTTRRREGALL
Ga0209116_112740423300027590Forest SoilGYKAGRRKARGAGRESEGFVVPMKACKTTRRREGALL
Ga0209593_1034527613300027743Freshwater SedimentYKAGRLKSHGAGRESERPMVPGKARKITRWREGALL
Ga0209490_1035858613300027823FreshwaterTTSGKDRAYKAGRLKSHGAGRESEGPIVPVKACKITRWREGALL
Ga0209693_1014821113300027855SoilPYLAAESGKDRGYKAGWLKSRGAGRESEGSVVPRKACKITRWREGALL
Ga0209698_1056700713300027911WatershedsYKAGRLKASGAGRETEGFVVPRKACNTTRRREGTLL
Ga0209698_1072340213300027911WatershedsGKDRAYKAGRRKVSGAGRESEGFVVPKKARNTTRRREGTLL
Ga0209698_1098425423300027911WatershedsEQERPYLAAESGKDRAYKAGWLKSRGAGRESEGFTVPEKACSKTRWREGALL
Ga0209062_107789623300027965Surface SoilERPYLAAQSGEDCGYKAGRLKSRRAGRESEGLVVPEKACKTTRWREGALL
Ga0302151_1004054813300028562BogEQERSSPAAMSGKYRAYKAGRWKTHGAGRKSEGFVVPKKACNTTRRREGTLL
Ga0302202_1016259113300028762BogVEQERPYLAALSGKDRWYKVERLKSSGAGRESEGFIVPEKACKTTRWREGTLL
Ga0302303_1010600713300028776PalsaKSGKDRAYKAGRLKARGAGRESEGFIVPGKACKKTRWREGALL
Ga0265338_1033495813300028800RhizosphereQERPYLAAWSGKDREYKAGRSKSSGAGRESEGSVVPMKARKITRWREGTLL
Ga0302157_1012239323300028813BogSPAAMSGKDRAYKAGRGKTHGAGRKSEGFVVPKKACNTTRRREGTLL
Ga0302199_118861113300028860BogPEETVEQERPYLAALSGKDRWYKVERLKSSGAGRESEGFIVPEKACKTTRWREGTLL
Ga0308309_1138512913300028906SoilQERPSPAAVSGKDRAYKAGRLKVPGAGRESEGFVVPEKACNTTHRREGTLL
Ga0222749_1053029413300029636SoilGKDWAYKAGRLKARGAGRESEGFIVPKKACSKTRWREGALL
Ga0222748_103582613300029701SoilSYLAAKSGKDRGYKAGWLKSRGARRKSEGSVLPMKACSKTRWREGALL
Ga0311341_1018570323300029908BogHKAGRLKVSGAGRESEGFVVPKKACNTTRRREGTLL
Ga0311361_1002667413300029911BogAHKAGRMKVNGAGRKSEGFVVPKKACNTTRRREGTLL
Ga0311361_1050932523300029911BogPAAKSGKDRVYKAGRLKMRGAGRESEGFVVPMKACNKTRRREGTLL
Ga0311340_1083303913300029943PalsaDRGYKAGRLKARGAGRESEGFVVPEKACNTTRRREGALL
Ga0311343_1021341923300029953BogMAALSGKDRWYKVERLKSSGAGRESEGFIVPEKACKTTRWREGTLL
Ga0311342_1013172733300029955BogVEQERPYLAALSGKDRWYKVERLKSSGAGRESEGFIVPEKACKTTR
Ga0311339_1102234923300029999PalsaYKAGRLKSHGAGRKSEGSIVPGKACSKTRWREGALL
Ga0302273_107920823300030048BogQERPYLAAESGKDRAYKAGWLKANGAGRESERPVVPRKACKTTRWREGALL
Ga0311333_1177916013300030114FenPGGKSGKDRAYKAGRLKTNGARRESEGFVVPEKACSKTRWRKGTLL
Ga0311360_1130381313300030339BogERPYRAAESGEDRWYKAGRLKSSGAGRESEGSVVPRKACKTTRWREGALL
Ga0311353_1100397623300030399PalsaAYKAGRLKVPGAGRESEGFVVPEKACNTTRRREGTLL
Ga0302309_1030992213300030687PalsaRPSPAAMSGKDRAYKAGRLKVPGAGRESEGFVVPMKACNTTRRREGTLL
Ga0265775_11048813300030762SoilLAEIEVEQERPYLAAMSGKDRAYKAGWLKSGGAGRESEGFVVPMKECSKTLRREGALL
Ga0265720_100742623300030764SoilVESDKDRGYKAGRRKTHGARRESEGFIVPRKACKTTRWREGALL
Ga0265726_10732613300030824SoilMSGKDRAYKAGWLKSGGAGRESEGFVVPMKECSKTLRREGALL
Ga0075374_1136131213300030855SoilGKDRAYKAGRLKSGGAGRESEGFVVPEKACNTTRRREGTLL
Ga0265749_10393723300031042SoilMSGKDRAYKAGKLKMRGAGRESEGFVVPEKACSKTRRREGTLL
Ga0302325_1298240413300031234PalsaRPYRAAESGKDRAYKAGRRKVSGAGRESEGFVVAMKACNTTRRREGTLLGSVPVGR
Ga0302324_10152061013300031236PalsaERPYLAVESDKDRAYKAGRRKAHGAGRESEGFVVPEKACKITRWREGALL
Ga0302140_1001880513300031261BogHKAGRLKVNGAGRKSEGFVVPKKACNTTRRREGTLL
Ga0307506_1009542513300031366SoilYLAAESGKDRAYKAGWLKTSGAGRESERPVVPEKACKTTRWREGALL
Ga0170820_1083139313300031446Forest SoilQVRPSPAAKSGKDRAYKAGRLKVNGAGRETEGFVVPMKACNTTRRREGTLL
Ga0318534_1043401513300031544SoilEQERSYLAAGTGKDRGYKAGRLKAHGAGRKSEGFIVPAKACSKTRWREGALL
Ga0318574_1073433433300031680SoilYKVGRLKVRGAGRESERPDVPVKACKTTRWREGALL
Ga0310686_11280910413300031708SoilERPSPTASSGKDRAYKAGRLKVRGAGRESEGFVVPMKACNITRRREGTLL
Ga0310813_1235069513300031716SoilAESGKDRWYKAGRLKASGAGRESEGPIVPRKACKTTRRREGALL
Ga0307469_1195358713300031720Hardwood Forest SoilLAAKSGKDRAYKAGWLKTNGAGRKSEGFIVPRKACSKTRWREGALL
Ga0311351_1011654823300031722FenLAARSGKDRAYKAGRRKAHGARRESERPEVPRKARKITRWREGALL
Ga0318493_1014218913300031723SoilDRAYKAGRSKASGARRESEGSVVPVKACKTTRWREGALL
Ga0302321_10223166223300031726FenSKAEQERSYLAAESGKDRAYKAGRLKSHGAGRKSEGPIVPVKACSKTRWREGALL
Ga0318502_1084756023300031747SoilERSYLAAGTGKDRGYKAGRLKAHGAGRKSEGFIVPAKACSKTRWREGALL
Ga0315280_1032640023300031862SedimentLAAVSGKDRAYKAGRLKSRGAGRESERPEVPVKARKTTRWREGVLL
Ga0302322_10148776823300031902FenESGKDRAYKAGWLKANGAGRESERPVVPRKACKTTRWREGALL
Ga0310916_1134949613300031942SoilLERSSAEQERPYPAVSSGKDRAYKVGWLKTRGAGRESERSVVPRKACNITRRRDGA
Ga0307479_1037449123300031962Hardwood Forest SoilPYLAAKSGGDRWYKAGRQKSSGAGRESEGLVVPKKACKTTRWREGVLL
Ga0307479_1057932913300031962Hardwood Forest SoilLAGESGKDRAYKAGRLKARGAGRESEGFIVPKKACSKTRWREGALL
Ga0247536_10189613300032027SoilAAESGKDRAHKAGRLKVPAAGRESEGFVVPKKACNTTRWREGTLL
Ga0315284_1041410613300032053SedimentRRIAEQERPYLAAKSGKDRAYKAGRRKAGGAGRESEGFVVPMKACSKTRWREGTLL
Ga0315276_1103085523300032177SedimentAAKSGKDRAYKAGRLKASGAGRESEGFIVPVKACKITRWREGALL
Ga0348332_1172332123300032515Plant LitterGYKAGRLKSHGAGRESEGFIVPKKACKTTRWREGALL
Ga0335082_1026172223300032782SoilARSGKDRGYKAGRLKSRGARRESEGSVVPEKACKTTRWREGALL
Ga0335082_1049156123300032782SoilKAGRLKSGGAGRESEGFTVPEKACKITRWREGTLL
Ga0335079_1075490113300032783SoilKDRWYKAGRLKSGGAGRESEGFTVPEKACKITRWREGTLL
Ga0335078_1124803723300032805SoilPSPAASSGKDRAYKAGRLKVRGAGRESEGFAVPEKARNTTRRREGTLL
Ga0335080_1039057723300032828SoilYLAAWSGKDRGYKAGRLKSRGAGRESEGSVVPAKARKITRWREGALL
Ga0335080_1165429123300032828SoilGKDRAYKTGRLKAHGARRESEGFIVPEKACKITRWREGALL
Ga0335081_1165460223300032892SoilRTYKAGKSKANGAGRESEGFVVPEKARKTTRWREGALL
Ga0335081_1218925413300032892SoilNAEQERPYLAASSGKDRGYKAGWLKSRGARRESERFVVPRKARKTTRWREGALL
Ga0335069_1055518813300032893SoilDRAYKTGRLKARGAGRESEGFIVPGKACKITRWREGALL
Ga0335071_1079890523300032897SoilPGSLSGKDRGYKAGRLKSSGAGRESEGPVVPMKARKITRWREGALL
Ga0335084_1243066923300033004SoilPYLAAESGKDRAYKAGWLKSRGAGRESEGFVVPEKACSKTRWREGALL
Ga0318519_1070298513300033290SoilAEQERPYPAVSSGKDRAYKVGWLKTRGAGRESERSVVPRKACNITRRREGALL
Ga0326727_1065154813300033405Peat SoilAAQSGKDRAYKAGWPKSRGAGRESEGSVVPVKARKITRWREGSLL
Ga0316601_10064351633300033419SoilKDGAYKAGWLKAHGARRESEGFVVPMKACNKTRWREGALL
Ga0310811_1036854413300033475SoilAWSGKDRAYKAGWLKAGGAGRESERSVVPRKACKTTRRREGTLL
Ga0316617_10151906913300033557SoilEQERPYLAAQSGEDRGYKAGRLKSRGAGRESEGSVVPMKACSKTRWREGALL
Ga0334837_119027_1_1293300033823SoilSGEDRAYKAGWLKSRGAGRESEGLIVPTKACMTTRWREGVLL
Ga0371487_0029255_1816_19773300033982Peat SoilMEQERPYLVASSGEDRGYKAGRLKSRGAGRESEGLVVPTKARKTTRWREGVLL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.