| Basic Information | |
|---|---|
| Family ID | F023927 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 208 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNHYPWLM |
| Number of Associated Samples | 187 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.40 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 90.38 % |
| Associated GOLD sequencing projects | 180 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.827 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF13181 | TPR_8 | 37.50 |
| PF13432 | TPR_16 | 5.77 |
| PF13374 | TPR_10 | 4.33 |
| PF00515 | TPR_1 | 3.85 |
| PF07719 | TPR_2 | 3.37 |
| PF13174 | TPR_6 | 2.88 |
| PF14559 | TPR_19 | 1.92 |
| PF16499 | Melibiase_2 | 0.96 |
| PF13414 | TPR_11 | 0.96 |
| PF02687 | FtsX | 0.48 |
| PF00989 | PAS | 0.48 |
| PF00296 | Bac_luciferase | 0.48 |
| PF13428 | TPR_14 | 0.48 |
| PF00990 | GGDEF | 0.48 |
| PF01351 | RNase_HII | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.48 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.48 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1055007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300001593|JGI12635J15846_10461027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 756 | Open in IMG/M |
| 3300001661|JGI12053J15887_10257465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 865 | Open in IMG/M |
| 3300001867|JGI12627J18819_10279833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300002560|JGI25383J37093_10069594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1096 | Open in IMG/M |
| 3300002908|JGI25382J43887_10183116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1026 | Open in IMG/M |
| 3300004139|Ga0058897_11110049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300004635|Ga0062388_102934051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005163|Ga0066823_10075047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300005175|Ga0066673_10005841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4966 | Open in IMG/M |
| 3300005176|Ga0066679_10025243 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
| 3300005176|Ga0066679_10167406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
| 3300005176|Ga0066679_10259284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300005332|Ga0066388_100349573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2125 | Open in IMG/M |
| 3300005436|Ga0070713_100865076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300005440|Ga0070705_100405798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1010 | Open in IMG/M |
| 3300005451|Ga0066681_10070679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1948 | Open in IMG/M |
| 3300005536|Ga0070697_101097883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 708 | Open in IMG/M |
| 3300005546|Ga0070696_101936313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300005553|Ga0066695_10283063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300005557|Ga0066704_10987103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 520 | Open in IMG/M |
| 3300005560|Ga0066670_10028939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2683 | Open in IMG/M |
| 3300005566|Ga0066693_10257395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 692 | Open in IMG/M |
| 3300005586|Ga0066691_10441380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300005598|Ga0066706_10860173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300005618|Ga0068864_101448622 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005764|Ga0066903_104575242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 737 | Open in IMG/M |
| 3300005995|Ga0066790_10060886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1628 | Open in IMG/M |
| 3300006162|Ga0075030_101509518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300006174|Ga0075014_100915699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300006642|Ga0075521_10381229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 685 | Open in IMG/M |
| 3300006806|Ga0079220_12000342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 517 | Open in IMG/M |
| 3300006871|Ga0075434_100139985 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300006903|Ga0075426_11240777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 565 | Open in IMG/M |
| 3300009012|Ga0066710_101555134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300009038|Ga0099829_10679965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300009137|Ga0066709_102253310 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300009522|Ga0116218_1405581 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009644|Ga0116121_1042557 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300009645|Ga0116106_1115084 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300009650|Ga0105857_1183912 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009660|Ga0105854_1113047 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300009683|Ga0116224_10298080 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300009700|Ga0116217_10117298 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300010046|Ga0126384_11275282 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300010358|Ga0126370_10616801 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300010358|Ga0126370_11676925 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300010359|Ga0126376_11402448 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010366|Ga0126379_10151085 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300011120|Ga0150983_10290559 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300011120|Ga0150983_12238113 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300011120|Ga0150983_13912463 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300011270|Ga0137391_10231403 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300011270|Ga0137391_10234503 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300011270|Ga0137391_10508634 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300011270|Ga0137391_10929777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300012056|Ga0153925_1028630 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012203|Ga0137399_10402186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300012203|Ga0137399_10544746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300012205|Ga0137362_10118388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2245 | Open in IMG/M |
| 3300012206|Ga0137380_10139197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2214 | Open in IMG/M |
| 3300012208|Ga0137376_11409563 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012209|Ga0137379_10040272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4510 | Open in IMG/M |
| 3300012350|Ga0137372_11002945 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012355|Ga0137369_10985417 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012363|Ga0137390_11615926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300012405|Ga0134041_1070880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300012685|Ga0137397_10013411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5742 | Open in IMG/M |
| 3300012918|Ga0137396_10363156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300012924|Ga0137413_10172793 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300012925|Ga0137419_10168175 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300012925|Ga0137419_11375289 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012925|Ga0137419_11443962 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012927|Ga0137416_10920611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300012964|Ga0153916_10615940 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300014150|Ga0134081_10352526 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300014157|Ga0134078_10660539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300015054|Ga0137420_1441688 | All Organisms → cellular organisms → Bacteria | 6761 | Open in IMG/M |
| 3300015082|Ga0167662_1031478 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300015358|Ga0134089_10020919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2236 | Open in IMG/M |
| 3300016319|Ga0182033_11546898 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300016341|Ga0182035_11233359 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300016357|Ga0182032_10147967 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300016371|Ga0182034_11000901 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300016387|Ga0182040_11077532 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300016404|Ga0182037_10317363 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300016422|Ga0182039_10038730 | All Organisms → cellular organisms → Bacteria | 3142 | Open in IMG/M |
| 3300017823|Ga0187818_10471907 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300017934|Ga0187803_10400968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300017942|Ga0187808_10407203 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300017944|Ga0187786_10140177 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300017947|Ga0187785_10216682 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300017972|Ga0187781_10039249 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
| 3300017975|Ga0187782_11043745 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300018007|Ga0187805_10599287 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018089|Ga0187774_11416321 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018090|Ga0187770_10224460 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300018090|Ga0187770_10601924 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300018468|Ga0066662_11572313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300019284|Ga0187797_1438234 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300019788|Ga0182028_1312363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1396 | Open in IMG/M |
| 3300020150|Ga0187768_1010862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1879 | Open in IMG/M |
| 3300020170|Ga0179594_10428193 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300020199|Ga0179592_10447838 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300020199|Ga0179592_10455378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300020579|Ga0210407_10734116 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300020580|Ga0210403_10401909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
| 3300020581|Ga0210399_11489261 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300021088|Ga0210404_10540123 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021168|Ga0210406_10574100 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300021170|Ga0210400_10617573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300021171|Ga0210405_10016296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6117 | Open in IMG/M |
| 3300021178|Ga0210408_10202233 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300021180|Ga0210396_10595666 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300021181|Ga0210388_10157668 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300021420|Ga0210394_10502624 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300021420|Ga0210394_10629339 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300021559|Ga0210409_10463703 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300022532|Ga0242655_10227064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300025474|Ga0208479_1066685 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300025544|Ga0208078_1046299 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300025625|Ga0208219_1053345 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300025898|Ga0207692_10604981 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300025906|Ga0207699_11380720 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300025915|Ga0207693_10468060 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300025939|Ga0207665_10968224 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300026305|Ga0209688_1013164 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300026310|Ga0209239_1085493 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300026310|Ga0209239_1131248 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300026316|Ga0209155_1004540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6243 | Open in IMG/M |
| 3300026319|Ga0209647_1239475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300026328|Ga0209802_1128591 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300026330|Ga0209473_1006977 | All Organisms → cellular organisms → Bacteria | 5821 | Open in IMG/M |
| 3300026481|Ga0257155_1066893 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300026482|Ga0257172_1107373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300026515|Ga0257158_1104454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300026839|Ga0207764_115066 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300026869|Ga0207821_1004152 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300026959|Ga0207852_1036269 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027039|Ga0207855_1058231 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027049|Ga0207806_1043920 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300027063|Ga0207762_1036007 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300027064|Ga0208724_1020682 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300027074|Ga0208092_101684 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300027109|Ga0208603_1011321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1463 | Open in IMG/M |
| 3300027376|Ga0209004_1039069 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300027502|Ga0209622_1107723 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027587|Ga0209220_1027862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1515 | Open in IMG/M |
| 3300027651|Ga0209217_1065023 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300027655|Ga0209388_1226428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027663|Ga0208990_1091484 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300027669|Ga0208981_1122797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300027671|Ga0209588_1124129 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300027671|Ga0209588_1262432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300027727|Ga0209328_10186861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300027738|Ga0208989_10167168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300027787|Ga0209074_10228319 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300027795|Ga0209139_10025281 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300027857|Ga0209166_10610517 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300027862|Ga0209701_10015676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4967 | Open in IMG/M |
| 3300027867|Ga0209167_10615512 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027882|Ga0209590_10838657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300027908|Ga0209006_10756185 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300027910|Ga0209583_10437369 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027910|Ga0209583_10778208 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300027915|Ga0209069_10313240 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300028800|Ga0265338_10834145 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300028906|Ga0308309_10233866 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300029636|Ga0222749_10374131 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300029636|Ga0222749_10598793 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300030399|Ga0311353_10243827 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300031122|Ga0170822_12734786 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031122|Ga0170822_12994467 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031231|Ga0170824_115202793 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031236|Ga0302324_100970154 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300031446|Ga0170820_12883347 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300031474|Ga0170818_108684413 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031545|Ga0318541_10309334 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300031572|Ga0318515_10357048 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031573|Ga0310915_10499581 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300031719|Ga0306917_11184905 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031720|Ga0307469_10149141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1747 | Open in IMG/M |
| 3300031736|Ga0318501_10314805 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031744|Ga0306918_10138047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1787 | Open in IMG/M |
| 3300031753|Ga0307477_10520532 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031764|Ga0318535_10336008 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031769|Ga0318526_10405396 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031771|Ga0318546_10255188 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300031819|Ga0318568_10594000 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031823|Ga0307478_10162946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1776 | Open in IMG/M |
| 3300031823|Ga0307478_10570021 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031833|Ga0310917_10791126 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031846|Ga0318512_10548716 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031942|Ga0310916_10434322 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300031945|Ga0310913_10141782 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300031946|Ga0310910_11408031 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031954|Ga0306926_10094857 | All Organisms → cellular organisms → Bacteria | 3651 | Open in IMG/M |
| 3300031959|Ga0318530_10470835 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032035|Ga0310911_10333729 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300032035|Ga0310911_10418808 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300032174|Ga0307470_10131732 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300032515|Ga0348332_14742152 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300032782|Ga0335082_10187869 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300032897|Ga0335071_12069320 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300033158|Ga0335077_11105257 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300033402|Ga0326728_10652879 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300033755|Ga0371489_0445545 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300033805|Ga0314864_0152400 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.44% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.48% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.48% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.48% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012056 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ009 MetaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10550072 | 3300000655 | Forest Soil | MNRIYRALLVVVAFEMGVLLLYLPWSIYWEQNFFLNHYP |
| JGI12635J15846_104610271 | 3300001593 | Forest Soil | MNRFYRALLVVLAFEMGAMLLYLPWSGYWEQNYFLSHYPS |
| JGI12053J15887_102574651 | 3300001661 | Forest Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHY |
| JGI12627J18819_102798331 | 3300001867 | Forest Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLNHY |
| JGI25383J37093_100695941 | 3300002560 | Grasslands Soil | MHRVYRALLIVLAFEMGAMLLYLPWSVYWEKNFFLSYYPSLMPIVLHPSFRG |
| JGI25382J43887_101831162 | 3300002908 | Grasslands Soil | MNRIYRALLVVVAFEMGALLLYLPWSVYWEQNYFLSHYPSLIHVVLHPSFR |
| Ga0058897_111100492 | 3300004139 | Forest Soil | MNRVYRALQVVLAFEMGAMLLYLPWTLYWEQNFFLSHYPSLMPIVLHPSFRGA |
| Ga0062388_1029340512 | 3300004635 | Bog Forest Soil | MNRILRALTVVLLFEMGALLLYLPWSSIWEQNYFLSHFPGLVRFVLNPSLRGIVSG |
| Ga0066823_100750471 | 3300005163 | Soil | MNKTLRIILIVLCLEMGAFLLYLPWSNFWEQNYFLVHLPEALRLFLLHSSFRGIV |
| Ga0066673_100058414 | 3300005175 | Soil | MNRIYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLMPV |
| Ga0066679_100252432 | 3300005176 | Soil | MNRVYQALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSL |
| Ga0066679_101674061 | 3300005176 | Soil | MNRLYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLRHYPSLMRIVLHPSFRG |
| Ga0066679_102592841 | 3300005176 | Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNYFLSHYPSLMRFVLHPSFRGVVSGV |
| Ga0066388_1003495731 | 3300005332 | Tropical Forest Soil | MNRILRALTVVLLFELGALLLYLPWSVFWEQNYFLKHYPW |
| Ga0070713_1008650761 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFRHLPGLVPI |
| Ga0070705_1004057981 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRVYRALLVVLAFEMGALLLYLPWSVYWEQNYFLSHYPVLMRIA |
| Ga0066681_100706791 | 3300005451 | Soil | MNRFYRALLVVLAFEMGAMLLYLPWSVYWEQNFFLSHYPSLMRIVLHPSF |
| Ga0070697_1010978832 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRVYRALLVVLAFEMGALLLYLPWSAYWEQNYFLSHYPVLMRIALHP |
| Ga0070696_1019363131 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKVLRAVVIVLCFELGALLLYLPWSNLWEQNYFLAHFPSLMM |
| Ga0066695_102830631 | 3300005553 | Soil | MNKALRAMLIVLCFEMGALLLYLPWSNFWEQNYFLIHFPTLVP |
| Ga0066704_109871032 | 3300005557 | Soil | MNRVYRALLIVLAFEMGAMLLYLPWSGYWEQNFFL |
| Ga0066670_100289392 | 3300005560 | Soil | MNRFYRALLVVLAFEMGAMLLYLPWSVYWEQNFFLSHYPSLMRIVLHPSFRG |
| Ga0066693_102573951 | 3300005566 | Soil | MNRFYRALLVVLAFEMGAMLLYLPWSVYWEQNFFLSH |
| Ga0066691_104413802 | 3300005586 | Soil | MSRIYRALLVVLAFEMGALLLYLPWSGYWEQNYFLSHFPSLMPIVLHPSFRGVVS |
| Ga0066706_108601732 | 3300005598 | Soil | MNKTLRVILIVLCLEMGAFLLYLPWSDYWERNYFLAHL |
| Ga0068864_1014486222 | 3300005618 | Switchgrass Rhizosphere | MNKVLRAVIIVLCFELGALLLYLPWSNLWEQNYFLAHFPSLML |
| Ga0066903_1045752421 | 3300005764 | Tropical Forest Soil | MNKVLRAIIIVLCFELGALLFYLPWSEFWEQNYFLFHF |
| Ga0066790_100608861 | 3300005995 | Soil | MNRVFRALSIILCFEMGALLLYLPWTGFWEQNYFLSHFPSLLPVLLH |
| Ga0075030_1015095182 | 3300006162 | Watersheds | MHSSMNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLHRFPW |
| Ga0075014_1009156991 | 3300006174 | Watersheds | MNRILRAMTVVLLFELGALLLYLPWSAFWEQNYFLSHHPWMMPLVLHPAT |
| Ga0075521_103812292 | 3300006642 | Arctic Peat Soil | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFRQIPGLMPFLLHPS |
| Ga0079220_120003422 | 3300006806 | Agricultural Soil | MNRIYRALLVVLAFEMGALLLYLPWSVYWEQNFFLSQYPLLRSILLHP |
| Ga0075434_1001399852 | 3300006871 | Populus Rhizosphere | MNKVLRAVIIVLCFELGALLLYLPWSNLWEQNYFLAHFP |
| Ga0075426_112407771 | 3300006903 | Populus Rhizosphere | MNKVLRAVIIVLCFELGALLLYLPWSNLWEQNYFLAHF |
| Ga0066710_1015551342 | 3300009012 | Grasslands Soil | MHRVYRALLIVLAFEMGAMLLYLPWSVYWEKNFFLSYYPSLM |
| Ga0099829_106799651 | 3300009038 | Vadose Zone Soil | MSRIYRALLVVLAFEMGALLLYLPWSGYWEQNYFLSHFPS |
| Ga0066709_1022533102 | 3300009137 | Grasslands Soil | MNKALRVILIVLCLEMGAFLLYLPWTDYWEHNYFLAHLPQTLR |
| Ga0116218_14055812 | 3300009522 | Peatlands Soil | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLSHFPRLMPFVLN |
| Ga0116121_10425572 | 3300009644 | Peatland | MNRILRAMTVVLLFEMGALLLYLPWSSFWEQNFFLHRFPWLMPILLHPSM |
| Ga0116106_11150842 | 3300009645 | Peatland | MHSSMNRLLRAMTAVLLFEMGALLLYLPWSAFWEQNYFLHRFPWLIPIVLH |
| Ga0105857_11839121 | 3300009650 | Permafrost Soil | MNRVFRALSIILCFEMGALLLYLPWTGFWEQNYFLSHFPSLL |
| Ga0105854_11130471 | 3300009660 | Permafrost Soil | MNRVFRALSIILCFEMGALLLYLPWTGFWEQNYFLSHFPSLLPVLLHP |
| Ga0116224_102980801 | 3300009683 | Peatlands Soil | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLSHFPRLMPFVLNPSLRGI |
| Ga0116217_101172981 | 3300009700 | Peatlands Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLHRFPWLIPYVLHPS |
| Ga0126384_112752821 | 3300010046 | Tropical Forest Soil | MNKALRVILIVLCLEMGAFLLYLPWSSFWEQNYFLHHLPSSLRVFLLHSSFRGIVSGL |
| Ga0126370_106168012 | 3300010358 | Tropical Forest Soil | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFRHFPGLVPIVLH |
| Ga0126370_116769252 | 3300010358 | Tropical Forest Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNHFPWLVRILL |
| Ga0126376_114024481 | 3300010359 | Tropical Forest Soil | MNRVLRAILIVLCFELGALLLYLPWSNFWEQNYFLFHFPALMSILLHPTVRG |
| Ga0126379_101510851 | 3300010366 | Tropical Forest Soil | MNRIYRALLVVLAFEMGALLLYLPWSIYWEQNYFLTHYPSLMHIVLHPFF |
| Ga0150983_102905591 | 3300011120 | Forest Soil | MSRIYRALLVVLAFEMGAMLLYLPWSLYWEQNYFL |
| Ga0150983_122381132 | 3300011120 | Forest Soil | MSRIYRALLVVLAFEMGALLLYLPWSIYWEQNYFLSHFPSLMHIVL |
| Ga0150983_139124631 | 3300011120 | Forest Soil | MNRVFRALLVVVCFEMGALLLYLPWSAFWEHNFFLIHFPALIHVV |
| Ga0137391_102314032 | 3300011270 | Vadose Zone Soil | MNRIYRALLVVLAFEMGALLLYLPWTGYWEQNYFLS |
| Ga0137391_102345031 | 3300011270 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYP |
| Ga0137391_105086342 | 3300011270 | Vadose Zone Soil | MNRIYRALLVVVAFEMGALLLYLPWSVYWEQNYFLSHYPSL |
| Ga0137391_109297771 | 3300011270 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSVYWEQNFFLSHFPSLMP |
| Ga0153925_10286302 | 3300012056 | Attine Ant Fungus Gardens | MTRIFRAMTVVLLFEMGALLLYLPWSAFWEQNYFLNHYTWLMPV |
| Ga0137399_104021861 | 3300012203 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNYFLSHYPALMRF |
| Ga0137399_105447462 | 3300012203 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNYFLSHYP |
| Ga0137362_101183881 | 3300012205 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLMPV |
| Ga0137380_101391971 | 3300012206 | Vadose Zone Soil | MHRVYRALLIVLAFEMGAMLLYLPWSVYWEKNFFLSYYPSLMPIVLHPSFR |
| Ga0137376_114095632 | 3300012208 | Vadose Zone Soil | MNKALRAMLIVLCFEMGALLLYLPWSNFWEQNYFLIHF |
| Ga0137379_100402724 | 3300012209 | Vadose Zone Soil | MNRIYHALLVVLAFEMGVLLLYLPWSIYWEQNFFLNHYPLLRSILIH |
| Ga0137372_110029451 | 3300012350 | Vadose Zone Soil | MNKALRAMLIVLCFEMGALLLYLPWSNFWVQNYFLFHFTTLVTFALHAS |
| Ga0137369_109854171 | 3300012355 | Vadose Zone Soil | MNRVYQALLVVLAFEMGAMLLYLPWSGYWEQNCFLSHYPSLM |
| Ga0137390_116159261 | 3300012363 | Vadose Zone Soil | MNRIYRALLVVLAFEMGALLLYLPWSGYWEQNFFLSHYPSLM |
| Ga0134041_10708802 | 3300012405 | Grasslands Soil | MNRFYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLM |
| Ga0137397_100134111 | 3300012685 | Vadose Zone Soil | MSRIYRALLVVLAFEMGALLLYLPWSGYWEQNYFLSHFPSLMPIVLHPSFRGV |
| Ga0137396_103631561 | 3300012918 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLS |
| Ga0137413_101727931 | 3300012924 | Vadose Zone Soil | MNKVLRAMIIVLCFEMGALLLYLPWSNFWERNYFLIHFPSFM |
| Ga0137419_101681751 | 3300012925 | Vadose Zone Soil | MSRIYRALLVVLAFEMGALLLYLPWSGYWEQNYFLS |
| Ga0137419_113752891 | 3300012925 | Vadose Zone Soil | MNKALRVILIVLCLEMGALLLYLPWSSFWEQNYFLYHLPNSMRIFLLHSSFRGIVSGL |
| Ga0137419_114439621 | 3300012925 | Vadose Zone Soil | MNKTLRVILIVLCLEMGAFLLYLPWSDYWERNYFLAH |
| Ga0137416_109206112 | 3300012927 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWAQNFFLS |
| Ga0153916_106159401 | 3300012964 | Freshwater Wetlands | MREREAVNHPTMNRILQAMFVLLYFEIGAILIYLPWSALWEQNYFLS |
| Ga0134081_103525261 | 3300014150 | Grasslands Soil | MNRIYRALLVVLAFEMGALLLYLPWSIYWENNYFLGHYPWLMHVVLHPF |
| Ga0134078_106605391 | 3300014157 | Grasslands Soil | MNRIYRALLVVLAFEMGALLLYLPWSVYWEQNFFLSHYPLLRSVL |
| Ga0137420_144168812 | 3300015054 | Vadose Zone Soil | RSSMNRVYRDCLSFLAFEMGAMLLYLPWSGYWEQKFFSQPYPSLMPIGFIRRFAGR* |
| Ga0167662_10314781 | 3300015082 | Glacier Forefield Soil | MNKALRAMLIVLCFEMGALLLYLPWSNFWEHNYFLAHFPLLMP |
| Ga0134089_100209191 | 3300015358 | Grasslands Soil | MHRVYRALLIVLAFEMGAMLLYLPWSVYWEKNFFLS |
| Ga0182033_115468981 | 3300016319 | Soil | MNKVVRAIIIVLCFELGALLFYLPWSEFWEQNYFLFHFPSLMPIALHPSVRGL |
| Ga0182035_112333591 | 3300016341 | Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNQFPWLVRI |
| Ga0182032_101479671 | 3300016357 | Soil | MNRIYRALLVVVAFEMGVLLLYLPWSIYWEQNFFLHH |
| Ga0182034_110009012 | 3300016371 | Soil | MNKVVRAIIIVLCFELGVLLFYLPWSEFWEQNYFLLHFPSLMPISLH |
| Ga0182040_110775321 | 3300016387 | Soil | MNKVLRAIIIVLCFELGALLFYLPWSGFWEQNYFLFHFPSLMP |
| Ga0182037_103173632 | 3300016404 | Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLN |
| Ga0182039_100387301 | 3300016422 | Soil | MIRILRALTVVLLFEMGALLLYLPWSSFWENNYFLFHYPW |
| Ga0187818_104719071 | 3300017823 | Freshwater Sediment | MNRILRAMSAVLLFEMGALLLYLPWTALWEQNYFLHLYPWLIRIVLHPSMRGIV |
| Ga0187803_104009681 | 3300017934 | Freshwater Sediment | MNRIFRALLVVLAFEMGALLLYLPWSGYWEQNYFL |
| Ga0187808_104072031 | 3300017942 | Freshwater Sediment | MTRIMRALTVVLLFEMGALLLYLPWSAFWEQNYFLNHYPWLMRF |
| Ga0187786_101401772 | 3300017944 | Tropical Peatland | MNRIFRALTVVLLFEMGALLLYLPWSTFWEQNYFLRHYSWLTPLLLHP |
| Ga0187785_102166821 | 3300017947 | Tropical Peatland | MNRIFRALTVVLLFEMGALLLYLPWSTFWEQNYFLRHY |
| Ga0187781_100392491 | 3300017972 | Tropical Peatland | MNRIFRALLVVLAFEMGALLLYLPWSGYWEQNYFLSH |
| Ga0187782_110437452 | 3300017975 | Tropical Peatland | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNHYPWLM |
| Ga0187805_105992871 | 3300018007 | Freshwater Sediment | MNRIFRALTVVLLFEMGALLLYLPWSSFWEQNYFLSHFPWLMPV |
| Ga0187774_114163211 | 3300018089 | Tropical Peatland | MSRILRALTVVLLFEMGALLLYLPWSSFWEQNYFLNHFPSLMP |
| Ga0187770_102244601 | 3300018090 | Tropical Peatland | MNRVLRALTVVLLFEMGALLLYLPWSTFWEENYFLSHFPWLMHIV |
| Ga0187770_106019242 | 3300018090 | Tropical Peatland | MNRILRAMSAVLLFEMGALLLYLPWSALWEQNYFLHRFPWL |
| Ga0066662_115723131 | 3300018468 | Grasslands Soil | MNRVYRALLIVLAFEMGAMLLYLPWSVYWEKNFFLSYYP |
| Ga0187797_14382341 | 3300019284 | Peatland | MLRLLRALTVVLLFEMGALLLYLPWSSFWEQNYFLTHYL |
| Ga0182028_13123631 | 3300019788 | Fen | MHSSMNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLHHFPG |
| Ga0187768_10108622 | 3300020150 | Tropical Peatland | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLSHFPWLMPVV |
| Ga0179594_104281932 | 3300020170 | Vadose Zone Soil | MSRIYRALLVVLAFEMGALLLYLPWSGYWEQNYFLSHFPSL |
| Ga0179592_104478382 | 3300020199 | Vadose Zone Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLGHYLWMRHFALHPATRGIVSG |
| Ga0179592_104553781 | 3300020199 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLMPIVLH |
| Ga0210407_107341161 | 3300020579 | Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLSHFPWMMHFALHPATR |
| Ga0210403_104019091 | 3300020580 | Soil | MSRVYKALQVVLAFEMGAILLYLPWSAYWETNYFLI |
| Ga0210399_114892611 | 3300020581 | Soil | MNRLLRALAVVLLFEMGALLLYLPWSAFWEQNYFFCHFPGLVPI |
| Ga0210404_105401231 | 3300021088 | Soil | MSRIYRALLVVLAFEMGALLLYLPWSIYWEQNYFLSHFPSLMHIVLHPS |
| Ga0210406_105741001 | 3300021168 | Soil | MNRVLRAMMVVLLFEMGALLLYLPWSMLWEQNYFLHHVPTLAPIVLHP |
| Ga0210400_106175732 | 3300021170 | Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLMPIVLTRHFAAR |
| Ga0210405_100162961 | 3300021171 | Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLSH |
| Ga0210408_102022332 | 3300021178 | Soil | MNRLLRALAVVLLFEMGALLLYLPWSAFWEQNYFFRHFPGLVPIVLHPS |
| Ga0210396_105956661 | 3300021180 | Soil | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFYHFPGL |
| Ga0210388_101576682 | 3300021181 | Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLSHYPWMMHFAL |
| Ga0210394_105026241 | 3300021420 | Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLSHYPWMM |
| Ga0210394_106293391 | 3300021420 | Soil | MNRILRAMTVVLLFELGALLLYLPWSAFWEQNYFLNHYPWMMHLALHPATRGIV |
| Ga0210409_104637031 | 3300021559 | Soil | MSRLLRALTVVLLFEMGALLLYLPWSSMWDKNYLL |
| Ga0242655_102270642 | 3300022532 | Soil | MNRIYRALLVVLAFEMGALLLYLPWSIYWEQNYFLSHFPSLMHIVLHPSFRG |
| Ga0208479_10666852 | 3300025474 | Arctic Peat Soil | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFRQIPGLMP |
| Ga0208078_10462991 | 3300025544 | Arctic Peat Soil | MNRVFRALSIILCFEMGALLLYLPWTGFWEQNYFLSHFPSLLPVLLHPSFRG |
| Ga0208219_10533451 | 3300025625 | Arctic Peat Soil | MNRVLRALSIILCFEMGALLLYLPWTNFWEQNYFL |
| Ga0207692_106049811 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKALRAMLIVLCFEMGALLLYLPWSNFWEQNYFLAHFPSLMSFLLHP |
| Ga0207699_113807201 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKALRVILIVLCLEMGAFLLYLPWSDYWERNYFLAHL |
| Ga0207693_104680601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKALRAMLIVLCFEMGALLLYLPWSNFWEQNYFLIHFPTLVRFALHP |
| Ga0207665_109682241 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKVLRAMIIVLCFEMGALLLYLPWSNFWERNYFLIHFPSFMSFAL |
| Ga0209688_10131642 | 3300026305 | Soil | MNRIYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLMPVVLHPSFRG |
| Ga0209239_10854932 | 3300026310 | Grasslands Soil | MNRIYHALLVVLAFEMGVLLLYLPWSIYWEQNFFLNHYPLLRSILL |
| Ga0209239_11312481 | 3300026310 | Grasslands Soil | MNRVYQALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLMPVVLHPS |
| Ga0209155_10045404 | 3300026316 | Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLMPVVLHPSF |
| Ga0209647_12394751 | 3300026319 | Grasslands Soil | MNRVYRALQVVLAFEMGAMLLYLPWTLYWEQNFFLSHYPLLMPIV |
| Ga0209802_11285911 | 3300026328 | Soil | MNKALRAMLIVLCFEMGALLLYLPWSNFWEQNYFLIHFPTLVPFALHPS |
| Ga0209473_10069771 | 3300026330 | Soil | MNRIYRALLVVLAFEMGALLLYLPWSIYWENNYFLGHYPWLMHVVLH |
| Ga0257155_10668931 | 3300026481 | Soil | MNKVLRAMIIVLCFEMGALLLYLPWSNFWERNYFLVHFP |
| Ga0257172_11073731 | 3300026482 | Soil | MNRIYRALLVVLAFEMGALLLYLPWSGYWEQNFFLSHYPSLMPIVLHP |
| Ga0257158_11044542 | 3300026515 | Soil | MNRIYRALLVVLAFEMGALLLYLPWSGYWEQNFFLSHYPSLMPI |
| Ga0207764_1150662 | 3300026839 | Tropical Forest Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNQFPWLVRILL |
| Ga0207821_10041522 | 3300026869 | Tropical Forest Soil | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLNHYVWLRAVILHPSI |
| Ga0207852_10362692 | 3300026959 | Tropical Forest Soil | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFRHLPALMPVLLHPSI |
| Ga0207855_10582312 | 3300027039 | Tropical Forest Soil | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLSHCIWLRPMVLHPSIRGIVSG |
| Ga0207806_10439202 | 3300027049 | Tropical Forest Soil | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLNHY |
| Ga0207762_10360071 | 3300027063 | Tropical Forest Soil | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFRHLPALMPV |
| Ga0208724_10206821 | 3300027064 | Forest Soil | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFGHFPGLVPIVLH |
| Ga0208092_1016841 | 3300027074 | Forest Soil | MSRIYRALLVVLAFEMGALLLYLPWSIYWEQNYFLS |
| Ga0208603_10113212 | 3300027109 | Forest Soil | MSRIYRALLVVLAFEMGALLLYLPWSIYWEQNYFL |
| Ga0209004_10390691 | 3300027376 | Forest Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLNHYPWMMHIALHPA |
| Ga0209622_11077232 | 3300027502 | Forest Soil | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLGHFPRLMPFILHP |
| Ga0209220_10278621 | 3300027587 | Forest Soil | MSRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLIPVVLHPSFRGVV |
| Ga0209217_10650231 | 3300027651 | Forest Soil | MSRLLRALTVVLLFEMGALLLYLPWSSMWDKNYLLSQVVWL |
| Ga0209388_12264282 | 3300027655 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSH |
| Ga0208990_10914841 | 3300027663 | Forest Soil | MNRILRAMTVVLLFELGALLLYLPWSAFWEQNYFLSHYPWM |
| Ga0208981_11227972 | 3300027669 | Forest Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFL |
| Ga0209588_11241292 | 3300027671 | Vadose Zone Soil | MNRILRAMTVVLLFELGALLLYLPWSAFWEQNYFLSHYPWIMHFALHPAT |
| Ga0209588_12624321 | 3300027671 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNYFLSHYPSLMR |
| Ga0209328_101868611 | 3300027727 | Forest Soil | MNRVFRALLIILCFEMGALLLYLPWTGFWEQNYFLSHFP |
| Ga0208989_101671681 | 3300027738 | Forest Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNYFL |
| Ga0209074_102283192 | 3300027787 | Agricultural Soil | MNRIYRALLVVLAFEMGALLLYLPWSVYWEQNFFLS |
| Ga0209139_100252812 | 3300027795 | Bog Forest Soil | MNRVFRALLVVLCFEMGALLLYLPWSIFWDQNYFLSHFPTLIPVLLHPSF |
| Ga0209166_106105172 | 3300027857 | Surface Soil | MNKTLRVILIVLCLEMGAFLLYLPWSNFWEQNYFLHH |
| Ga0209701_100156764 | 3300027862 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLSHYPSLMPIVLHPSFRG |
| Ga0209167_106155122 | 3300027867 | Surface Soil | MNRIFRALTVVLLFELGALLLYLPWSAFWEQNYFLNHYPWMM |
| Ga0209590_108386572 | 3300027882 | Vadose Zone Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLAHYPSLI |
| Ga0209006_107561852 | 3300027908 | Forest Soil | MNRVFRALLVVLCFEMGALLLYLPWSAYWDQNYFLNHFPVL |
| Ga0209583_104373691 | 3300027910 | Watersheds | MNKILRALSVVLAFEMGALLLYMPWSIYWEQNYFLSHFPSLMHIV |
| Ga0209583_107782081 | 3300027910 | Watersheds | MSRLLRALTVVLLFEMGALLLYLPWSSMWDKNYLLSHAVWLKPLILHPSVRGMVSGLALL |
| Ga0209069_103132401 | 3300027915 | Watersheds | MSRLLRALTVVLLFEMGALLLYLPWSSMWDKNYLLSHAVWLK |
| Ga0265338_108341452 | 3300028800 | Rhizosphere | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFHQIPGLMPILLHPS |
| Ga0308309_102338661 | 3300028906 | Soil | MNRLLRALTVVLLFEMGALLLYLPWSSMWDKNYLLI |
| Ga0222749_103741311 | 3300029636 | Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLNHYPWMMHIA |
| Ga0222749_105987932 | 3300029636 | Soil | MLVVLCFEMGALLLYLPWTAFWEQNYFLSHFPALMRITLH |
| Ga0311353_102438271 | 3300030399 | Palsa | MNRVFRALLVVLCFEMGALLLYLPWSVYWDQNYFLHHIPVL |
| Ga0170822_127347862 | 3300031122 | Forest Soil | MNRILRAMTVVLLFELGALLLYLPWSAFWEQNYFLNHYPWMMHFA |
| Ga0170822_129944672 | 3300031122 | Forest Soil | MNKVLRAMIIVLCFEMGALLLYLPWSSFWERNYFLIHFP |
| Ga0170824_1152027931 | 3300031231 | Forest Soil | MNKVLRAIVIVLCFEMGALLLYLPWSNFWERNYFLIHFPWFMSF |
| Ga0302324_1009701541 | 3300031236 | Palsa | MNRVFRALLVVLCFEMGALLLYLPWSVYWDQNYFLHHIPVLVPVLLHPS |
| Ga0170820_128833471 | 3300031446 | Forest Soil | MNKVLRAMIIVLCFEMGALLLYLPWSSFWERNYFL |
| Ga0170818_1086844131 | 3300031474 | Forest Soil | MNKVLRAIVIVLCFEMGALLLYLPWTNFWEQNYFLAHFPAL |
| Ga0318541_103093341 | 3300031545 | Soil | MNKVVRAIIIVLCFELGALLFYLPWSEFWEQNYFLFHFPSLMPIA |
| Ga0318515_103570481 | 3300031572 | Soil | MNKVVRAIIIVLCFELGALLFYLPWSEFWEQNYFLFHFPSLLPIALHP |
| Ga0310915_104995811 | 3300031573 | Soil | MTVVLLFELGALLLYLPWSAFWEQNYFLSHVPWLIPIVLH |
| Ga0306917_111849052 | 3300031719 | Soil | LLINKVVRAIIIVLCFELGALLFYLPWSEFWEQNYF |
| Ga0307469_101491411 | 3300031720 | Hardwood Forest Soil | MNRVYRALLVVLAFEMGAMLLYLPWSGYWEQNFFLGHFPLLIRIVLHPC |
| Ga0318501_103148051 | 3300031736 | Soil | MNKVVRAIIIVLCFELGALLFYLPWSEFWEQNYFLFHFPSLMPIALHPSVRGLV |
| Ga0306918_101380472 | 3300031744 | Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLDQFPW |
| Ga0307477_105205321 | 3300031753 | Hardwood Forest Soil | MNRILRALTVVLLFELGALLLYLPWSGFWEQNYFLSHYPWMMHF |
| Ga0318535_103360082 | 3300031764 | Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNHF |
| Ga0318526_104053962 | 3300031769 | Soil | LLINKVVRAIIIVLCFELGALLFYLPWSEFWEQNYFLFHF |
| Ga0318546_102551882 | 3300031771 | Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNHFP |
| Ga0318568_105940001 | 3300031819 | Soil | MIRILRALTVVLLFEMGALLLYLPWSSFWENNYFLFHYPWLIR |
| Ga0307478_101629461 | 3300031823 | Hardwood Forest Soil | MHRVYRALLVVLAFEMGAMLLYLPWSLYWEQNFFLSHFPSLMPIVLHPSFRGA |
| Ga0307478_105700211 | 3300031823 | Hardwood Forest Soil | MNRILRALTVVLLFELGALLLYLPWSAFWEQNYFLSHYPWMMHFALH |
| Ga0310917_107911261 | 3300031833 | Soil | MNRLLRALAVVLLFEMGALLLYLPWSSFWEQNYFFRHFPGLVPIVLHPS |
| Ga0318512_105487162 | 3300031846 | Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNQFPWLVR |
| Ga0310916_104343222 | 3300031942 | Soil | LLINKVVRAIIIVLCFELGALLFYLPWSEFWEQNYFLFH |
| Ga0310913_101417821 | 3300031945 | Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLNHFPWLVRILLHP |
| Ga0310910_114080311 | 3300031946 | Soil | MNRILRALTVVLLFEMGALLLYLPWSAFWEQNYFLD |
| Ga0306926_100948572 | 3300031954 | Soil | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLSHYVWLKPLVLHPSVR |
| Ga0318530_104708352 | 3300031959 | Soil | MNRILRALTVVLLFEMGALLLYLPWSTFWEQNYFLSHYIWLRP |
| Ga0310911_103337292 | 3300032035 | Soil | MIRILRALTVVLLFEMGALLLYLPWSSFWENNYFLFHYPS |
| Ga0310911_104188081 | 3300032035 | Soil | MNKVVRAIIIVLCFELGALLFYLPWSEFWEQNYFLFHFPSLMPIAL |
| Ga0307470_101317321 | 3300032174 | Hardwood Forest Soil | MNRLLRALAVVLLFEMGALLLYLPWSAFWEQNYFFRHFPG |
| Ga0348332_147421521 | 3300032515 | Plant Litter | MNRVFRALLVVLCFEMGALLLYLPWSIFWDQNYFLSHFPSLIP |
| Ga0335082_101878691 | 3300032782 | Soil | MNRILRALTVVLLFELGALLLYLPWSTFWEQNYFLSHFP |
| Ga0335071_120693201 | 3300032897 | Soil | MNRILRAMSAVLLFEMGALLLYLPWSAFWEQNFFLHRLPWLM |
| Ga0335077_111052572 | 3300033158 | Soil | MNRILRAMTVVLLFELGALLLYLPWSAFWEQNYFLRQFPWLMHFVLHPA |
| Ga0326728_106528792 | 3300033402 | Peat Soil | MHSSMNRLLRALTVVLLFEMGALLLYLPWSAFWEQNYFLHRFPWLI |
| Ga0371489_0445545_1_123 | 3300033755 | Peat Soil | MHSSMNRLLRALTVVLLFEMGALLLYLPWSAFWEQNYFLHR |
| Ga0314864_0152400_458_589 | 3300033805 | Peatland | MNRILRAMTAVLLFEMGALLLYLPWSAFWEQNYFLHRFPWLIPV |
| ⦗Top⦘ |