NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F023923

Metagenome / Metatranscriptome Family F023923

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023923
Family Type Metagenome / Metatranscriptome
Number of Sequences 208
Average Sequence Length 43 residues
Representative Sequence VRWKGRAGVFRRDVGDGEHAEIVIAERVYRVRTGELG
Number of Associated Samples 156
Number of Associated Scaffolds 208

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 24.39 %
% of genes near scaffold ends (potentially truncated) 56.73 %
% of genes from short scaffolds (< 2000 bps) 90.87 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.135 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.981 % of family members)
Environment Ontology (ENVO) Unclassified
(25.481 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.62%    β-sheet: 32.31%    Coil/Unstructured: 63.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 208 Family Scaffolds
PF02746MR_MLE_N 3.37
PF01381HTH_3 2.40
PF06627DUF1153 1.92
PF02775TPP_enzyme_C 1.92
PF00248Aldo_ket_red 1.44
PF00296Bac_luciferase 1.44
PF13683rve_3 0.96
PF13358DDE_3 0.96
PF07505DUF5131 0.96
PF00118Cpn60_TCP1 0.96
PF11008DUF2846 0.96
PF01594AI-2E_transport 0.48
PF00717Peptidase_S24 0.48
PF07589PEP-CTERM 0.48
PF00999Na_H_Exchanger 0.48
PF02518HATPase_c 0.48
PF13711DUF4160 0.48
PF02817E3_binding 0.48
PF13340DUF4096 0.48
PF07690MFS_1 0.48
PF12844HTH_19 0.48
PF13544Obsolete Pfam Family 0.48
PF13437HlyD_3 0.48
PF02899Phage_int_SAM_1 0.48
PF13378MR_MLE_C 0.48
PF01527HTH_Tnp_1 0.48
PF01370Epimerase 0.48
PF13365Trypsin_2 0.48
PF01627Hpt 0.48
PF00501AMP-binding 0.48
PF14226DIOX_N 0.48
PF04392ABC_sub_bind 0.48
PF05239PRC 0.48
PF10691DUF2497 0.48
PF07859Abhydrolase_3 0.48
PF00155Aminotran_1_2 0.48
PF00440TetR_N 0.48
PF13467RHH_4 0.48
PF13586DDE_Tnp_1_2 0.48
PF00027cNMP_binding 0.48
PF07992Pyr_redox_2 0.48
PF13565HTH_32 0.48
PF01717Meth_synt_2 0.48
PF12706Lactamase_B_2 0.48
PF00589Phage_integrase 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 208 Family Scaffolds
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 6.73
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.44
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.96
COG4422Bacteriophage protein gp37Mobilome: prophages, transposons [X] 0.96
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.48
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.48
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 0.48
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.48
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.48
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.48
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.48
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.48
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.48
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.48
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.48
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.13 %
UnclassifiedrootN/A15.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100216268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium643Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101547887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300001686|C688J18823_10197894Not Available1357Open in IMG/M
3300001686|C688J18823_10940652Not Available548Open in IMG/M
3300002568|C688J35102_118939752Not Available616Open in IMG/M
3300002568|C688J35102_120920592Not Available2351Open in IMG/M
3300004081|Ga0063454_101948556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300005167|Ga0066672_10140127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1510Open in IMG/M
3300005175|Ga0066673_10345438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium869Open in IMG/M
3300005176|Ga0066679_11054588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300005177|Ga0066690_10318690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1052Open in IMG/M
3300005184|Ga0066671_11069376Not Available505Open in IMG/M
3300005187|Ga0066675_10275626All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300005331|Ga0070670_100109203Not Available2384Open in IMG/M
3300005332|Ga0066388_102961916All Organisms → cellular organisms → Bacteria → Proteobacteria868Open in IMG/M
3300005332|Ga0066388_103595035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300005353|Ga0070669_101364614Not Available615Open in IMG/M
3300005435|Ga0070714_100795690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium915Open in IMG/M
3300005436|Ga0070713_100704647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria964Open in IMG/M
3300005441|Ga0070700_101515399All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005454|Ga0066687_10188951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1117Open in IMG/M
3300005455|Ga0070663_101928516All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005457|Ga0070662_100335531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1236Open in IMG/M
3300005533|Ga0070734_10328774Not Available873Open in IMG/M
3300005536|Ga0070697_101024975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium734Open in IMG/M
3300005544|Ga0070686_101385826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300005557|Ga0066704_10124888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1710Open in IMG/M
3300005575|Ga0066702_10302853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria975Open in IMG/M
3300005575|Ga0066702_10675086Not Available617Open in IMG/M
3300005576|Ga0066708_10572334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300005577|Ga0068857_102187695All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005602|Ga0070762_10586398All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300005614|Ga0068856_102357464Not Available540Open in IMG/M
3300005618|Ga0068864_102592381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300005764|Ga0066903_109107524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300005903|Ga0075279_10043952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria726Open in IMG/M
3300005921|Ga0070766_10187056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1289Open in IMG/M
3300005921|Ga0070766_10277481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1070Open in IMG/M
3300006028|Ga0070717_10675658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium938Open in IMG/M
3300006031|Ga0066651_10331871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria816Open in IMG/M
3300006031|Ga0066651_10701457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300006046|Ga0066652_100363556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1307Open in IMG/M
3300006046|Ga0066652_100407727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1240Open in IMG/M
3300006046|Ga0066652_101824821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300006175|Ga0070712_100459985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1061Open in IMG/M
3300006176|Ga0070765_100590899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1046Open in IMG/M
3300006800|Ga0066660_10655724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium870Open in IMG/M
3300006806|Ga0079220_10321493All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300006806|Ga0079220_10934204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300006854|Ga0075425_101860649Not Available675Open in IMG/M
3300009038|Ga0099829_11263496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300009094|Ga0111539_10614141All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300009137|Ga0066709_101070365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1184Open in IMG/M
3300009137|Ga0066709_101971263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium810Open in IMG/M
3300009137|Ga0066709_103951019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300009143|Ga0099792_10530209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium741Open in IMG/M
3300009792|Ga0126374_10088910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1716Open in IMG/M
3300010041|Ga0126312_10722438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300010041|Ga0126312_11426448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300010043|Ga0126380_10950544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium719Open in IMG/M
3300010044|Ga0126310_11207215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae607Open in IMG/M
3300010045|Ga0126311_11592787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300010045|Ga0126311_11928806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300010046|Ga0126384_11522979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300010046|Ga0126384_11531228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium626Open in IMG/M
3300010326|Ga0134065_10198329All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300010358|Ga0126370_12326040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300010358|Ga0126370_12395482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300010360|Ga0126372_11862021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300010361|Ga0126378_10079466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3172Open in IMG/M
3300010361|Ga0126378_11801657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300010362|Ga0126377_10237265All Organisms → cellular organisms → Bacteria1768Open in IMG/M
3300010362|Ga0126377_12276035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300010376|Ga0126381_104090169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300010376|Ga0126381_104606179All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010396|Ga0134126_11304229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium804Open in IMG/M
3300010397|Ga0134124_11087173Not Available816Open in IMG/M
3300010880|Ga0126350_10825435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium845Open in IMG/M
3300011119|Ga0105246_12418984Not Available515Open in IMG/M
3300011120|Ga0150983_16640679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium842Open in IMG/M
3300011269|Ga0137392_10075693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2602Open in IMG/M
3300012189|Ga0137388_11309849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300012198|Ga0137364_10029672All Organisms → cellular organisms → Bacteria3477Open in IMG/M
3300012198|Ga0137364_10293752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM14171206Open in IMG/M
3300012200|Ga0137382_10001274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium11052Open in IMG/M
3300012202|Ga0137363_10759357All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300012203|Ga0137399_11465454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300012205|Ga0137362_11072485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium685Open in IMG/M
3300012205|Ga0137362_11409125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300012206|Ga0137380_11543888All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012208|Ga0137376_10079086All Organisms → cellular organisms → Bacteria2753Open in IMG/M
3300012208|Ga0137376_10231867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1600Open in IMG/M
3300012212|Ga0150985_100640276All Organisms → cellular organisms → Bacteria2259Open in IMG/M
3300012212|Ga0150985_101057970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium736Open in IMG/M
3300012212|Ga0150985_105383623All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300012212|Ga0150985_106647766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium727Open in IMG/M
3300012285|Ga0137370_10169600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1270Open in IMG/M
3300012285|Ga0137370_10978851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1417521Open in IMG/M
3300012349|Ga0137387_10973743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300012362|Ga0137361_11702516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300012375|Ga0134034_1129452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300012469|Ga0150984_103271575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1691Open in IMG/M
3300012469|Ga0150984_107530273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1461Open in IMG/M
3300012469|Ga0150984_110841008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300012469|Ga0150984_115050320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales901Open in IMG/M
3300012469|Ga0150984_116298068Not Available890Open in IMG/M
3300012469|Ga0150984_123461871All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300012917|Ga0137395_10371282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1021Open in IMG/M
3300012927|Ga0137416_11173650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300012960|Ga0164301_11008034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300012961|Ga0164302_11157438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300012986|Ga0164304_10953599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300013306|Ga0163162_13062215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300014157|Ga0134078_10024891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1920Open in IMG/M
3300014157|Ga0134078_10249144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium744Open in IMG/M
3300014325|Ga0163163_10657530All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300014325|Ga0163163_12418033Not Available584Open in IMG/M
3300014501|Ga0182024_10068958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium5374Open in IMG/M
3300014654|Ga0181525_10171498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1187Open in IMG/M
3300014968|Ga0157379_12139749All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300015053|Ga0137405_1340608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4950Open in IMG/M
3300015245|Ga0137409_10931838All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300015373|Ga0132257_100934040Not Available1089Open in IMG/M
3300015373|Ga0132257_101933668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium760Open in IMG/M
3300015373|Ga0132257_102831106Not Available632Open in IMG/M
3300015374|Ga0132255_103112272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium708Open in IMG/M
3300015374|Ga0132255_103839886Not Available638Open in IMG/M
3300015374|Ga0132255_105804939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300016294|Ga0182041_10772767All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300016404|Ga0182037_10348133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1206Open in IMG/M
3300018071|Ga0184618_10138714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae → Afipia broomeae ATCC 49717986Open in IMG/M
3300018431|Ga0066655_10939354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300018431|Ga0066655_11122185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300018433|Ga0066667_11706404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300018433|Ga0066667_11811978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300018433|Ga0066667_11912178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300018468|Ga0066662_10075180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2283Open in IMG/M
3300018468|Ga0066662_10950130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium848Open in IMG/M
3300018476|Ga0190274_10737688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1034Open in IMG/M
3300019789|Ga0137408_1437257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1225Open in IMG/M
3300019888|Ga0193751_1006688All Organisms → cellular organisms → Bacteria → Proteobacteria6340Open in IMG/M
3300020579|Ga0210407_11254228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300020582|Ga0210395_10133312Not Available1849Open in IMG/M
3300020583|Ga0210401_10291663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1492Open in IMG/M
3300020583|Ga0210401_11256973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300020583|Ga0210401_11389711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300021180|Ga0210396_10717418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium863Open in IMG/M
3300021181|Ga0210388_10078456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2798Open in IMG/M
3300021407|Ga0210383_11673311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300021432|Ga0210384_10274092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1519Open in IMG/M
3300021432|Ga0210384_10579206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1009Open in IMG/M
3300021560|Ga0126371_11327129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium852Open in IMG/M
3300021560|Ga0126371_12361062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium643Open in IMG/M
3300021560|Ga0126371_13404524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300022756|Ga0222622_10668771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium753Open in IMG/M
3300022756|Ga0222622_11395283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300024179|Ga0247695_1035652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium713Open in IMG/M
3300025907|Ga0207645_11050419Not Available550Open in IMG/M
3300025915|Ga0207693_10128998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1988Open in IMG/M
3300025915|Ga0207693_11164960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300025922|Ga0207646_11732673Not Available536Open in IMG/M
3300025922|Ga0207646_11831023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300025923|Ga0207681_10766893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium805Open in IMG/M
3300025925|Ga0207650_11364708Not Available603Open in IMG/M
3300025929|Ga0207664_10420350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1191Open in IMG/M
3300025930|Ga0207701_10649329All Organisms → cellular organisms → Bacteria → Acidobacteria896Open in IMG/M
3300025931|Ga0207644_10514200Not Available989Open in IMG/M
3300025936|Ga0207670_11716355Not Available534Open in IMG/M
3300025940|Ga0207691_10932874Not Available726Open in IMG/M
3300025989|Ga0207998_1013350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300026067|Ga0207678_11964306All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300026304|Ga0209240_1099227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1045Open in IMG/M
3300026324|Ga0209470_1280056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300026325|Ga0209152_10090236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1141Open in IMG/M
3300026548|Ga0209161_10264205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium879Open in IMG/M
3300026557|Ga0179587_11036841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300026557|Ga0179587_11101081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300027565|Ga0209219_1070897All Organisms → cellular organisms → Bacteria → Proteobacteria866Open in IMG/M
3300027565|Ga0209219_1161111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300027591|Ga0209733_1147762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300027603|Ga0209331_1086033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.776Open in IMG/M
3300027825|Ga0209039_10097820All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium1262Open in IMG/M
3300027903|Ga0209488_10270678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1271Open in IMG/M
3300028047|Ga0209526_10090348Not Available2156Open in IMG/M
3300028047|Ga0209526_10773772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300028381|Ga0268264_11296149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium738Open in IMG/M
3300029943|Ga0311340_10545055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1026Open in IMG/M
3300031091|Ga0308201_10309444Not Available565Open in IMG/M
3300031446|Ga0170820_10102762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300031561|Ga0318528_10814228All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031740|Ga0307468_100806020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae801Open in IMG/M
3300031754|Ga0307475_10691190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium814Open in IMG/M
3300031782|Ga0318552_10267830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium867Open in IMG/M
3300031793|Ga0318548_10053548Not Available1850Open in IMG/M
3300031823|Ga0307478_11060901Not Available676Open in IMG/M
3300031859|Ga0318527_10225498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium795Open in IMG/M
3300031941|Ga0310912_10053327All Organisms → cellular organisms → Bacteria2849Open in IMG/M
3300031947|Ga0310909_10185003Not Available1726Open in IMG/M
3300031954|Ga0306926_11404933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium810Open in IMG/M
3300031965|Ga0326597_10351570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1656Open in IMG/M
3300032064|Ga0318510_10422465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300032091|Ga0318577_10180877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1007Open in IMG/M
3300032770|Ga0335085_11754634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300032895|Ga0335074_10051433All Organisms → cellular organisms → Bacteria → Proteobacteria5669Open in IMG/M
3300032954|Ga0335083_11409729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.13%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.37%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.88%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.88%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.44%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.48%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.48%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.48%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.48%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.48%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.48%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012375Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025989Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10021626823300000364SoilLWKGRAAIFRREVGDGEHAEVVIEGRVYRVRIVELS*
INPhiseqgaiiFebDRAFT_10154788723300000364SoilMSWKGRAGTFQRETGDGTHAEVTIEGRVYRVRISELI*
C688J18823_1019789453300001686SoilRDRAGTYRRDTGDGEHVEIVIAERVYRVRRAELRQG*
C688J18823_1094065213300001686SoilDKVSWQGRAGVFRRDIGDGEHAEVVIGERVYRVRNAELG*
C688J35102_11893975223300002568SoilMTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHVEVTIGERVYRVKSAELG*
C688J35102_12092059243300002568SoilMRLTPTWRAGDNIRWQGRPAVYRRDVGDGQHAEIVIGERIYRVRSKEFG*
Ga0063454_10194855613300004081SoilMTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHAEVTIGER
Ga0066672_1014012713300005167SoilPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVRIGELR*
Ga0066673_1034543833300005175SoilASMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIEELA*
Ga0066679_1105458813300005176SoilVSPDKKVMPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVRTSELS*
Ga0066690_1031869013300005177SoilTWRAGEVVRWKNRTGIFRREVGDGEHAEVVIAERVYRVRIGELS*
Ga0066671_1106937623300005184SoilAARPIEIPRQPGDRVRWRDRAGTYRRDTGDGEHVEIVIAERVYRVRRAELRQG*
Ga0066675_1027562623300005187SoilMPARISPIWRAGEAVRWKGRAGVFRRVVDDGEHAEIVIAERVYRVRIGELS*
Ga0070670_10010920343300005331Switchgrass RhizosphereLKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVSRGELRAG*
Ga0066388_10296191613300005332Tropical Forest SoilDRVKWRDRVGLYRRDVDDEHGEVVLDERLYRVRKSELRPG*
Ga0066388_10359503513300005332Tropical Forest SoilMPVIWKGRAAIFRREVGDGEHAEVLIDERVYRVRMSELR*
Ga0070669_10136461423300005353Switchgrass RhizosphereSRLKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVSRGELRAG*
Ga0070675_10194660013300005354Miscanthus RhizosphereGASVRWQNRDGVFHRDVGDGEHAEIIIGERTYRVRMRDLV*
Ga0070714_10079569023300005435Agricultural SoilMPVLWKGRAAVFRREVGDGEHAEILVDGRIYRVRISELR*SAI
Ga0070713_10070464713300005436Corn, Switchgrass And Miscanthus RhizosphereMPVLWKGRAAVFRRDVGDGEHAEILIDGRIYGVPISELR*
Ga0070700_10151539913300005441Corn, Switchgrass And Miscanthus RhizosphereEATPIRITPTYRTGDPVWWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA*
Ga0066687_1018895123300005454SoilITPTWRRGDQVRWKDRAGVFRRDVGDGEHAEVTIGERVYRVRMAELA*
Ga0070663_10192851613300005455Corn RhizosphereIRITPTYRTGDPVLWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA*
Ga0070662_10033553143300005457Corn RhizosphereVRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG*
Ga0070734_1032877413300005533Surface SoilRIRPIWRPGDQVSYQGRTGTFRRDTGDGEHVEIVIGERVYRVRSNDLS*
Ga0070697_10102497523300005536Corn, Switchgrass And Miscanthus RhizosphereMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRLSELA*
Ga0070686_10138582623300005544Switchgrass RhizosphereVEIEAPWHPGNRVRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG*
Ga0066704_1012488813300005557SoilWRASMPVLWKGRAGIFRRDVGDGEHAEIVIDGRIYRVRIEELR*
Ga0066702_1030285323300005575SoilMPARISPTWRAGEAVHWKGRAGVFRRVVDDGEHAEIVIAERVYRVRIGELS*
Ga0066702_1067508613300005575SoilGDRVRWRDRAGTYRRDTGDREHVEIVIAERVYRVRRPELRQG*
Ga0066708_1057233413300005576SoilVGSAPAKIGPVWQASMPVLWKGRAGVFRRDVGDGENAEVVIDGRVYRVRFSELR*
Ga0068857_10218769523300005577Corn RhizosphereWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA*
Ga0070762_1058639823300005602SoilMAPTWRAGDPVRCKGRAGVFRRDVGDGVHAEIVIGERVYRVRIGELG*
Ga0068856_10235746413300005614Corn RhizosphereVRWRDRGGTYRRDVDDGEHVEILIAERVYRVRRAELRPG*
Ga0068864_10259238123300005618Switchgrass RhizosphereRVRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG*
Ga0066903_10910752423300005764Tropical Forest SoilMAPVWKSGDAVRWSGRNGTFRCDVGDGEHAEITLAERIYR
Ga0075279_1004395233300005903Rice Paddy SoilVRWKGRGGTFRRDVGDGEHAEIALAERIYRVRVSELG*
Ga0070766_1018705643300005921SoilGDPVRCKGRAGVFRRDVGDGVHAEIVIGERVYRVRIGELG*
Ga0070766_1027748113300005921SoilVRWKGRAGVFARDVGDGEHAEIVIAERVYRVRIGELS*
Ga0070717_1067565813300006028Corn, Switchgrass And Miscanthus RhizosphereVWRASMPVLWKGRAAVFRRDVGDGEHAEILIDGRIYRVRISELR*
Ga0066651_1033187113300006031SoilLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVLIGELR*
Ga0066651_1070145713300006031SoilLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIEELA*
Ga0066652_10036355643300006046SoilWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIGELS*
Ga0066652_10040772723300006046SoilMPVLWKGRAGIFRRDVGDGEHAEVVIEGRIYRVRMSELA*
Ga0066652_10182482133300006046SoilSVLAKVRIGIFRRDVGDGEHAQVVIDGRVYRVGIEELA*
Ga0070712_10045998533300006175Corn, Switchgrass And Miscanthus RhizosphereVSPDKKAMPIWRASMPVLWKGRAGIFRRDVGDGEKAEVVIEGRVSRVRIGELR*
Ga0070765_10059089923300006176SoilVPAKISPTWRAGDAVRWKDRTGVFRRDVGDGEHAEIGIAERVYRVRIGELS*
Ga0066660_1065572413300006800SoilKGRAGIFRRDVGDGEHAEVVLDGPVYRVRIGELR*
Ga0079220_1032149313300006806Agricultural SoilSWNPGESLFWKGRAGIFRRDVGDGEHAEIIIAERTYRVPISELT*
Ga0079220_1093420413300006806Agricultural SoilVRWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA*
Ga0075425_10186064913300006854Populus RhizosphereMPVLWKGRAGIFRRDVRDGEHAKFVIRVSVVRVFETTGWLN*
Ga0099829_1126349633300009038Vadose Zone SoilARISPTWRAGEVVRWKGRAGVFRREVGDGEQAEIVIAERVYRVRTSGLR*
Ga0111539_1061414123300009094Populus RhizosphereVWWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA*
Ga0066709_10107036513300009137Grasslands SoilVSPANAIPVWRASMPVLWKGRARIFRRDVGDGEHAEVVIDGRVYRVQTSELS*
Ga0066709_10197126323300009137Grasslands SoilMPVLWKGRAGIVRRDVGDGEHAEVVIEGRVYRVRMGELR*
Ga0066709_10395101923300009137Grasslands SoilMPVLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVRIEELA*
Ga0099792_1053020913300009143Vadose Zone SoilMPVSWSGRAGVFRREVGDGEHAEVLIDGRVYRVHSRELS*
Ga0126374_1008891013300009792Tropical Forest SoilVLWQGRAGIFRRDVGDGEHAEIVITERIYRVRVEKLG*
Ga0126312_1072243823300010041Serpentine SoilVRWKDRVGVFRRPVGDDEHAEIVIAERVYRVRISELA*
Ga0126312_1142644813300010041Serpentine SoilWRAGDQVRWQGRAGVFRRDIGDGEHAEVVIAERVYRVRSSELV*
Ga0126380_1095054413300010043Tropical Forest SoilVRWQGRAGIFRRDAGDGEHAEILIAGRVYRVRLKDLA*
Ga0126310_1120721513300010044Serpentine SoilVRWKDRAGVFRRAVGDDDEHAEIVIAERVYRVRTSELA*
Ga0126311_1159278713300010045Serpentine SoilQGRVGTFRRDVGDGEHAEVAIGERVYRVRTSELG*
Ga0126311_1192880623300010045Serpentine SoilVRWKDRVGVFRRPVGDDEHAEIVIAERVYRVRTSELPSDLA*
Ga0126384_1152297933300010046Tropical Forest SoilVLWKGRAGIFRREVGDGEHAEVVIEGRVYRVRIADLR*
Ga0126384_1153122813300010046Tropical Forest SoilRKARRSSPLTARISPSWRAGDGVYWQGRAGIFRRDVGDGEHAEIVIAERVYRVRTTELT*
Ga0134065_1019832913300010326Grasslands SoilKVSWQGRAGVFRRDVGDGEHAEVVIGERVYRVRSAELG*
Ga0126370_1232604023300010358Tropical Forest SoilKLTPVWCANMPVLWKDRAAVFRREVGDGEHAEIVLDGRIYRVRISELR*
Ga0126370_1239548233300010358Tropical Forest SoilGAAKLTPVWRASMPVLWKGRAGIFRRDVADGEHAEILLDGRIYRVRISELR*
Ga0126372_1186202113300010360Tropical Forest SoilTPVWRASMPVRWKGRAGIFRREVGDGEHAEVVIEGRVYRVRIAELH*
Ga0126378_1007946633300010361Tropical Forest SoilVRWHGRAGVFQRDVGDGEHAEIVIAERIYRVRTKELA*
Ga0126378_1180165713300010361Tropical Forest SoilVRWHGRAGTFRRDIGDGKHAEIVIAERVYRVRVDELA*
Ga0126377_1023726523300010362Tropical Forest SoilMPVLWKGRAGIFRREVGDGEHAEIVLDGRIYRVRISELA*
Ga0126377_1227603523300010362Tropical Forest SoilMAPVWKSGDAVRGSGRAGTFRRDVGDGEHAEITLAERIYRVRLSELG*
Ga0126381_10409016923300010376Tropical Forest SoilMAPVWKSGDAVRWSGRNGTFRCDVCDGEHAEITLAERIYRVRLSELG*
Ga0126381_10460617923300010376Tropical Forest SoilWRASMPVLWKERAAVFRRDVGDGEHAEILVDGRIYRVRISSTGK*
Ga0134126_1130422913300010396Terrestrial SoilMPVLWKGRAGIFRRDVGDGEHAEVVVEGRVYRVRIGELS*
Ga0134124_1108717313300010397Terrestrial SoilVRWRDRTGTYRRDAGDGEHVEIVIAERVYRVRRSELLPG*
Ga0126350_1082543513300010880Boreal Forest SoilVVHWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELGWAPKS*
Ga0105246_1241898423300011119Miscanthus RhizosphereLVWKPGDAVRWKGRSGTFRCDVGDGEHAEIALAERIYRVRLSELG*
Ga0150983_1664067923300011120Forest SoilAGGPVRWQGRAGIFRRDVGDGVHVEIVIAERVYRVRTAELS*
Ga0137392_1007569323300011269Vadose Zone SoilVVRWKGRAGVFRREVGDGEQAEIVIAERVYRVRTSGLR*
Ga0137388_1130984933300012189Vadose Zone SoilVRWKGRAGVFRREVGDGDQAEIVIAERVYRVRTSGLR*
Ga0137364_1002967263300012198Vadose Zone SoilMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEGLC*
Ga0137364_1029375213300012198Vadose Zone SoilRAANAAKAVPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIGELG*
Ga0137382_10001274103300012200Vadose Zone SoilMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEELC*
Ga0137363_1075935723300012202Vadose Zone SoilVRWQGRAGIFRRDVGDGEHAEIAIAERVYRVRINELA*
Ga0137399_1146545413300012203Vadose Zone SoilMPVLWKGRAGVFRREVGDGEHAEVLIDGRVYRVRLSELD*
Ga0137362_1107248513300012205Vadose Zone SoilVSLSAKLTPVWRASMPVLWKGRAGMFRRDVGDGEHAEVAIDRRIYRVRLTELG*
Ga0137362_1140912513300012205Vadose Zone SoilVLWKGRAGIFRREVGDGEHAEVVIEGRVYRVRIEELA*
Ga0137380_1154388823300012206Vadose Zone SoilARISPTWNAGDTVHWKNRAGTFRRDVGDGEHAEIVIGVRVYRVRTAELR*
Ga0137376_1007908613300012208Vadose Zone SoilMPVWRASMPVLWKGRAGIFRRDVGDGEHAEVAIDGRVYRVRIGELG*
Ga0137376_1023186713300012208Vadose Zone SoilSMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIGELS*
Ga0150985_10064027633300012212Avena Fatua RhizosphereVRWKDRAGLFRREIGDGEHAEIAIGERIYRVRIAELT*
Ga0150985_10105797013300012212Avena Fatua RhizosphereVRWKDRAGLFHREIGDGEYAEITIGERIYRVRIAELV*
Ga0150985_10538362333300012212Avena Fatua RhizosphereMTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHAEVTIGERVYRVKSAELG*
Ga0150985_10664776623300012212Avena Fatua RhizosphereMTARIAPSWRAGDQVRWQGRMGTFRRDVGDGEHAEVMIGERVYRVKSAELG*
Ga0137370_1016960023300012285Vadose Zone SoilMPVLWKGRAAVFRREVGDGEHAEILVDGRIYRVRISELR*
Ga0137370_1097885113300012285Vadose Zone SoilSMPVLWKGRAGIFRRDVGDGEHAEVAIDGRVYRVRIGQLG*
Ga0137387_1097374313300012349Vadose Zone SoilISPTWNAGDTVHWKNRAGTFRRDVGDGEHAEIVIGVRVYRVRTAELR*
Ga0137361_1170251613300012362Vadose Zone SoilSPRWRADDRVRWQGRAGIFRRDVGDGEYAEIVIAERVYRVRIKELA*
Ga0134034_112945233300012375Grasslands SoilMTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHAEVMIGERVYRVKSAELG
Ga0150984_10327157543300012469Avena Fatua RhizosphereLAAWRPGDRVRWRDRAGIYRRDGGDGEHVEIVIAERVYRVRRAELLPG*
Ga0150984_10753027333300012469Avena Fatua RhizosphereVRWKDRAGQFRREIGDGEHAEIAIGERIYRVRIAELV*
Ga0150984_11084100813300012469Avena Fatua RhizospherePGESLFWKGRAGIFRRDVGDGEHAEIVIAERTYRVQISELT*
Ga0150984_11505032033300012469Avena Fatua RhizosphereKWKDRTGLFCREVGDNEHAEIAIAERVYRVKLSELG*
Ga0150984_11629806813300012469Avena Fatua RhizosphereWKDRTGLFRREVGDNEHAEIAIAERVYRVKLSDLG*
Ga0150984_12346187123300012469Avena Fatua RhizosphereVLWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA*
Ga0137395_1037128213300012917Vadose Zone SoilPLWRASMPVLWKGRARVFRRDVGDGEHAEVVIEGRVYRVPIGELT*
Ga0137413_1117603113300012924Vadose Zone SoilQDRIGVFRRDVGDGEHAEIVIADRIYRVRVGDLA*
Ga0137416_1117365013300012927Vadose Zone SoilASMPVLWKGRAGVFRREVGDGEHAEVLIDGRVYRVRLSEIA*
Ga0164301_1100803423300012960SoilVRWQDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG*
Ga0164302_1115743823300012961SoilMLVWRASMPVLWKGRAGIFRRDVGDGEKAGVVIEGRISRVRIGELR*
Ga0164304_1095359923300012986SoilMPVLWKGRAGIFRRDVGDGEKAEVVIEGRVSRVRIGELR*
Ga0163162_1306221523300013306Switchgrass RhizosphereSWHPGSRVCWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG*
Ga0134078_1002489113300014157Grasslands SoilGIWKDHAGIFRRDVGDGERDEVVIDGRTYRVRTSELT*
Ga0134078_1024914423300014157Grasslands SoilMPVSWKGRAGIFRRDVGDGEHAEVAIEGRVYRVRIGELS*
Ga0163163_1065753023300014325Switchgrass RhizosphereVRWKDRAGLFRREIGDGEHAEITIGERIYRVRIAELV*
Ga0163163_1241803313300014325Switchgrass RhizosphereLKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRV
Ga0182024_1006895823300014501PermafrostVKWKGRDGTYRRDVGDGEHAEIVIGPRVYRVRLTELR*
Ga0181525_1017149813300014654BogVQWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELG*
Ga0157379_1213974923300014968Switchgrass RhizosphereVRWRDRAGTYRRDAGDGEHVEIVIAERVYRVRRSELLPG*
Ga0137405_134060833300015053Vadose Zone SoilMPVLWKGRAGIFRRDIGDGEHAEVVIDGRVYRVRLRELSYAPR*
Ga0137409_1093183823300015245Vadose Zone SoilHWKNRAGTFRRDVGDGEHAEIVIGVRVYRVRTAELR*
Ga0132257_10093404023300015373Arabidopsis RhizosphereLKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVRRAELRPG*
Ga0132257_10193366813300015373Arabidopsis RhizosphereVRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRSELLPR*
Ga0132257_10283110623300015373Arabidopsis RhizosphereSIEIIQSRASGTYRRDAGDGEHVEIVIAERVYRIRRGELRPG*
Ga0132255_10311227213300015374Arabidopsis RhizosphereVVWRPGDQVRWKERSGVFRRDVGDGEHAEIMLGERTYRVRTSELS*
Ga0132255_10383988623300015374Arabidopsis RhizosphereKAPWHPGERVRWRDRAGTYRRDVGDEEHVEIVIAERVYRVRRGELRPG*
Ga0132255_10580493913300015374Arabidopsis RhizosphereRNVGPGTRKISPAWRASMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRLNELA*
Ga0182041_1077276713300016294SoilSQRKTRRASPVTSRVTPSWRAGDGVRWQHRAGIFRRDVGDDEHAEIVIGERVYRVRISEL
Ga0182037_1034813313300016404SoilRRAPPVTSRISPSWRAGEGVRWQGRAGIFRRDVGDGEHAEIVIAERVYRVRIKELA
Ga0184618_1013871423300018071Groundwater SedimentVRWKGRAGVFRRDVGDGEHAEIVIAERVYRVRTGELG
Ga0066655_1093935423300018431Grasslands SoilMTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHAEVTIGERVYRVKSAELG
Ga0066655_1112218523300018431Grasslands SoilMLVWRASMPVLWKGRAGIFRRDVGDGEKAEVVIEGRVSRVRIGELR
Ga0066667_1170640413300018433Grasslands SoilWKGRAGIFRGDVGDGEHAEVVIEGRMYRVRMSELA
Ga0066667_1181197813300018433Grasslands SoilMTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHVEVTIGERVYRVKSAELG
Ga0066667_1191217823300018433Grasslands SoilMPVLWKGRAGVFRRDIGDGEHAEVVIGERVYRVRNAELG
Ga0066662_1007518043300018468Grasslands SoilMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEELC
Ga0066662_1095013013300018468Grasslands SoilMAAATGIPVWRASIPVLWKGRAGIFRREVGDGEHGEIVIDGRVYPGAE
Ga0190274_1073768833300018476SoilLWRVGDPVKWQGRDGAYRRDVGDGEHSEIVIGQRVYRVRTKEIG
Ga0137408_143725713300019789Vadose Zone SoilLSWGPGDPVKWKRRPGIFRREVGDGEHAEIVIGERVYRVPINELG
Ga0193751_100668863300019888SoilSPAAKAAPLWRASMPVLWKGRAGIFRRDVGDGEHAEVVIEGRIYRVRIGELQ
Ga0210407_1125422813300020579SoilPTWRAGDAVRWKGRAGVYRRDVGDGDHAEIVIAERVYRVRIGELS
Ga0210395_1013331243300020582SoilVVQWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELG
Ga0210401_1029166313300020583SoilVRWKGRAGVFRREVGDAEHAEIVIAERVYRVRTSELG
Ga0210401_1125697313300020583SoilPGRISPTWRVGEPVRWKGRAGVFRRDVGDGEHAEIVVAERVYRVRISELG
Ga0210401_1138971113300020583SoilPGRISPTWRVGEPVRWKGRAGVFRRDVGDGEHAEIGIAERVYRVRIGELS
Ga0210396_1071741823300021180SoilSPTWRVGEPVRWKGRAGVFRRDVGDGEHAEIGIAERVYRVRIGELS
Ga0210388_1007845633300021181SoilVVQWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLNELV
Ga0210383_1167331123300021407SoilVWKSGDAVHWSGRAGTFRRDVGDGEHAEITLAERIYRVRLSELG
Ga0210384_1027409213300021432SoilAGSVPGRISPTWRVGEPVRWKGRAGVFRRDVGDGEHAEIVVAERVYRVRISELG
Ga0210384_1057920613300021432SoilSPIWRAGDPVRWKSREGIFRREVGDGEHAEIVIAERVYRVRTSELGRSGAPARKEIG
Ga0126371_1132712913300021560Tropical Forest SoilVRWHGRVGIFRRDVGDGEHAEIAIAERVYRVRVNELA
Ga0126371_1236106213300021560Tropical Forest SoilSMPVLWRGRAGIFRREVGDGEHAEVVIEGRVYRVRIAELH
Ga0126371_1340452413300021560Tropical Forest SoilGDGVSWQGRAGIFRRDVGDGEHAEIAIAERVYRVRTTELV
Ga0222622_1066877133300022756Groundwater SedimentPEKASPVWRASMPVLWKGRAGIFRRDAGDGEHAEVVLDGRVYRVRISELS
Ga0222622_1139528313300022756Groundwater SedimentMPVWRASMPVLWKGRAGIFRRDAGDGEHAEVVLDGRVYRVRISE
Ga0247695_103565213300024179SoilHPGNRVRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRAG
Ga0207645_1105041913300025907Miscanthus RhizosphereCPGARRWGARDRAGNYRRDAGDGERAEIVIAERVYRVRRAEPRPG
Ga0207693_1012899863300025915Corn, Switchgrass And Miscanthus RhizosphereMPIWRASMPVLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVRIGELR
Ga0207693_1116496013300025915Corn, Switchgrass And Miscanthus RhizosphereATKAIPVWRASMPVLWKGRVGIFRRDVGDGEHAEVVIEGRVYRVRIGELR
Ga0207646_1173267323300025922Corn, Switchgrass And Miscanthus RhizosphereMPTRITPQWRFGDRVRWQDRAGLFRRDLGDENAEITIANRVYRVRIADLRPG
Ga0207646_1183102313300025922Corn, Switchgrass And Miscanthus RhizosphereLPARINPTWRAGEAVRWKDRTGVFRRDVGDGEHAEIGIAER
Ga0207681_1076689323300025923Switchgrass RhizosphereVWWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA
Ga0207650_1136470813300025925Switchgrass RhizosphereLKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVSRGELRAG
Ga0207664_1042035013300025929Agricultural SoilASMPALWKGRAAVFRREVGDGEHAEILVDGRIYRVRISELR
Ga0207701_1064932913300025930Corn, Switchgrass And Miscanthus RhizosphereGDRVRWRDRAGIYRRDAGDGEHVEIVIAERVYRVRRGELLPG
Ga0207644_1051420013300025931Switchgrass RhizosphereWRDRAGTYRRDAGDGEHVEIVIAERVYRVRRSELLPG
Ga0207670_1171635513300025936Switchgrass RhizosphereAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVSRGELRAG
Ga0207691_1093287423300025940Miscanthus RhizosphereRDRAGTYRRDVGDGEHVEIVIAERVYRVRRADLRPG
Ga0207998_101335033300025989Rice Paddy SoilVRWKGRGGTFRRDVGDGEHAEIALAERIYRVRVSELG
Ga0207678_1196430623300026067Corn RhizospherePIRITPTYRTGDPVLWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA
Ga0209240_109922713300026304Grasslands SoilEPARWQGRNGVFRREVGDGEHAEIVIAERIYRVRTRELIPGL
Ga0209470_128005623300026324SoilRAVSHHAKAPPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVNDGLVYRIRIEELC
Ga0209152_1009023623300026325SoilVWRASMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEGLC
Ga0209161_1026420513300026548SoilAKAPPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVNDGRVYRIRIEELC
Ga0179587_1103684123300026557Vadose Zone SoilDWRSSMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEGLC
Ga0179587_1110108113300026557Vadose Zone SoilVRWQGRAGIFRRDVGDGEHAEIAIAERVYRVRINELA
Ga0209219_107089713300027565Forest SoilTWRAGDPVRWKGRAGVFRRDVGDGEHAEIVIAERVYRVRTSELG
Ga0209219_116111123300027565Forest SoilVLWQGRNGVFRREVGDGEHSEIVIAERVYRVRTRELS
Ga0209733_114776213300027591Forest SoilRAFRAGVFRRDFGDGEHAEIVIGERVYRVRAKELS
Ga0209331_108603313300027603Forest SoilGEPVQWRGRAGVFRRDVGDGEHAEIVIAERVYRVRTSELG
Ga0209039_1009782023300027825Bog Forest SoilVRWQGRAGIFRRDVGDGEHAEIVIAERVYRVRIEELA
Ga0209488_1027067843300027903Vadose Zone SoilRNVGSAPAKISPVWQAGMPVLWKGRAGVFRRDVGDGEHAEVLIDGRVYRVRLSELA
Ga0209526_1009034813300028047Forest SoilWKGRAGVFRREVGDAEHAEIVIAERVYRVRTSELG
Ga0209526_1077377213300028047Forest SoilESRPTTISPTWRTGEAVRWKGRAGVFRRDVGDGEHAEIVIAERVYRVRIGELS
Ga0268264_1129614923300028381Switchgrass RhizosphereGSRVCWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPGRSRGSIT
Ga0311340_1054505543300029943PalsaAELEANDVVRWKGRSGTFRRDVGDGEHVEIVLADRIYRVRLSELG
Ga0308201_1030944433300031091SoilVKWKDRTGLFRREVGDNEHAEIAIAERVYRVKLSELG
Ga0302324_10083604823300031236PalsaSQRNSRRANAAPARIDPIWRAGDTVRWQGRPGVYRRDVGDGEHAEIMLGERVYRVKVKEL
Ga0170820_1010276213300031446Forest SoilAKLSPVWSASMPVLWKGRAGVFRRDVGDGVHAEVTIDEGVYRVPIRELA
Ga0318528_1081422823300031561SoilWQHRAGIFRRDVGDDEHAEIVIGERVYRVRISELG
Ga0307468_10080602033300031740Hardwood Forest SoilVPRQLGDRVRWRDRAGTYHRDVGAGEHVEIVIAERVYRVHRAELRPG
Ga0307475_1069119023300031754Hardwood Forest SoilLTLSPTWRRGDPVRWKDRAGVFRRDVGDGEHAEIVIGERVYRVQTRELG
Ga0318552_1026783023300031782SoilVRWQHRAGIFRRDVGDDEHAEIVIGERVYRVRISELG
Ga0318548_1005354823300031793SoilVRWQGRAGIFRRDVGDAEHAEIVIAERVYRVRINELA
Ga0307478_1106090113300031823Hardwood Forest SoilVRWQSRVGVFRRDVDDGEHAEIVIGERIYRVRARELG
Ga0318527_1022549813300031859SoilRWRDRIGGFRRDVGDGEHAEIVITGRVYRVRLEELG
Ga0310912_1005332753300031941SoilSPVTARISPSWRTGDGVSWQGRAGIFRRDVGDGEHAEIAIAERVYRVRTTELA
Ga0310909_1018500333300031947SoilMSPSWRAGDGVRWQGRDGIFQRDVGDGEHAEIVIANRVYRVGIKELA
Ga0306926_1140493313300031954SoilVRWQGRAGIFRRDVGDGEHAEIVITERIYRVRVKELA
Ga0326597_1035157013300031965SoilMSWRVGDHVKWQGRAGVFRRDVGDGEHAEIVIAERVYRVRSKEIE
Ga0318510_1042246513300032064SoilGVRWQGRAGIFRRDVGDGEHAEIVIAERVYRVRIKELA
Ga0318577_1018087723300032091SoilVRWRDRIGGFRRDVGDGEHAEIVITGRVYRVRLEELG
Ga0335085_1175463423300032770SoilWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELV
Ga0335074_1005143363300032895SoilVRWKGRGGTFRRDFGDGEHAEIALADRIYRVRVSELG
Ga0335083_1140972913300032954SoilWKPDDVVQWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.