Basic Information | |
---|---|
Family ID | F023923 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 208 |
Average Sequence Length | 43 residues |
Representative Sequence | VRWKGRAGVFRRDVGDGEHAEIVIAERVYRVRTGELG |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 208 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 24.39 % |
% of genes near scaffold ends (potentially truncated) | 56.73 % |
% of genes from short scaffolds (< 2000 bps) | 90.87 % |
Associated GOLD sequencing projects | 147 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.67 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.135 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.981 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.481 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.62% β-sheet: 32.31% Coil/Unstructured: 63.08% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 208 Family Scaffolds |
---|---|---|
PF02746 | MR_MLE_N | 3.37 |
PF01381 | HTH_3 | 2.40 |
PF06627 | DUF1153 | 1.92 |
PF02775 | TPP_enzyme_C | 1.92 |
PF00248 | Aldo_ket_red | 1.44 |
PF00296 | Bac_luciferase | 1.44 |
PF13683 | rve_3 | 0.96 |
PF13358 | DDE_3 | 0.96 |
PF07505 | DUF5131 | 0.96 |
PF00118 | Cpn60_TCP1 | 0.96 |
PF11008 | DUF2846 | 0.96 |
PF01594 | AI-2E_transport | 0.48 |
PF00717 | Peptidase_S24 | 0.48 |
PF07589 | PEP-CTERM | 0.48 |
PF00999 | Na_H_Exchanger | 0.48 |
PF02518 | HATPase_c | 0.48 |
PF13711 | DUF4160 | 0.48 |
PF02817 | E3_binding | 0.48 |
PF13340 | DUF4096 | 0.48 |
PF07690 | MFS_1 | 0.48 |
PF12844 | HTH_19 | 0.48 |
PF13544 | Obsolete Pfam Family | 0.48 |
PF13437 | HlyD_3 | 0.48 |
PF02899 | Phage_int_SAM_1 | 0.48 |
PF13378 | MR_MLE_C | 0.48 |
PF01527 | HTH_Tnp_1 | 0.48 |
PF01370 | Epimerase | 0.48 |
PF13365 | Trypsin_2 | 0.48 |
PF01627 | Hpt | 0.48 |
PF00501 | AMP-binding | 0.48 |
PF14226 | DIOX_N | 0.48 |
PF04392 | ABC_sub_bind | 0.48 |
PF05239 | PRC | 0.48 |
PF10691 | DUF2497 | 0.48 |
PF07859 | Abhydrolase_3 | 0.48 |
PF00155 | Aminotran_1_2 | 0.48 |
PF00440 | TetR_N | 0.48 |
PF13467 | RHH_4 | 0.48 |
PF13586 | DDE_Tnp_1_2 | 0.48 |
PF00027 | cNMP_binding | 0.48 |
PF07992 | Pyr_redox_2 | 0.48 |
PF13565 | HTH_32 | 0.48 |
PF01717 | Meth_synt_2 | 0.48 |
PF12706 | Lactamase_B_2 | 0.48 |
PF00589 | Phage_integrase | 0.48 |
COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
---|---|---|---|
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 6.73 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.44 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.96 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.48 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.48 |
COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.48 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.48 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.48 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.48 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.48 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.48 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.48 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.48 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.48 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.13 % |
Unclassified | root | N/A | 15.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100216268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101547887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
3300001686|C688J18823_10197894 | Not Available | 1357 | Open in IMG/M |
3300001686|C688J18823_10940652 | Not Available | 548 | Open in IMG/M |
3300002568|C688J35102_118939752 | Not Available | 616 | Open in IMG/M |
3300002568|C688J35102_120920592 | Not Available | 2351 | Open in IMG/M |
3300004081|Ga0063454_101948556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
3300005167|Ga0066672_10140127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1510 | Open in IMG/M |
3300005175|Ga0066673_10345438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 869 | Open in IMG/M |
3300005176|Ga0066679_11054588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
3300005177|Ga0066690_10318690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1052 | Open in IMG/M |
3300005184|Ga0066671_11069376 | Not Available | 505 | Open in IMG/M |
3300005187|Ga0066675_10275626 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300005331|Ga0070670_100109203 | Not Available | 2384 | Open in IMG/M |
3300005332|Ga0066388_102961916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
3300005332|Ga0066388_103595035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
3300005353|Ga0070669_101364614 | Not Available | 615 | Open in IMG/M |
3300005435|Ga0070714_100795690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 915 | Open in IMG/M |
3300005436|Ga0070713_100704647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
3300005441|Ga0070700_101515399 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005454|Ga0066687_10188951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
3300005455|Ga0070663_101928516 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300005457|Ga0070662_100335531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1236 | Open in IMG/M |
3300005533|Ga0070734_10328774 | Not Available | 873 | Open in IMG/M |
3300005536|Ga0070697_101024975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 734 | Open in IMG/M |
3300005544|Ga0070686_101385826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300005557|Ga0066704_10124888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1710 | Open in IMG/M |
3300005575|Ga0066702_10302853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 975 | Open in IMG/M |
3300005575|Ga0066702_10675086 | Not Available | 617 | Open in IMG/M |
3300005576|Ga0066708_10572334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
3300005577|Ga0068857_102187695 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005602|Ga0070762_10586398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
3300005614|Ga0068856_102357464 | Not Available | 540 | Open in IMG/M |
3300005618|Ga0068864_102592381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300005764|Ga0066903_109107524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300005903|Ga0075279_10043952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
3300005921|Ga0070766_10187056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1289 | Open in IMG/M |
3300005921|Ga0070766_10277481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1070 | Open in IMG/M |
3300006028|Ga0070717_10675658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 938 | Open in IMG/M |
3300006031|Ga0066651_10331871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
3300006031|Ga0066651_10701457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
3300006046|Ga0066652_100363556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1307 | Open in IMG/M |
3300006046|Ga0066652_100407727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1240 | Open in IMG/M |
3300006046|Ga0066652_101824821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
3300006175|Ga0070712_100459985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1061 | Open in IMG/M |
3300006176|Ga0070765_100590899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1046 | Open in IMG/M |
3300006800|Ga0066660_10655724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 870 | Open in IMG/M |
3300006806|Ga0079220_10321493 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300006806|Ga0079220_10934204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300006854|Ga0075425_101860649 | Not Available | 675 | Open in IMG/M |
3300009038|Ga0099829_11263496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
3300009094|Ga0111539_10614141 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
3300009137|Ga0066709_101070365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1184 | Open in IMG/M |
3300009137|Ga0066709_101971263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
3300009137|Ga0066709_103951019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300009143|Ga0099792_10530209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
3300009792|Ga0126374_10088910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1716 | Open in IMG/M |
3300010041|Ga0126312_10722438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
3300010041|Ga0126312_11426448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300010043|Ga0126380_10950544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
3300010044|Ga0126310_11207215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 607 | Open in IMG/M |
3300010045|Ga0126311_11592787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300010045|Ga0126311_11928806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300010046|Ga0126384_11522979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
3300010046|Ga0126384_11531228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
3300010326|Ga0134065_10198329 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300010358|Ga0126370_12326040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300010358|Ga0126370_12395482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
3300010360|Ga0126372_11862021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
3300010361|Ga0126378_10079466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3172 | Open in IMG/M |
3300010361|Ga0126378_11801657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
3300010362|Ga0126377_10237265 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300010362|Ga0126377_12276035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
3300010376|Ga0126381_104090169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
3300010376|Ga0126381_104606179 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300010396|Ga0134126_11304229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 804 | Open in IMG/M |
3300010397|Ga0134124_11087173 | Not Available | 816 | Open in IMG/M |
3300010880|Ga0126350_10825435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 845 | Open in IMG/M |
3300011119|Ga0105246_12418984 | Not Available | 515 | Open in IMG/M |
3300011120|Ga0150983_16640679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
3300011269|Ga0137392_10075693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2602 | Open in IMG/M |
3300012189|Ga0137388_11309849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
3300012198|Ga0137364_10029672 | All Organisms → cellular organisms → Bacteria | 3477 | Open in IMG/M |
3300012198|Ga0137364_10293752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1417 | 1206 | Open in IMG/M |
3300012200|Ga0137382_10001274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 11052 | Open in IMG/M |
3300012202|Ga0137363_10759357 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300012203|Ga0137399_11465454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
3300012205|Ga0137362_11072485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
3300012205|Ga0137362_11409125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
3300012206|Ga0137380_11543888 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012208|Ga0137376_10079086 | All Organisms → cellular organisms → Bacteria | 2753 | Open in IMG/M |
3300012208|Ga0137376_10231867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1600 | Open in IMG/M |
3300012212|Ga0150985_100640276 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
3300012212|Ga0150985_101057970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
3300012212|Ga0150985_105383623 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300012212|Ga0150985_106647766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
3300012285|Ga0137370_10169600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1270 | Open in IMG/M |
3300012285|Ga0137370_10978851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1417 | 521 | Open in IMG/M |
3300012349|Ga0137387_10973743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300012362|Ga0137361_11702516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
3300012375|Ga0134034_1129452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
3300012469|Ga0150984_103271575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1691 | Open in IMG/M |
3300012469|Ga0150984_107530273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1461 | Open in IMG/M |
3300012469|Ga0150984_110841008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
3300012469|Ga0150984_115050320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 901 | Open in IMG/M |
3300012469|Ga0150984_116298068 | Not Available | 890 | Open in IMG/M |
3300012469|Ga0150984_123461871 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300012917|Ga0137395_10371282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1021 | Open in IMG/M |
3300012927|Ga0137416_11173650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
3300012960|Ga0164301_11008034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300012961|Ga0164302_11157438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300012986|Ga0164304_10953599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
3300013306|Ga0163162_13062215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300014157|Ga0134078_10024891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1920 | Open in IMG/M |
3300014157|Ga0134078_10249144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
3300014325|Ga0163163_10657530 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300014325|Ga0163163_12418033 | Not Available | 584 | Open in IMG/M |
3300014501|Ga0182024_10068958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 5374 | Open in IMG/M |
3300014654|Ga0181525_10171498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1187 | Open in IMG/M |
3300014968|Ga0157379_12139749 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300015053|Ga0137405_1340608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4950 | Open in IMG/M |
3300015245|Ga0137409_10931838 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300015373|Ga0132257_100934040 | Not Available | 1089 | Open in IMG/M |
3300015373|Ga0132257_101933668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
3300015373|Ga0132257_102831106 | Not Available | 632 | Open in IMG/M |
3300015374|Ga0132255_103112272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
3300015374|Ga0132255_103839886 | Not Available | 638 | Open in IMG/M |
3300015374|Ga0132255_105804939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
3300016294|Ga0182041_10772767 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300016404|Ga0182037_10348133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1206 | Open in IMG/M |
3300018071|Ga0184618_10138714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae → Afipia broomeae ATCC 49717 | 986 | Open in IMG/M |
3300018431|Ga0066655_10939354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
3300018431|Ga0066655_11122185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
3300018433|Ga0066667_11706404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
3300018433|Ga0066667_11811978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
3300018433|Ga0066667_11912178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300018468|Ga0066662_10075180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2283 | Open in IMG/M |
3300018468|Ga0066662_10950130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
3300018476|Ga0190274_10737688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1034 | Open in IMG/M |
3300019789|Ga0137408_1437257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1225 | Open in IMG/M |
3300019888|Ga0193751_1006688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6340 | Open in IMG/M |
3300020579|Ga0210407_11254228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300020582|Ga0210395_10133312 | Not Available | 1849 | Open in IMG/M |
3300020583|Ga0210401_10291663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1492 | Open in IMG/M |
3300020583|Ga0210401_11256973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
3300020583|Ga0210401_11389711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300021180|Ga0210396_10717418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
3300021181|Ga0210388_10078456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2798 | Open in IMG/M |
3300021407|Ga0210383_11673311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
3300021432|Ga0210384_10274092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1519 | Open in IMG/M |
3300021432|Ga0210384_10579206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1009 | Open in IMG/M |
3300021560|Ga0126371_11327129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 852 | Open in IMG/M |
3300021560|Ga0126371_12361062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
3300021560|Ga0126371_13404524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300022756|Ga0222622_10668771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
3300022756|Ga0222622_11395283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300024179|Ga0247695_1035652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
3300025907|Ga0207645_11050419 | Not Available | 550 | Open in IMG/M |
3300025915|Ga0207693_10128998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1988 | Open in IMG/M |
3300025915|Ga0207693_11164960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
3300025922|Ga0207646_11732673 | Not Available | 536 | Open in IMG/M |
3300025922|Ga0207646_11831023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
3300025923|Ga0207681_10766893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 805 | Open in IMG/M |
3300025925|Ga0207650_11364708 | Not Available | 603 | Open in IMG/M |
3300025929|Ga0207664_10420350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1191 | Open in IMG/M |
3300025930|Ga0207701_10649329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
3300025931|Ga0207644_10514200 | Not Available | 989 | Open in IMG/M |
3300025936|Ga0207670_11716355 | Not Available | 534 | Open in IMG/M |
3300025940|Ga0207691_10932874 | Not Available | 726 | Open in IMG/M |
3300025989|Ga0207998_1013350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
3300026067|Ga0207678_11964306 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300026304|Ga0209240_1099227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1045 | Open in IMG/M |
3300026324|Ga0209470_1280056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
3300026325|Ga0209152_10090236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1141 | Open in IMG/M |
3300026548|Ga0209161_10264205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
3300026557|Ga0179587_11036841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
3300026557|Ga0179587_11101081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300027565|Ga0209219_1070897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
3300027565|Ga0209219_1161111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300027591|Ga0209733_1147762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
3300027603|Ga0209331_1086033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 776 | Open in IMG/M |
3300027825|Ga0209039_10097820 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 1262 | Open in IMG/M |
3300027903|Ga0209488_10270678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1271 | Open in IMG/M |
3300028047|Ga0209526_10090348 | Not Available | 2156 | Open in IMG/M |
3300028047|Ga0209526_10773772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
3300028381|Ga0268264_11296149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
3300029943|Ga0311340_10545055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1026 | Open in IMG/M |
3300031091|Ga0308201_10309444 | Not Available | 565 | Open in IMG/M |
3300031446|Ga0170820_10102762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
3300031561|Ga0318528_10814228 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300031740|Ga0307468_100806020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 801 | Open in IMG/M |
3300031754|Ga0307475_10691190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 814 | Open in IMG/M |
3300031782|Ga0318552_10267830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 867 | Open in IMG/M |
3300031793|Ga0318548_10053548 | Not Available | 1850 | Open in IMG/M |
3300031823|Ga0307478_11060901 | Not Available | 676 | Open in IMG/M |
3300031859|Ga0318527_10225498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
3300031941|Ga0310912_10053327 | All Organisms → cellular organisms → Bacteria | 2849 | Open in IMG/M |
3300031947|Ga0310909_10185003 | Not Available | 1726 | Open in IMG/M |
3300031954|Ga0306926_11404933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
3300031965|Ga0326597_10351570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1656 | Open in IMG/M |
3300032064|Ga0318510_10422465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
3300032091|Ga0318577_10180877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1007 | Open in IMG/M |
3300032770|Ga0335085_11754634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
3300032895|Ga0335074_10051433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5669 | Open in IMG/M |
3300032954|Ga0335083_11409729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.37% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.37% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.88% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.88% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.40% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.44% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.44% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.48% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.48% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.48% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.48% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025989 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1002162682 | 3300000364 | Soil | LWKGRAAIFRREVGDGEHAEVVIEGRVYRVRIVELS* |
INPhiseqgaiiFebDRAFT_1015478872 | 3300000364 | Soil | MSWKGRAGTFQRETGDGTHAEVTIEGRVYRVRISELI* |
C688J18823_101978945 | 3300001686 | Soil | RDRAGTYRRDTGDGEHVEIVIAERVYRVRRAELRQG* |
C688J18823_109406521 | 3300001686 | Soil | DKVSWQGRAGVFRRDIGDGEHAEVVIGERVYRVRNAELG* |
C688J35102_1189397522 | 3300002568 | Soil | MTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHVEVTIGERVYRVKSAELG* |
C688J35102_1209205924 | 3300002568 | Soil | MRLTPTWRAGDNIRWQGRPAVYRRDVGDGQHAEIVIGERIYRVRSKEFG* |
Ga0063454_1019485561 | 3300004081 | Soil | MTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHAEVTIGER |
Ga0066672_101401271 | 3300005167 | Soil | PVWRASMPVLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVRIGELR* |
Ga0066673_103454383 | 3300005175 | Soil | ASMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIEELA* |
Ga0066679_110545881 | 3300005176 | Soil | VSPDKKVMPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVRTSELS* |
Ga0066690_103186901 | 3300005177 | Soil | TWRAGEVVRWKNRTGIFRREVGDGEHAEVVIAERVYRVRIGELS* |
Ga0066671_110693762 | 3300005184 | Soil | AARPIEIPRQPGDRVRWRDRAGTYRRDTGDGEHVEIVIAERVYRVRRAELRQG* |
Ga0066675_102756262 | 3300005187 | Soil | MPARISPIWRAGEAVRWKGRAGVFRRVVDDGEHAEIVIAERVYRVRIGELS* |
Ga0070670_1001092034 | 3300005331 | Switchgrass Rhizosphere | LKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVSRGELRAG* |
Ga0066388_1029619161 | 3300005332 | Tropical Forest Soil | DRVKWRDRVGLYRRDVDDEHGEVVLDERLYRVRKSELRPG* |
Ga0066388_1035950351 | 3300005332 | Tropical Forest Soil | MPVIWKGRAAIFRREVGDGEHAEVLIDERVYRVRMSELR* |
Ga0070669_1013646142 | 3300005353 | Switchgrass Rhizosphere | SRLKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVSRGELRAG* |
Ga0070675_1019466001 | 3300005354 | Miscanthus Rhizosphere | GASVRWQNRDGVFHRDVGDGEHAEIIIGERTYRVRMRDLV* |
Ga0070714_1007956902 | 3300005435 | Agricultural Soil | MPVLWKGRAAVFRREVGDGEHAEILVDGRIYRVRISELR*SAI |
Ga0070713_1007046471 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVLWKGRAAVFRRDVGDGEHAEILIDGRIYGVPISELR* |
Ga0070700_1015153991 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | EATPIRITPTYRTGDPVWWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA* |
Ga0066687_101889512 | 3300005454 | Soil | ITPTWRRGDQVRWKDRAGVFRRDVGDGEHAEVTIGERVYRVRMAELA* |
Ga0070663_1019285161 | 3300005455 | Corn Rhizosphere | IRITPTYRTGDPVLWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA* |
Ga0070662_1003355314 | 3300005457 | Corn Rhizosphere | VRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG* |
Ga0070734_103287741 | 3300005533 | Surface Soil | RIRPIWRPGDQVSYQGRTGTFRRDTGDGEHVEIVIGERVYRVRSNDLS* |
Ga0070697_1010249752 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRLSELA* |
Ga0070686_1013858262 | 3300005544 | Switchgrass Rhizosphere | VEIEAPWHPGNRVRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG* |
Ga0066704_101248881 | 3300005557 | Soil | WRASMPVLWKGRAGIFRRDVGDGEHAEIVIDGRIYRVRIEELR* |
Ga0066702_103028532 | 3300005575 | Soil | MPARISPTWRAGEAVHWKGRAGVFRRVVDDGEHAEIVIAERVYRVRIGELS* |
Ga0066702_106750861 | 3300005575 | Soil | GDRVRWRDRAGTYRRDTGDREHVEIVIAERVYRVRRPELRQG* |
Ga0066708_105723341 | 3300005576 | Soil | VGSAPAKIGPVWQASMPVLWKGRAGVFRRDVGDGENAEVVIDGRVYRVRFSELR* |
Ga0068857_1021876952 | 3300005577 | Corn Rhizosphere | WKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA* |
Ga0070762_105863982 | 3300005602 | Soil | MAPTWRAGDPVRCKGRAGVFRRDVGDGVHAEIVIGERVYRVRIGELG* |
Ga0068856_1023574641 | 3300005614 | Corn Rhizosphere | VRWRDRGGTYRRDVDDGEHVEILIAERVYRVRRAELRPG* |
Ga0068864_1025923812 | 3300005618 | Switchgrass Rhizosphere | RVRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG* |
Ga0066903_1091075242 | 3300005764 | Tropical Forest Soil | MAPVWKSGDAVRWSGRNGTFRCDVGDGEHAEITLAERIYR |
Ga0075279_100439523 | 3300005903 | Rice Paddy Soil | VRWKGRGGTFRRDVGDGEHAEIALAERIYRVRVSELG* |
Ga0070766_101870564 | 3300005921 | Soil | GDPVRCKGRAGVFRRDVGDGVHAEIVIGERVYRVRIGELG* |
Ga0070766_102774811 | 3300005921 | Soil | VRWKGRAGVFARDVGDGEHAEIVIAERVYRVRIGELS* |
Ga0070717_106756581 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VWRASMPVLWKGRAAVFRRDVGDGEHAEILIDGRIYRVRISELR* |
Ga0066651_103318711 | 3300006031 | Soil | LWKGRAGIFRRDVGDGEHAEVVIEGRVYRVLIGELR* |
Ga0066651_107014571 | 3300006031 | Soil | LWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIEELA* |
Ga0066652_1003635564 | 3300006046 | Soil | WKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIGELS* |
Ga0066652_1004077272 | 3300006046 | Soil | MPVLWKGRAGIFRRDVGDGEHAEVVIEGRIYRVRMSELA* |
Ga0066652_1018248213 | 3300006046 | Soil | SVLAKVRIGIFRRDVGDGEHAQVVIDGRVYRVGIEELA* |
Ga0070712_1004599853 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPDKKAMPIWRASMPVLWKGRAGIFRRDVGDGEKAEVVIEGRVSRVRIGELR* |
Ga0070765_1005908992 | 3300006176 | Soil | VPAKISPTWRAGDAVRWKDRTGVFRRDVGDGEHAEIGIAERVYRVRIGELS* |
Ga0066660_106557241 | 3300006800 | Soil | KGRAGIFRRDVGDGEHAEVVLDGPVYRVRIGELR* |
Ga0079220_103214931 | 3300006806 | Agricultural Soil | SWNPGESLFWKGRAGIFRRDVGDGEHAEIIIAERTYRVPISELT* |
Ga0079220_109342041 | 3300006806 | Agricultural Soil | VRWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA* |
Ga0075425_1018606491 | 3300006854 | Populus Rhizosphere | MPVLWKGRAGIFRRDVRDGEHAKFVIRVSVVRVFETTGWLN* |
Ga0099829_112634963 | 3300009038 | Vadose Zone Soil | ARISPTWRAGEVVRWKGRAGVFRREVGDGEQAEIVIAERVYRVRTSGLR* |
Ga0111539_106141412 | 3300009094 | Populus Rhizosphere | VWWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA* |
Ga0066709_1010703651 | 3300009137 | Grasslands Soil | VSPANAIPVWRASMPVLWKGRARIFRRDVGDGEHAEVVIDGRVYRVQTSELS* |
Ga0066709_1019712632 | 3300009137 | Grasslands Soil | MPVLWKGRAGIVRRDVGDGEHAEVVIEGRVYRVRMGELR* |
Ga0066709_1039510192 | 3300009137 | Grasslands Soil | MPVLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVRIEELA* |
Ga0099792_105302091 | 3300009143 | Vadose Zone Soil | MPVSWSGRAGVFRREVGDGEHAEVLIDGRVYRVHSRELS* |
Ga0126374_100889101 | 3300009792 | Tropical Forest Soil | VLWQGRAGIFRRDVGDGEHAEIVITERIYRVRVEKLG* |
Ga0126312_107224382 | 3300010041 | Serpentine Soil | VRWKDRVGVFRRPVGDDEHAEIVIAERVYRVRISELA* |
Ga0126312_114264481 | 3300010041 | Serpentine Soil | WRAGDQVRWQGRAGVFRRDIGDGEHAEVVIAERVYRVRSSELV* |
Ga0126380_109505441 | 3300010043 | Tropical Forest Soil | VRWQGRAGIFRRDAGDGEHAEILIAGRVYRVRLKDLA* |
Ga0126310_112072151 | 3300010044 | Serpentine Soil | VRWKDRAGVFRRAVGDDDEHAEIVIAERVYRVRTSELA* |
Ga0126311_115927871 | 3300010045 | Serpentine Soil | QGRVGTFRRDVGDGEHAEVAIGERVYRVRTSELG* |
Ga0126311_119288062 | 3300010045 | Serpentine Soil | VRWKDRVGVFRRPVGDDEHAEIVIAERVYRVRTSELPSDLA* |
Ga0126384_115229793 | 3300010046 | Tropical Forest Soil | VLWKGRAGIFRREVGDGEHAEVVIEGRVYRVRIADLR* |
Ga0126384_115312281 | 3300010046 | Tropical Forest Soil | RKARRSSPLTARISPSWRAGDGVYWQGRAGIFRRDVGDGEHAEIVIAERVYRVRTTELT* |
Ga0134065_101983291 | 3300010326 | Grasslands Soil | KVSWQGRAGVFRRDVGDGEHAEVVIGERVYRVRSAELG* |
Ga0126370_123260402 | 3300010358 | Tropical Forest Soil | KLTPVWCANMPVLWKDRAAVFRREVGDGEHAEIVLDGRIYRVRISELR* |
Ga0126370_123954823 | 3300010358 | Tropical Forest Soil | GAAKLTPVWRASMPVLWKGRAGIFRRDVADGEHAEILLDGRIYRVRISELR* |
Ga0126372_118620211 | 3300010360 | Tropical Forest Soil | TPVWRASMPVRWKGRAGIFRREVGDGEHAEVVIEGRVYRVRIAELH* |
Ga0126378_100794663 | 3300010361 | Tropical Forest Soil | VRWHGRAGVFQRDVGDGEHAEIVIAERIYRVRTKELA* |
Ga0126378_118016571 | 3300010361 | Tropical Forest Soil | VRWHGRAGTFRRDIGDGKHAEIVIAERVYRVRVDELA* |
Ga0126377_102372652 | 3300010362 | Tropical Forest Soil | MPVLWKGRAGIFRREVGDGEHAEIVLDGRIYRVRISELA* |
Ga0126377_122760352 | 3300010362 | Tropical Forest Soil | MAPVWKSGDAVRGSGRAGTFRRDVGDGEHAEITLAERIYRVRLSELG* |
Ga0126381_1040901692 | 3300010376 | Tropical Forest Soil | MAPVWKSGDAVRWSGRNGTFRCDVCDGEHAEITLAERIYRVRLSELG* |
Ga0126381_1046061792 | 3300010376 | Tropical Forest Soil | WRASMPVLWKERAAVFRRDVGDGEHAEILVDGRIYRVRISSTGK* |
Ga0134126_113042291 | 3300010396 | Terrestrial Soil | MPVLWKGRAGIFRRDVGDGEHAEVVVEGRVYRVRIGELS* |
Ga0134124_110871731 | 3300010397 | Terrestrial Soil | VRWRDRTGTYRRDAGDGEHVEIVIAERVYRVRRSELLPG* |
Ga0126350_108254351 | 3300010880 | Boreal Forest Soil | VVHWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELGWAPKS* |
Ga0105246_124189842 | 3300011119 | Miscanthus Rhizosphere | LVWKPGDAVRWKGRSGTFRCDVGDGEHAEIALAERIYRVRLSELG* |
Ga0150983_166406792 | 3300011120 | Forest Soil | AGGPVRWQGRAGIFRRDVGDGVHVEIVIAERVYRVRTAELS* |
Ga0137392_100756932 | 3300011269 | Vadose Zone Soil | VVRWKGRAGVFRREVGDGEQAEIVIAERVYRVRTSGLR* |
Ga0137388_113098493 | 3300012189 | Vadose Zone Soil | VRWKGRAGVFRREVGDGDQAEIVIAERVYRVRTSGLR* |
Ga0137364_100296726 | 3300012198 | Vadose Zone Soil | MPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEGLC* |
Ga0137364_102937521 | 3300012198 | Vadose Zone Soil | RAANAAKAVPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIGELG* |
Ga0137382_1000127410 | 3300012200 | Vadose Zone Soil | MPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEELC* |
Ga0137363_107593572 | 3300012202 | Vadose Zone Soil | VRWQGRAGIFRRDVGDGEHAEIAIAERVYRVRINELA* |
Ga0137399_114654541 | 3300012203 | Vadose Zone Soil | MPVLWKGRAGVFRREVGDGEHAEVLIDGRVYRVRLSELD* |
Ga0137362_110724851 | 3300012205 | Vadose Zone Soil | VSLSAKLTPVWRASMPVLWKGRAGMFRRDVGDGEHAEVAIDRRIYRVRLTELG* |
Ga0137362_114091251 | 3300012205 | Vadose Zone Soil | VLWKGRAGIFRREVGDGEHAEVVIEGRVYRVRIEELA* |
Ga0137380_115438882 | 3300012206 | Vadose Zone Soil | ARISPTWNAGDTVHWKNRAGTFRRDVGDGEHAEIVIGVRVYRVRTAELR* |
Ga0137376_100790861 | 3300012208 | Vadose Zone Soil | MPVWRASMPVLWKGRAGIFRRDVGDGEHAEVAIDGRVYRVRIGELG* |
Ga0137376_102318671 | 3300012208 | Vadose Zone Soil | SMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRIGELS* |
Ga0150985_1006402763 | 3300012212 | Avena Fatua Rhizosphere | VRWKDRAGLFRREIGDGEHAEIAIGERIYRVRIAELT* |
Ga0150985_1010579701 | 3300012212 | Avena Fatua Rhizosphere | VRWKDRAGLFHREIGDGEYAEITIGERIYRVRIAELV* |
Ga0150985_1053836233 | 3300012212 | Avena Fatua Rhizosphere | MTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHAEVTIGERVYRVKSAELG* |
Ga0150985_1066477662 | 3300012212 | Avena Fatua Rhizosphere | MTARIAPSWRAGDQVRWQGRMGTFRRDVGDGEHAEVMIGERVYRVKSAELG* |
Ga0137370_101696002 | 3300012285 | Vadose Zone Soil | MPVLWKGRAAVFRREVGDGEHAEILVDGRIYRVRISELR* |
Ga0137370_109788511 | 3300012285 | Vadose Zone Soil | SMPVLWKGRAGIFRRDVGDGEHAEVAIDGRVYRVRIGQLG* |
Ga0137387_109737431 | 3300012349 | Vadose Zone Soil | ISPTWNAGDTVHWKNRAGTFRRDVGDGEHAEIVIGVRVYRVRTAELR* |
Ga0137361_117025161 | 3300012362 | Vadose Zone Soil | SPRWRADDRVRWQGRAGIFRRDVGDGEYAEIVIAERVYRVRIKELA* |
Ga0134034_11294523 | 3300012375 | Grasslands Soil | MTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHAEVMIGERVYRVKSAELG |
Ga0150984_1032715754 | 3300012469 | Avena Fatua Rhizosphere | LAAWRPGDRVRWRDRAGIYRRDGGDGEHVEIVIAERVYRVRRAELLPG* |
Ga0150984_1075302733 | 3300012469 | Avena Fatua Rhizosphere | VRWKDRAGQFRREIGDGEHAEIAIGERIYRVRIAELV* |
Ga0150984_1108410081 | 3300012469 | Avena Fatua Rhizosphere | PGESLFWKGRAGIFRRDVGDGEHAEIVIAERTYRVQISELT* |
Ga0150984_1150503203 | 3300012469 | Avena Fatua Rhizosphere | KWKDRTGLFCREVGDNEHAEIAIAERVYRVKLSELG* |
Ga0150984_1162980681 | 3300012469 | Avena Fatua Rhizosphere | WKDRTGLFRREVGDNEHAEIAIAERVYRVKLSDLG* |
Ga0150984_1234618712 | 3300012469 | Avena Fatua Rhizosphere | VLWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA* |
Ga0137395_103712821 | 3300012917 | Vadose Zone Soil | PLWRASMPVLWKGRARVFRRDVGDGEHAEVVIEGRVYRVPIGELT* |
Ga0137413_111760311 | 3300012924 | Vadose Zone Soil | QDRIGVFRRDVGDGEHAEIVIADRIYRVRVGDLA* |
Ga0137416_111736501 | 3300012927 | Vadose Zone Soil | ASMPVLWKGRAGVFRREVGDGEHAEVLIDGRVYRVRLSEIA* |
Ga0164301_110080342 | 3300012960 | Soil | VRWQDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG* |
Ga0164302_111574382 | 3300012961 | Soil | MLVWRASMPVLWKGRAGIFRRDVGDGEKAGVVIEGRISRVRIGELR* |
Ga0164304_109535992 | 3300012986 | Soil | MPVLWKGRAGIFRRDVGDGEKAEVVIEGRVSRVRIGELR* |
Ga0163162_130622152 | 3300013306 | Switchgrass Rhizosphere | SWHPGSRVCWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPG* |
Ga0134078_100248911 | 3300014157 | Grasslands Soil | GIWKDHAGIFRRDVGDGERDEVVIDGRTYRVRTSELT* |
Ga0134078_102491442 | 3300014157 | Grasslands Soil | MPVSWKGRAGIFRRDVGDGEHAEVAIEGRVYRVRIGELS* |
Ga0163163_106575302 | 3300014325 | Switchgrass Rhizosphere | VRWKDRAGLFRREIGDGEHAEITIGERIYRVRIAELV* |
Ga0163163_124180331 | 3300014325 | Switchgrass Rhizosphere | LKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRV |
Ga0182024_100689582 | 3300014501 | Permafrost | VKWKGRDGTYRRDVGDGEHAEIVIGPRVYRVRLTELR* |
Ga0181525_101714981 | 3300014654 | Bog | VQWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELG* |
Ga0157379_121397492 | 3300014968 | Switchgrass Rhizosphere | VRWRDRAGTYRRDAGDGEHVEIVIAERVYRVRRSELLPG* |
Ga0137405_13406083 | 3300015053 | Vadose Zone Soil | MPVLWKGRAGIFRRDIGDGEHAEVVIDGRVYRVRLRELSYAPR* |
Ga0137409_109318382 | 3300015245 | Vadose Zone Soil | HWKNRAGTFRRDVGDGEHAEIVIGVRVYRVRTAELR* |
Ga0132257_1009340402 | 3300015373 | Arabidopsis Rhizosphere | LKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVRRAELRPG* |
Ga0132257_1019336681 | 3300015373 | Arabidopsis Rhizosphere | VRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRSELLPR* |
Ga0132257_1028311062 | 3300015373 | Arabidopsis Rhizosphere | SIEIIQSRASGTYRRDAGDGEHVEIVIAERVYRIRRGELRPG* |
Ga0132255_1031122721 | 3300015374 | Arabidopsis Rhizosphere | VVWRPGDQVRWKERSGVFRRDVGDGEHAEIMLGERTYRVRTSELS* |
Ga0132255_1038398862 | 3300015374 | Arabidopsis Rhizosphere | KAPWHPGERVRWRDRAGTYRRDVGDEEHVEIVIAERVYRVRRGELRPG* |
Ga0132255_1058049391 | 3300015374 | Arabidopsis Rhizosphere | RNVGPGTRKISPAWRASMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRVRLNELA* |
Ga0182041_107727671 | 3300016294 | Soil | SQRKTRRASPVTSRVTPSWRAGDGVRWQHRAGIFRRDVGDDEHAEIVIGERVYRVRISEL |
Ga0182037_103481331 | 3300016404 | Soil | RRAPPVTSRISPSWRAGEGVRWQGRAGIFRRDVGDGEHAEIVIAERVYRVRIKELA |
Ga0184618_101387142 | 3300018071 | Groundwater Sediment | VRWKGRAGVFRRDVGDGEHAEIVIAERVYRVRTGELG |
Ga0066655_109393542 | 3300018431 | Grasslands Soil | MTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHAEVTIGERVYRVKSAELG |
Ga0066655_111221852 | 3300018431 | Grasslands Soil | MLVWRASMPVLWKGRAGIFRRDVGDGEKAEVVIEGRVSRVRIGELR |
Ga0066667_117064041 | 3300018433 | Grasslands Soil | WKGRAGIFRGDVGDGEHAEVVIEGRMYRVRMSELA |
Ga0066667_118119781 | 3300018433 | Grasslands Soil | MTARIAPTWRAGDQVRWQGRMGTFRRDVGDGEHVEVTIGERVYRVKSAELG |
Ga0066667_119121782 | 3300018433 | Grasslands Soil | MPVLWKGRAGVFRRDIGDGEHAEVVIGERVYRVRNAELG |
Ga0066662_100751804 | 3300018468 | Grasslands Soil | MPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEELC |
Ga0066662_109501301 | 3300018468 | Grasslands Soil | MAAATGIPVWRASIPVLWKGRAGIFRREVGDGEHGEIVIDGRVYPGAE |
Ga0190274_107376883 | 3300018476 | Soil | LWRVGDPVKWQGRDGAYRRDVGDGEHSEIVIGQRVYRVRTKEIG |
Ga0137408_14372571 | 3300019789 | Vadose Zone Soil | LSWGPGDPVKWKRRPGIFRREVGDGEHAEIVIGERVYRVPINELG |
Ga0193751_10066886 | 3300019888 | Soil | SPAAKAAPLWRASMPVLWKGRAGIFRRDVGDGEHAEVVIEGRIYRVRIGELQ |
Ga0210407_112542281 | 3300020579 | Soil | PTWRAGDAVRWKGRAGVYRRDVGDGDHAEIVIAERVYRVRIGELS |
Ga0210395_101333124 | 3300020582 | Soil | VVQWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELG |
Ga0210401_102916631 | 3300020583 | Soil | VRWKGRAGVFRREVGDAEHAEIVIAERVYRVRTSELG |
Ga0210401_112569731 | 3300020583 | Soil | PGRISPTWRVGEPVRWKGRAGVFRRDVGDGEHAEIVVAERVYRVRISELG |
Ga0210401_113897111 | 3300020583 | Soil | PGRISPTWRVGEPVRWKGRAGVFRRDVGDGEHAEIGIAERVYRVRIGELS |
Ga0210396_107174182 | 3300021180 | Soil | SPTWRVGEPVRWKGRAGVFRRDVGDGEHAEIGIAERVYRVRIGELS |
Ga0210388_100784563 | 3300021181 | Soil | VVQWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLNELV |
Ga0210383_116733112 | 3300021407 | Soil | VWKSGDAVHWSGRAGTFRRDVGDGEHAEITLAERIYRVRLSELG |
Ga0210384_102740921 | 3300021432 | Soil | AGSVPGRISPTWRVGEPVRWKGRAGVFRRDVGDGEHAEIVVAERVYRVRISELG |
Ga0210384_105792061 | 3300021432 | Soil | SPIWRAGDPVRWKSREGIFRREVGDGEHAEIVIAERVYRVRTSELGRSGAPARKEIG |
Ga0126371_113271291 | 3300021560 | Tropical Forest Soil | VRWHGRVGIFRRDVGDGEHAEIAIAERVYRVRVNELA |
Ga0126371_123610621 | 3300021560 | Tropical Forest Soil | SMPVLWRGRAGIFRREVGDGEHAEVVIEGRVYRVRIAELH |
Ga0126371_134045241 | 3300021560 | Tropical Forest Soil | GDGVSWQGRAGIFRRDVGDGEHAEIAIAERVYRVRTTELV |
Ga0222622_106687713 | 3300022756 | Groundwater Sediment | PEKASPVWRASMPVLWKGRAGIFRRDAGDGEHAEVVLDGRVYRVRISELS |
Ga0222622_113952831 | 3300022756 | Groundwater Sediment | MPVWRASMPVLWKGRAGIFRRDAGDGEHAEVVLDGRVYRVRISE |
Ga0247695_10356521 | 3300024179 | Soil | HPGNRVRWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRAG |
Ga0207645_110504191 | 3300025907 | Miscanthus Rhizosphere | CPGARRWGARDRAGNYRRDAGDGERAEIVIAERVYRVRRAEPRPG |
Ga0207693_101289986 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIWRASMPVLWKGRAGIFRRDVGDGEHAEVVIEGRVYRVRIGELR |
Ga0207693_111649601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ATKAIPVWRASMPVLWKGRVGIFRRDVGDGEHAEVVIEGRVYRVRIGELR |
Ga0207646_117326732 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTRITPQWRFGDRVRWQDRAGLFRRDLGDENAEITIANRVYRVRIADLRPG |
Ga0207646_118310231 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LPARINPTWRAGEAVRWKDRTGVFRRDVGDGEHAEIGIAER |
Ga0207681_107668932 | 3300025923 | Switchgrass Rhizosphere | VWWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA |
Ga0207650_113647081 | 3300025925 | Switchgrass Rhizosphere | LKFRGAGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVSRGELRAG |
Ga0207664_104203501 | 3300025929 | Agricultural Soil | ASMPALWKGRAAVFRREVGDGEHAEILVDGRIYRVRISELR |
Ga0207701_106493291 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GDRVRWRDRAGIYRRDAGDGEHVEIVIAERVYRVRRGELLPG |
Ga0207644_105142001 | 3300025931 | Switchgrass Rhizosphere | WRDRAGTYRRDAGDGEHVEIVIAERVYRVRRSELLPG |
Ga0207670_117163551 | 3300025936 | Switchgrass Rhizosphere | AGDRVRWRDRAGTYRRAADDGEHVEIVIAERVYRVSRGELRAG |
Ga0207691_109328742 | 3300025940 | Miscanthus Rhizosphere | RDRAGTYRRDVGDGEHVEIVIAERVYRVRRADLRPG |
Ga0207998_10133503 | 3300025989 | Rice Paddy Soil | VRWKGRGGTFRRDVGDGEHAEIALAERIYRVRVSELG |
Ga0207678_119643062 | 3300026067 | Corn Rhizosphere | PIRITPTYRTGDPVLWKDRAGLFRREIGDGEHAEIAIGERVYRVRIAELA |
Ga0209240_10992271 | 3300026304 | Grasslands Soil | EPARWQGRNGVFRREVGDGEHAEIVIAERIYRVRTRELIPGL |
Ga0209470_12800562 | 3300026324 | Soil | RAVSHHAKAPPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVNDGLVYRIRIEELC |
Ga0209152_100902362 | 3300026325 | Soil | VWRASMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEGLC |
Ga0209161_102642051 | 3300026548 | Soil | AKAPPVWRASMPVLWKGRAGIFRRDVGDGEHAEVVNDGRVYRIRIEELC |
Ga0179587_110368412 | 3300026557 | Vadose Zone Soil | DWRSSMPVLWKGRAGIFRRDVGDGEHAEVVIDGRVYRIRIEGLC |
Ga0179587_111010811 | 3300026557 | Vadose Zone Soil | VRWQGRAGIFRRDVGDGEHAEIAIAERVYRVRINELA |
Ga0209219_10708971 | 3300027565 | Forest Soil | TWRAGDPVRWKGRAGVFRRDVGDGEHAEIVIAERVYRVRTSELG |
Ga0209219_11611112 | 3300027565 | Forest Soil | VLWQGRNGVFRREVGDGEHSEIVIAERVYRVRTRELS |
Ga0209733_11477621 | 3300027591 | Forest Soil | RAFRAGVFRRDFGDGEHAEIVIGERVYRVRAKELS |
Ga0209331_10860331 | 3300027603 | Forest Soil | GEPVQWRGRAGVFRRDVGDGEHAEIVIAERVYRVRTSELG |
Ga0209039_100978202 | 3300027825 | Bog Forest Soil | VRWQGRAGIFRRDVGDGEHAEIVIAERVYRVRIEELA |
Ga0209488_102706784 | 3300027903 | Vadose Zone Soil | RNVGSAPAKISPVWQAGMPVLWKGRAGVFRRDVGDGEHAEVLIDGRVYRVRLSELA |
Ga0209526_100903481 | 3300028047 | Forest Soil | WKGRAGVFRREVGDAEHAEIVIAERVYRVRTSELG |
Ga0209526_107737721 | 3300028047 | Forest Soil | ESRPTTISPTWRTGEAVRWKGRAGVFRRDVGDGEHAEIVIAERVYRVRIGELS |
Ga0268264_112961492 | 3300028381 | Switchgrass Rhizosphere | GSRVCWRDRAGTYRRDVGDGEHVEIVIAERVYRVRRAELRPGRSRGSIT |
Ga0311340_105450554 | 3300029943 | Palsa | AELEANDVVRWKGRSGTFRRDVGDGEHVEIVLADRIYRVRLSELG |
Ga0308201_103094443 | 3300031091 | Soil | VKWKDRTGLFRREVGDNEHAEIAIAERVYRVKLSELG |
Ga0302324_1008360482 | 3300031236 | Palsa | SQRNSRRANAAPARIDPIWRAGDTVRWQGRPGVYRRDVGDGEHAEIMLGERVYRVKVKEL |
Ga0170820_101027621 | 3300031446 | Forest Soil | AKLSPVWSASMPVLWKGRAGVFRRDVGDGVHAEVTIDEGVYRVPIRELA |
Ga0318528_108142282 | 3300031561 | Soil | WQHRAGIFRRDVGDDEHAEIVIGERVYRVRISELG |
Ga0307468_1008060203 | 3300031740 | Hardwood Forest Soil | VPRQLGDRVRWRDRAGTYHRDVGAGEHVEIVIAERVYRVHRAELRPG |
Ga0307475_106911902 | 3300031754 | Hardwood Forest Soil | LTLSPTWRRGDPVRWKDRAGVFRRDVGDGEHAEIVIGERVYRVQTRELG |
Ga0318552_102678302 | 3300031782 | Soil | VRWQHRAGIFRRDVGDDEHAEIVIGERVYRVRISELG |
Ga0318548_100535482 | 3300031793 | Soil | VRWQGRAGIFRRDVGDAEHAEIVIAERVYRVRINELA |
Ga0307478_110609011 | 3300031823 | Hardwood Forest Soil | VRWQSRVGVFRRDVDDGEHAEIVIGERIYRVRARELG |
Ga0318527_102254981 | 3300031859 | Soil | RWRDRIGGFRRDVGDGEHAEIVITGRVYRVRLEELG |
Ga0310912_100533275 | 3300031941 | Soil | SPVTARISPSWRTGDGVSWQGRAGIFRRDVGDGEHAEIAIAERVYRVRTTELA |
Ga0310909_101850033 | 3300031947 | Soil | MSPSWRAGDGVRWQGRDGIFQRDVGDGEHAEIVIANRVYRVGIKELA |
Ga0306926_114049331 | 3300031954 | Soil | VRWQGRAGIFRRDVGDGEHAEIVITERIYRVRVKELA |
Ga0326597_103515701 | 3300031965 | Soil | MSWRVGDHVKWQGRAGVFRRDVGDGEHAEIVIAERVYRVRSKEIE |
Ga0318510_104224651 | 3300032064 | Soil | GVRWQGRAGIFRRDVGDGEHAEIVIAERVYRVRIKELA |
Ga0318577_101808772 | 3300032091 | Soil | VRWRDRIGGFRRDVGDGEHAEIVITGRVYRVRLEELG |
Ga0335085_117546342 | 3300032770 | Soil | WKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELV |
Ga0335074_100514336 | 3300032895 | Soil | VRWKGRGGTFRRDFGDGEHAEIALADRIYRVRVSELG |
Ga0335083_114097291 | 3300032954 | Soil | WKPDDVVQWKGRGGTFRRDVGDGEHVEIVLADRIYRVRLSELV |
⦗Top⦘ |