| Basic Information | |
|---|---|
| Family ID | F023867 |
| Family Type | Metagenome |
| Number of Sequences | 208 |
| Average Sequence Length | 46 residues |
| Representative Sequence | NITVVLARFHGDDLEEPSTDRITIELPPLEEDKTLDDTYEADTEPH |
| Number of Associated Samples | 166 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.48 % |
| % of genes near scaffold ends (potentially truncated) | 99.52 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.635 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.615 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.135 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.22% Coil/Unstructured: 83.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF01957 | NfeD | 72.12 |
| PF01619 | Pro_dh | 13.46 |
| PF07992 | Pyr_redox_2 | 0.96 |
| PF13672 | PP2C_2 | 0.48 |
| PF01642 | MM_CoA_mutase | 0.48 |
| PF00076 | RRM_1 | 0.48 |
| PF14907 | NTP_transf_5 | 0.48 |
| PF00583 | Acetyltransf_1 | 0.48 |
| PF04542 | Sigma70_r2 | 0.48 |
| PF07949 | YbbR | 0.48 |
| PF13646 | HEAT_2 | 0.48 |
| PF00905 | Transpeptidase | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
|---|---|---|---|
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 13.46 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.48 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.48 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.48 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.48 |
| COG4856 | Cyclic di-AMP synthase regulator CdaR, YbbR domain | Signal transduction mechanisms [T] | 0.48 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.63 % |
| Unclassified | root | N/A | 3.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02GGOWR | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 2170459019|G14TP7Y02F7RT9 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10419998 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101791547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300000574|JGI1357J11328_10218270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300000787|JGI11643J11755_11404733 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300000789|JGI1027J11758_11716233 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300000789|JGI1027J11758_11994749 | Not Available | 886 | Open in IMG/M |
| 3300000953|JGI11615J12901_11320906 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300003321|soilH1_10149561 | All Organisms → cellular organisms → Bacteria | 3982 | Open in IMG/M |
| 3300003324|soilH2_10013288 | All Organisms → cellular organisms → Bacteria | 4766 | Open in IMG/M |
| 3300003324|soilH2_10025779 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300004114|Ga0062593_103215177 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300004463|Ga0063356_102815149 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300004480|Ga0062592_100058703 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300004480|Ga0062592_100897729 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300004480|Ga0062592_101123530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300005180|Ga0066685_10866834 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005181|Ga0066678_10315581 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300005184|Ga0066671_10288406 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300005186|Ga0066676_10506599 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005289|Ga0065704_10083236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3491 | Open in IMG/M |
| 3300005328|Ga0070676_11379531 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005330|Ga0070690_100723617 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005335|Ga0070666_10462112 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300005340|Ga0070689_101635923 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005341|Ga0070691_10912162 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005438|Ga0070701_11224946 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005440|Ga0070705_100428285 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005440|Ga0070705_101091461 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005440|Ga0070705_101596657 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005440|Ga0070705_101784003 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005447|Ga0066689_10789201 | Not Available | 591 | Open in IMG/M |
| 3300005459|Ga0068867_101580380 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005467|Ga0070706_101555861 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005518|Ga0070699_101726163 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005540|Ga0066697_10096176 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300005543|Ga0070672_101204010 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005545|Ga0070695_100592875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 869 | Open in IMG/M |
| 3300005545|Ga0070695_100741327 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005545|Ga0070695_100823242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 745 | Open in IMG/M |
| 3300005545|Ga0070695_100850439 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005546|Ga0070696_101754949 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005549|Ga0070704_101051988 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005556|Ga0066707_10929431 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005577|Ga0068857_100543175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 1094 | Open in IMG/M |
| 3300005577|Ga0068857_101373790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 687 | Open in IMG/M |
| 3300005577|Ga0068857_101897479 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005578|Ga0068854_100959328 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005586|Ga0066691_10665662 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005616|Ga0068852_101531964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 689 | Open in IMG/M |
| 3300005618|Ga0068864_102655972 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005834|Ga0068851_10980329 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005842|Ga0068858_100390534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 1336 | Open in IMG/M |
| 3300005842|Ga0068858_101095349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 782 | Open in IMG/M |
| 3300005843|Ga0068860_101705780 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005843|Ga0068860_101786133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 637 | Open in IMG/M |
| 3300005844|Ga0068862_100343505 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300005985|Ga0081539_10349377 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006046|Ga0066652_101302966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 685 | Open in IMG/M |
| 3300006358|Ga0068871_100087191 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300006755|Ga0079222_11083515 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300006844|Ga0075428_100533231 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300006876|Ga0079217_10209515 | Not Available | 1004 | Open in IMG/M |
| 3300006880|Ga0075429_100600069 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300006880|Ga0075429_100621309 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300006894|Ga0079215_11123535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 591 | Open in IMG/M |
| 3300006904|Ga0075424_101460542 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300006904|Ga0075424_102848226 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006954|Ga0079219_10437025 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300007265|Ga0099794_10201092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1020 | Open in IMG/M |
| 3300007265|Ga0099794_10468507 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300007265|Ga0099794_10669935 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009012|Ga0066710_102942279 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300009012|Ga0066710_104792217 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009078|Ga0105106_10162212 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300009090|Ga0099827_10943802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 748 | Open in IMG/M |
| 3300009094|Ga0111539_11113535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 917 | Open in IMG/M |
| 3300009098|Ga0105245_10462505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1279 | Open in IMG/M |
| 3300009100|Ga0075418_10833367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 996 | Open in IMG/M |
| 3300009101|Ga0105247_10316229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1088 | Open in IMG/M |
| 3300009147|Ga0114129_10283457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2213 | Open in IMG/M |
| 3300009148|Ga0105243_10704792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 984 | Open in IMG/M |
| 3300009148|Ga0105243_10898005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 881 | Open in IMG/M |
| 3300009174|Ga0105241_10637206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 967 | Open in IMG/M |
| 3300009174|Ga0105241_11383115 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009176|Ga0105242_11677202 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300009176|Ga0105242_12816203 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009176|Ga0105242_13111034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009176|Ga0105242_13115549 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009177|Ga0105248_10444810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1460 | Open in IMG/M |
| 3300009177|Ga0105248_12588867 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300009553|Ga0105249_12104719 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300009553|Ga0105249_12267074 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009789|Ga0126307_11165277 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009789|Ga0126307_11192495 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009840|Ga0126313_10960797 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010037|Ga0126304_10445192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 867 | Open in IMG/M |
| 3300010038|Ga0126315_11087047 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010042|Ga0126314_10545906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 843 | Open in IMG/M |
| 3300010045|Ga0126311_11219311 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010326|Ga0134065_10207967 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010360|Ga0126372_10842584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 913 | Open in IMG/M |
| 3300010360|Ga0126372_12189038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300010361|Ga0126378_12616967 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010364|Ga0134066_10219747 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010366|Ga0126379_11313190 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300010397|Ga0134124_11120899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 804 | Open in IMG/M |
| 3300010397|Ga0134124_11546670 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300010399|Ga0134127_12223171 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010399|Ga0134127_12490611 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010400|Ga0134122_11555682 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010401|Ga0134121_12170243 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010403|Ga0134123_11147648 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010403|Ga0134123_11702719 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300010403|Ga0134123_12205933 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010403|Ga0134123_13587304 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300011271|Ga0137393_10605387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 940 | Open in IMG/M |
| 3300012015|Ga0120187_1058078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300012096|Ga0137389_11392063 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012096|Ga0137389_11827920 | Not Available | 503 | Open in IMG/M |
| 3300012199|Ga0137383_10231131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1355 | Open in IMG/M |
| 3300012200|Ga0137382_10756810 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012202|Ga0137363_10137882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1903 | Open in IMG/M |
| 3300012208|Ga0137376_10611326 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300012212|Ga0150985_102916721 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012285|Ga0137370_10719202 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012357|Ga0137384_10793860 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300012362|Ga0137361_11411052 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012469|Ga0150984_111035424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1007 | Open in IMG/M |
| 3300012474|Ga0157356_1016554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300012511|Ga0157332_1026998 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012685|Ga0137397_10077894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2407 | Open in IMG/M |
| 3300012918|Ga0137396_11195208 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012925|Ga0137419_11936333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 506 | Open in IMG/M |
| 3300012927|Ga0137416_11834399 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012929|Ga0137404_11202827 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012957|Ga0164303_10118838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1344 | Open in IMG/M |
| 3300013100|Ga0157373_10603914 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300013306|Ga0163162_12760187 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300013307|Ga0157372_11891842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300013308|Ga0157375_10776020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1108 | Open in IMG/M |
| 3300013308|Ga0157375_13552387 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300013760|Ga0120188_1023402 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300014263|Ga0075324_1161448 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300014326|Ga0157380_12823417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300014968|Ga0157379_11639382 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300014969|Ga0157376_11109220 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300015373|Ga0132257_100218804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2263 | Open in IMG/M |
| 3300018027|Ga0184605_10143254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1073 | Open in IMG/M |
| 3300018063|Ga0184637_10171538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1335 | Open in IMG/M |
| 3300018076|Ga0184609_10039730 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300018466|Ga0190268_10778289 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018476|Ga0190274_10621270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1111 | Open in IMG/M |
| 3300018476|Ga0190274_13691736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 517 | Open in IMG/M |
| 3300019879|Ga0193723_1178399 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300019999|Ga0193718_1069850 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300020004|Ga0193755_1079893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1050 | Open in IMG/M |
| 3300020061|Ga0193716_1273163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 591 | Open in IMG/M |
| 3300025893|Ga0207682_10534587 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300025899|Ga0207642_10054271 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300025903|Ga0207680_10528095 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300025904|Ga0207647_10381090 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300025908|Ga0207643_10046009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2466 | Open in IMG/M |
| 3300025908|Ga0207643_10837117 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300025913|Ga0207695_11745225 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025920|Ga0207649_11454175 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300025922|Ga0207646_10672622 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300025923|Ga0207681_10583586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 922 | Open in IMG/M |
| 3300025923|Ga0207681_11851591 | Not Available | 503 | Open in IMG/M |
| 3300025925|Ga0207650_11468284 | Not Available | 580 | Open in IMG/M |
| 3300025930|Ga0207701_10412832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1162 | Open in IMG/M |
| 3300025933|Ga0207706_11159628 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300025936|Ga0207670_10987779 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300025939|Ga0207665_11515479 | Not Available | 533 | Open in IMG/M |
| 3300025941|Ga0207711_10503118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1129 | Open in IMG/M |
| 3300025945|Ga0207679_11844809 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300025945|Ga0207679_11978379 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300025981|Ga0207640_11736256 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300025986|Ga0207658_11497371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300026035|Ga0207703_10315801 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300026041|Ga0207639_10566120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300026095|Ga0207676_11390674 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300026095|Ga0207676_12062268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 569 | Open in IMG/M |
| 3300026116|Ga0207674_10076224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3362 | Open in IMG/M |
| 3300026142|Ga0207698_11977917 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300026285|Ga0209438_1034934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1667 | Open in IMG/M |
| 3300026313|Ga0209761_1158238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1060 | Open in IMG/M |
| 3300027748|Ga0209689_1354312 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027886|Ga0209486_11219925 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027909|Ga0209382_11194730 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300028381|Ga0268264_12523489 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300028536|Ga0137415_10303675 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300028792|Ga0307504_10415990 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031229|Ga0299913_10155407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2258 | Open in IMG/M |
| 3300031716|Ga0310813_10961346 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031731|Ga0307405_10483131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 989 | Open in IMG/M |
| 3300031740|Ga0307468_102139090 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031852|Ga0307410_11365273 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300032002|Ga0307416_101201022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 864 | Open in IMG/M |
| 3300032003|Ga0310897_10442876 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300032004|Ga0307414_10989364 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300032005|Ga0307411_10453891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1073 | Open in IMG/M |
| 3300032126|Ga0307415_100286979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
| 3300032180|Ga0307471_103414607 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300033412|Ga0310810_10727766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 915 | Open in IMG/M |
| 3300033412|Ga0310810_10789164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 861 | Open in IMG/M |
| 3300033412|Ga0310810_11406261 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.29% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.44% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.44% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.48% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.48% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.48% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_04218540 | 2065487018 | Soil | NITVVLARFIGDDLEEPSNDRITIELPQLEEDKTLDDTYEADTEPRI |
| 4MG_03996650 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | EDNITVVMARFFGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH |
| ICChiseqgaiiFebDRAFT_104199983 | 3300000363 | Soil | DDLALPTSDKITIELPPLEEDKTLDDNYEADTEPQG* |
| INPhiseqgaiiFebDRAFT_1017915472 | 3300000364 | Soil | RGGEDNITVVLARFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI* |
| JGI1357J11328_102182702 | 3300000574 | Groundwater | NITVVLARFTGEDLREASADRITVELPPLEEDKTLDETEADTSSH* |
| JGI11643J11755_114047331 | 3300000787 | Soil | LGEDLALPTNDKITIELPPLEEDKTLDDNYEADTEPQGS* |
| JGI1027J11758_117162332 | 3300000789 | Soil | DLEEPSNDRITIELPQLEEDKTLDDTYEADTEPRI* |
| JGI1027J11758_119947493 | 3300000789 | Soil | TVVLARFTGDDLRDPNDDRITVELPPLEEDRTLDETETDTQHP* |
| JGI11615J12901_113209063 | 3300000953 | Soil | FGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| soilH1_101495611 | 3300003321 | Sugarcane Root And Bulk Soil | EDNITVVLARFQGDDLEEPATDRITIELPPLEEDKTLDDTYEADTEPH* |
| soilH2_100132881 | 3300003324 | Sugarcane Root And Bulk Soil | GEDNITVVLARFQGDDLEEPATDRITIELPPLEEDKTLDDTYEADTEPH* |
| soilH2_100257794 | 3300003324 | Sugarcane Root And Bulk Soil | NITVVLARFHGDDLEEPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0062593_1032151772 | 3300004114 | Soil | RFNGDELEDPSSDRITIELPPIEEEDKTLDDTYDPTTEPR* |
| Ga0063356_1028151492 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NITVVLARFHGDDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH* |
| Ga0062592_1000587031 | 3300004480 | Soil | DNITVVLARFQGDDLEEPSTDRITIELPPLEEDKTLDDNYEADTEPH* |
| Ga0062592_1008977291 | 3300004480 | Soil | GGEDNITVILARFSGDELEEPSAEKITIELPLLEEDKTLDDTYDPDTEPR* |
| Ga0062592_1011235302 | 3300004480 | Soil | VVLARFQGDDLEAPSSDRITIELPPLEEDKTLDDNYEADTEPH* |
| Ga0066685_108668342 | 3300005180 | Soil | LARFLGDDLEEPVSDRITIELPALEEDKTLEDTFEPDTEPH* |
| Ga0066678_103155813 | 3300005181 | Soil | VLARFTGEELSNSSHDRITVELPPLEEDKTLDETEADTEQQ* |
| Ga0066671_102884063 | 3300005184 | Soil | ANNRGGEDNITVVLARFSGEDLRDPNDDRITVELPTLEEDRTLDETEADTESGNR* |
| Ga0066676_105065991 | 3300005186 | Soil | RFLGDDLEPPTTERITIELPPLEEDKTLDDSYDEPDTEPQ* |
| Ga0065704_100832366 | 3300005289 | Switchgrass Rhizosphere | ARFLGDDLEAPSTEKITIELPPLDEDKTLDDGYEADTEPH* |
| Ga0070676_113795312 | 3300005328 | Miscanthus Rhizosphere | GGEDNITVVLARFIGDDLEEPSNDRITVELPQLEEDKTLDDTYEADTEPRI* |
| Ga0070690_1007236172 | 3300005330 | Switchgrass Rhizosphere | SGDELEEPDTDRITIELPPLEEDMTLDDSYEHDTEPREQ* |
| Ga0070666_104621121 | 3300005335 | Switchgrass Rhizosphere | GDDLEAPATDRITIELPPLEEDKTLDDTYEADTEPRTGE* |
| Ga0070689_1016359232 | 3300005340 | Switchgrass Rhizosphere | ILARFSGDELEEPDTDRITIELPPLEEDMTLDDNYEPDTEPR* |
| Ga0070691_109121621 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | NNRGGEDNITVVLARFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI* |
| Ga0070701_112249461 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | GGEDNITVVLAKFLGDDLALPTSDKITIELPPLEEDKTLDDNYEADTEPQG* |
| Ga0070705_1004282853 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GGEDNITVVLAHFSGDDLEPPATDRITIELPPLEEDKTLDDTYEADTEPR* |
| Ga0070705_1010914611 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RGGEDNITVVLARFGGDDLEEATSERITIELPALEEDKTLEDNFEADTEPQ* |
| Ga0070705_1015966571 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | EANNRGGEDNITVVLARFTGEELRDPNDDRITVELPLMEEDRTLDETEVDTQHP* |
| Ga0070705_1017840031 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IRGGEDNITVVLARFLGDDLEPPTTERITIELPPLEEDKTLDDSYDEPDTEPQ* |
| Ga0066689_107892011 | 3300005447 | Soil | ITVVLARFTGDELREPTSDRITIELPPMEEDKTLDETEADTENPD* |
| Ga0068867_1015803801 | 3300005459 | Miscanthus Rhizosphere | NITVVLARFSGDDLRDPNDDRITVELPPLDEDRTLDETVADTEHP* |
| Ga0070706_1015558611 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EANNRGGEDNITVVLARFTGKDLRDPNDDRITVELPLMEEDRTLDETEVDTQHP* |
| Ga0070699_1017261632 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RGGEDNITVVLARFTGDELKDGSADRITVELPVLEEDKTLDETEADTGQM* |
| Ga0066697_100961761 | 3300005540 | Soil | ELREPTSDRITIELPPMEEDKTLDETEADTENPD* |
| Ga0070672_1012040102 | 3300005543 | Miscanthus Rhizosphere | ANNRGGEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0070695_1005928751 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | NERGGEDNITVVLARFSGEGLDDGAADRITVELPVSEEDRTLDETEVDSQHQTPSL* |
| Ga0070695_1007413272 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RFSGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0070695_1008232421 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TAANDRGGEDNITVVLARFTGKELEDAGTDRITVELPVVEEDKTLEETEIDTQHRTPIL* |
| Ga0070695_1008504391 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LIDEANNRGGEDNITVVLAHFSGDDLEPPATDRITIELPPLEEDKTLDDTYEADTEPN* |
| Ga0070696_1017549492 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DNITVVLARFIGDDLEEPSNDRITIELPQLEEDKTLDDTYDADTEPRI* |
| Ga0070704_1010519883 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ANNRGGEDNITVVLVRFLGDDLQEPTNDHITVELPPLEEDKTLDDTYEADTESS* |
| Ga0066707_109294312 | 3300005556 | Soil | ITVVLARFVGDDLEPPTTERITIELPPLEEDKTLDDNFEADTEPQ* |
| Ga0068857_1005431753 | 3300005577 | Corn Rhizosphere | TVVLVRFLGDDLQEPTGDHITVELPPLEEDKTLDDTYEADTEAS* |
| Ga0068857_1013737902 | 3300005577 | Corn Rhizosphere | ANNRGGEDNITVVLARFDGEDLEAPATDRITIELPPLEEDKTLDDNYEADTEPH* |
| Ga0068857_1018974791 | 3300005577 | Corn Rhizosphere | DDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0068854_1009593281 | 3300005578 | Corn Rhizosphere | NNRGGEDNITVVLARFSGDDLEEPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0066691_106656622 | 3300005586 | Soil | EDNITVVLARFTGEELSNSGHDRITVELPPLEEDKTLDETESDTEVQ* |
| Ga0068852_1015319641 | 3300005616 | Corn Rhizosphere | EEANNRGGEDNITVVLARFLGEDLGLPTNDKITIELPPLEEDKTLDDNYEADTEPQGS* |
| Ga0068864_1026559722 | 3300005618 | Switchgrass Rhizosphere | LEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI* |
| Ga0068851_109803291 | 3300005834 | Corn Rhizosphere | SGDDLEEAQSDRITIELPPMEEDKTLDDTYEADTEPR* |
| Ga0068858_1003905343 | 3300005842 | Switchgrass Rhizosphere | DNITVVLAKFLGDDLALPTSDKITIELPPLEEDKTLDDNYEADTEPQG* |
| Ga0068858_1010953493 | 3300005842 | Switchgrass Rhizosphere | ARFFGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0068860_1017057802 | 3300005843 | Switchgrass Rhizosphere | TVILARFSGDELEEPSAEKITIELPLLEEDKTLDDTYDPDTEPR* |
| Ga0068860_1017861332 | 3300005843 | Switchgrass Rhizosphere | NNRGGEDNITVVLARFFGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0068862_1003435053 | 3300005844 | Switchgrass Rhizosphere | ELEEPSAEKITIELPLLEEDKTLDDTYDPDTEPR* |
| Ga0081539_103493772 | 3300005985 | Tabebuia Heterophylla Rhizosphere | DLEPPATDRITIELPPLEEDKTLDDTYEADTEPQ* |
| Ga0066652_1013029661 | 3300006046 | Soil | RGGEDNITVVLARFSGDDLRDPNDDRITVELPPLDEDRTLDETIADTEHP* |
| Ga0068871_1000871915 | 3300006358 | Miscanthus Rhizosphere | RFSGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0079222_110835151 | 3300006755 | Agricultural Soil | ARFFGDDLEGPSSDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0075428_1005332311 | 3300006844 | Populus Rhizosphere | DNITVVLARFMGDDLEPPATDRITIELPPLEEDKTLDDSYEADTEPQ* |
| Ga0079217_102095152 | 3300006876 | Agricultural Soil | VVLARFHGDDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH* |
| Ga0075429_1006000693 | 3300006880 | Populus Rhizosphere | DLEAPATDRITIELPPLEEDKTLDDNYEADTEPH* |
| Ga0075429_1006213091 | 3300006880 | Populus Rhizosphere | DDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ* |
| Ga0079215_111235351 | 3300006894 | Agricultural Soil | GGEDNITVILARFSGDELQEPASDRITVELPAIEEEDKTLDDTYESDTEPQPNS* |
| Ga0075424_1014605422 | 3300006904 | Populus Rhizosphere | VLARFLGEDLEEPSTDRITIELPPLEEDKTLDDTYDADTEPRI* |
| Ga0075424_1028482262 | 3300006904 | Populus Rhizosphere | ANNRGGEDNITVVLARFSGDELQDGAEDRITVELPVLDEDKTLDETEVDSHTTPKL* |
| Ga0079219_104370251 | 3300006954 | Agricultural Soil | NRGGEDNITVVLARFFGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0099794_102010923 | 3300007265 | Vadose Zone Soil | GGEDNITVVLARFSGDELRDPNDDRITVELPPVEDDKTLDETEADTQNPER* |
| Ga0099794_104685071 | 3300007265 | Vadose Zone Soil | NRGGEDNITVVLARFSGDELRDPNDDRITVELPPVEDDKTLDETEADTQQP* |
| Ga0099794_106699351 | 3300007265 | Vadose Zone Soil | NRGGEDNITVVLARFVGDDLELPTTERITIELPPLEEDKTLDDNFEADTEPQ* |
| Ga0066710_1029422791 | 3300009012 | Grasslands Soil | RGGEDNITVVLARFTGEELSAPDQDRITVELPPLDEDRTLDETDIDTTANM |
| Ga0066710_1047922172 | 3300009012 | Grasslands Soil | EDNITVVLARFTGDELREPTQDRITIELPPLEEDKTLDETEADTQHETEDD |
| Ga0105106_101622124 | 3300009078 | Freshwater Sediment | DGKDLEEPSTDRITIELPQLDEDKTLDDNYQADTEPH* |
| Ga0099827_109438023 | 3300009090 | Vadose Zone Soil | ARFSGEELEEPASDRITIELPPLEEDKTLDDNFEPDTEPR* |
| Ga0111539_111135351 | 3300009094 | Populus Rhizosphere | DNITVVVARFSGDDLEEAQSDRITIELPPMEEDKTLDDTYEADTEPR* |
| Ga0105245_104625054 | 3300009098 | Miscanthus Rhizosphere | NITVVLARISGDDLEAPASDRITIELPPLEEDKTLDDTYEADTEPR* |
| Ga0075418_108333673 | 3300009100 | Populus Rhizosphere | AEANNRGGEDNITVVLARFTGEELRDPNDDRITVELPPMEEDRTLDETEVDTQHP* |
| Ga0105247_103162291 | 3300009101 | Switchgrass Rhizosphere | DDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0114129_102834574 | 3300009147 | Populus Rhizosphere | DLEAPSSDRITIELPPLEEDKTLDDNYEADTEPH* |
| Ga0105243_107047923 | 3300009148 | Miscanthus Rhizosphere | EDNITVVLARFIGDDLEEPSNDRITIELPQLEEDKTLDDTYDADTEPRI* |
| Ga0105243_108980053 | 3300009148 | Miscanthus Rhizosphere | TVILARFTGDELEEPASEKITVELPPMTEEDKTLDDTYSPDTEPR* |
| Ga0105241_106372061 | 3300009174 | Corn Rhizosphere | VLARFSGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0105241_113831151 | 3300009174 | Corn Rhizosphere | ITVVLARFQGDDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH* |
| Ga0105242_116772021 | 3300009176 | Miscanthus Rhizosphere | TVILARFSGEELEEPSTDRITIELPPLEEDMTLDDSYERDTEPR* |
| Ga0105242_128162032 | 3300009176 | Miscanthus Rhizosphere | GEDNITVVLARFSGDDLRDPNDDRITVELPPLDEDRTLDETIADTEHP* |
| Ga0105242_131110341 | 3300009176 | Miscanthus Rhizosphere | RFSGNELEEPSADKITIELPLLDEDKTLDDTYDPDTEPR* |
| Ga0105242_131155492 | 3300009176 | Miscanthus Rhizosphere | LARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0105248_104448103 | 3300009177 | Switchgrass Rhizosphere | VLARFSGEDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0105248_125888672 | 3300009177 | Switchgrass Rhizosphere | EDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0105249_121047192 | 3300009553 | Switchgrass Rhizosphere | GEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0105249_122670741 | 3300009553 | Switchgrass Rhizosphere | LARFFGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0126307_111652772 | 3300009789 | Serpentine Soil | EDNITVVLARFSGDDLEAPATDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0126307_111924952 | 3300009789 | Serpentine Soil | FSGDDLEPPATDRITIELLPLEEDKTLDDTYEADTEPQ* |
| Ga0126313_109607971 | 3300009840 | Serpentine Soil | RGGEDNITVVLARFSGDDLEAPATDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0126304_104451921 | 3300010037 | Serpentine Soil | ITVVLARFSGDDLQAPATDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0126315_110870472 | 3300010038 | Serpentine Soil | VLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0126314_105459063 | 3300010042 | Serpentine Soil | FSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0126311_112193112 | 3300010045 | Serpentine Soil | VLAHFSGDDLEPPATDRITIELPPLEEDKTLDDTYEADTEPQ* |
| Ga0134065_102079672 | 3300010326 | Grasslands Soil | VLARFTGEELSNSSHDRITVELPPLEEDKTLDETEADTEI* |
| Ga0126372_108425843 | 3300010360 | Tropical Forest Soil | LAKFLGDDLEAPSSNRITIELPPLEEDKTLDDGYEADTEPRS* |
| Ga0126372_121890381 | 3300010360 | Tropical Forest Soil | VLARFFGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0126378_126169671 | 3300010361 | Tropical Forest Soil | NRGGEDNITVVLARFGGDDLEEPVSDRITIELPPLEEDKTLEDGFEADTQPH* |
| Ga0134066_102197472 | 3300010364 | Grasslands Soil | EDNITVVIARFDGDDLQEPTTNRITIELPALEEDKTLEDTFDADTQPQ* |
| Ga0126379_113131902 | 3300010366 | Tropical Forest Soil | TVVLARFGGDDLDEPTSDRITIELPPLEEDKTLEDNFESDTQTQQ* |
| Ga0134124_111208991 | 3300010397 | Terrestrial Soil | DLEEAQSDRITIELPPMEEDKTLDDTYEADTEPR* |
| Ga0134124_115466702 | 3300010397 | Terrestrial Soil | EDNITVVLAKFLGDDLALPTSDKITIELPPLEEDKTLDDNYEADTEPQG* |
| Ga0134127_122231712 | 3300010399 | Terrestrial Soil | ARFSGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0134127_124906111 | 3300010399 | Terrestrial Soil | DLEEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0134122_115556821 | 3300010400 | Terrestrial Soil | RGGEDNITVVLARFDGDDLQEATTDRITIELPTLEEDKTLEDTFDADTQPH* |
| Ga0134121_121702431 | 3300010401 | Terrestrial Soil | RGGEDNITVVLARFFGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0134123_111476482 | 3300010403 | Terrestrial Soil | LARFLGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPQH* |
| Ga0134123_117027192 | 3300010403 | Terrestrial Soil | VILARFTGDELEDPATDRITIELPPIEEEDKTLDDTYDPDTEPR* |
| Ga0134123_122059331 | 3300010403 | Terrestrial Soil | DDLEEPATDRITIELPPLEEDKTLDDSYEADTEPQ* |
| Ga0134123_135873041 | 3300010403 | Terrestrial Soil | HRGGEDNITVVLARFDGDDLQEATTDRITIELPALEEDKTLEDTFDADTQPH* |
| Ga0137393_106053873 | 3300011271 | Vadose Zone Soil | ANNRGGEDNITVVLARFVGDDLEPPTTERITIELPPLEEDKTLDDNFEADTEPQ* |
| Ga0120187_10580782 | 3300012015 | Terrestrial | EANNRGGEDNITVVLARFNGDDLEAPATDKITIELPPMEEDKTLDDTYEADTEPR* |
| Ga0137389_113920631 | 3300012096 | Vadose Zone Soil | EDNITVVLARLTGEALKPTLEDRITVKLPVLKENKTLEKTKADTEDPTIGN* |
| Ga0137389_118279202 | 3300012096 | Vadose Zone Soil | VLARFSGEELSNSSHDRITVELPPLEEDKTLDETEADTEQQ* |
| Ga0137383_102311313 | 3300012199 | Vadose Zone Soil | GGEDNITVVLARFSGDDLEEAREDRITVELPAIEEDQTLDETEIDTEADTVIPHRR* |
| Ga0137382_107568102 | 3300012200 | Vadose Zone Soil | EDNITVILARFSGNELEDPASDRITIELPAMDEDKTLDDTYDTYDPDTEPH* |
| Ga0137363_101378821 | 3300012202 | Vadose Zone Soil | EELEEPASDRITIELPPLEEDKTLDDSYESDTEPR* |
| Ga0137376_106113262 | 3300012208 | Vadose Zone Soil | EANRRGGEDNITVVLARFTGEELSNSSHDRITVELPPLEEDKTLDETEADAEQR* |
| Ga0150985_1029167212 | 3300012212 | Avena Fatua Rhizosphere | GEDNITVVLARFLGDDLEEPSNERITIELPPLEEDKTLDDTYEADTEPQS* |
| Ga0137370_107192022 | 3300012285 | Vadose Zone Soil | NRGGEDNITVVLARFTGDELRDPNDDRITVELPPLEEDRTLDETEADTQHE* |
| Ga0137384_107938603 | 3300012357 | Vadose Zone Soil | EDLEEPVTDRITIELPALEEDKTLEDNFDSDTEPQ* |
| Ga0137361_114110521 | 3300012362 | Vadose Zone Soil | ANNRGGEDNITVVLARFDGDDLQEPATDRITIELPALEEDKTLEDFEGDTEPQ* |
| Ga0150984_1110354241 | 3300012469 | Avena Fatua Rhizosphere | RGGEDNITVVLARFSGGDLRDPNDDRITVELPPLDDDRTLDETIADTEHP* |
| Ga0157356_10165541 | 3300012474 | Unplanted Soil | ANNRGGEDNITVVLARFLGDDLAEPSTDRITIELPPLEEDKTLDDSYEADTEPQH* |
| Ga0157332_10269982 | 3300012511 | Soil | GEDNITVVLARFLGDDLEEPSNERITIELPPLEEDKTLDDSYEADTEPQH* |
| Ga0137397_100778941 | 3300012685 | Vadose Zone Soil | TGEELREASADRITVELPPLEEDKTLDETEADTSHH* |
| Ga0137396_111952081 | 3300012918 | Vadose Zone Soil | DNITVVLARFTGDELREASEDRITVELPPLEEDKTLDETEADTQNPDR* |
| Ga0137419_119363331 | 3300012925 | Vadose Zone Soil | NYRGGEDNITVVLARFTGEELREASEDRITVELPPLEEDKTLDETEADTSPH* |
| Ga0137416_118343991 | 3300012927 | Vadose Zone Soil | TGNELEDPASDRITIELPAMEDEDKTRDATYDTDTEPR* |
| Ga0137404_112028272 | 3300012929 | Vadose Zone Soil | EANNRGGEDNITVILARFGGPDLEEATTERITIELPILEEDKTLEDTFEADTEPPTGD* |
| Ga0164303_101188383 | 3300012957 | Soil | FLGDDLEAPATEKITIELPPLDEDKTLDDGYEADTEPR* |
| Ga0157373_106039143 | 3300013100 | Corn Rhizosphere | DNITVVLARFSGDDLEAPATDRITIELPPLEEDKTLDDTYEADTGPH* |
| Ga0163162_127601871 | 3300013306 | Switchgrass Rhizosphere | EDNITVVLARFLGDDLEAPATEKITIELPPLDEDKTLDDGYEADTEPR* |
| Ga0157372_118918422 | 3300013307 | Corn Rhizosphere | RGGEDNITVVLARFQGDDLEEAATDRITIELPPLDEDKTLDDNYEADTEPH* |
| Ga0157375_107760203 | 3300013308 | Miscanthus Rhizosphere | VVLARFLGGDLEAPSTEKITIELPPLDEDKTLDDGYEADTEPH* |
| Ga0157375_135523872 | 3300013308 | Miscanthus Rhizosphere | RGGEDNITVILARFTGDELEEPASDRITVELPAMQEEDKTLDDTYSPETDPR* |
| Ga0120188_10234021 | 3300013760 | Terrestrial | LEEPASDRITVELPAIQEEDKTLDDTFESDTEPHG* |
| Ga0075324_11614482 | 3300014263 | Natural And Restored Wetlands | NITVVLARFFGEDLEAPASDRITIELPPLEEDKTLDDTYEADTEPH* |
| Ga0157380_128234171 | 3300014326 | Switchgrass Rhizosphere | NNRGGEDNITVILARFNGDELEDPASDRITIELPPIEEEDKTLDDTYDPDTEPH* |
| Ga0157379_116393821 | 3300014968 | Switchgrass Rhizosphere | NRGGEDNITVVLARFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI* |
| Ga0157376_111092201 | 3300014969 | Miscanthus Rhizosphere | RFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI* |
| Ga0132257_1002188045 | 3300015373 | Arabidopsis Rhizosphere | AQFSGDDLEAPESDRITIELPPLEEDKTLDDTYEADTEPQ* |
| Ga0184605_101432541 | 3300018027 | Groundwater Sediment | IRGGEDNITVVLARFLGDDLEPASTDRITIELPPLEEDKTLDDSYEPDTEPQ |
| Ga0184637_101715381 | 3300018063 | Groundwater Sediment | SGDELEEPASDRITIELPPLQEEDKTLDDTYDPDTDPR |
| Ga0184609_100397304 | 3300018076 | Groundwater Sediment | GEDNITVVLARFLGDDLEEPANDRVTIELPQLEEDKTLDDSYEADTEPQQQ |
| Ga0190268_107782892 | 3300018466 | Soil | VLAHFSGDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ |
| Ga0190274_106212703 | 3300018476 | Soil | GGEDNITVVLARFLGEDLEAPSTERITIELPPLEEDKTLDDTYEADTEPQQN |
| Ga0190274_136917361 | 3300018476 | Soil | ARFSGDELEEPATDRITIELPPLEEEDMTLDDTYESDTESH |
| Ga0193723_11783992 | 3300019879 | Soil | GDELEEPTADRITIELPLLEEDKTLDDTYDPDTEPR |
| Ga0193718_10698502 | 3300019999 | Soil | ANYRGGEDNITVVLAKFTGEDLREANADRITVELPPLEEDKTLDETEADTSHH |
| Ga0193755_10798933 | 3300020004 | Soil | EDNITVVLARFTGDELREASEDRITVELPPLEEDRTLDETEADTQNPNK |
| Ga0193716_12731631 | 3300020061 | Soil | RLMGDDLEEPANDRVTIELPQLEEDKTLDDNYEADTEPTAE |
| Ga0207682_105345871 | 3300025893 | Miscanthus Rhizosphere | SGTELEEPVNDRITIELPPLTEDDKTLDDTYEQDTEPRQL |
| Ga0207642_100542711 | 3300025899 | Miscanthus Rhizosphere | TVVLAWFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI |
| Ga0207680_105280952 | 3300025903 | Switchgrass Rhizosphere | GEDNITVVLARFLGDDLEAPATDRITIELPPLEEDKTLDDTYEADTEPRTGE |
| Ga0207647_103810902 | 3300025904 | Corn Rhizosphere | EEANNRGGEDNITVVLARFLGEDLGLPTNDKITIELPPLEEDKTLDDNYEADTEPQGS |
| Ga0207643_100460091 | 3300025908 | Miscanthus Rhizosphere | TVVLAQFSGDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ |
| Ga0207643_108371172 | 3300025908 | Miscanthus Rhizosphere | VVARFSGDDLEEAQSDRITIELPPMEEDKTLDDTYEADTEPR |
| Ga0207695_117452252 | 3300025913 | Corn Rhizosphere | AEANNRGGEDNITVVLARFTDDELRDPNDDRITVELPPLEEDRTLDETEADTQHE |
| Ga0207649_114541751 | 3300025920 | Corn Rhizosphere | EDNITVVLARFSGEDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0207646_106726223 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RGGEDNITVVLARFLGDDLEEPVSDRITIELPALEEDKTLEDTFEPDTEPH |
| Ga0207681_105835861 | 3300025923 | Switchgrass Rhizosphere | FSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0207681_118515912 | 3300025923 | Switchgrass Rhizosphere | ARFDGDDLEAPSTERITIELPPLEEDKTLDDNYEADTEPH |
| Ga0207650_114682841 | 3300025925 | Switchgrass Rhizosphere | LARFTGDELEEPTTDRITVELPPMQEEDKTLDDTYSPDTDPQ |
| Ga0207701_104128323 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | YRGGEDNITVVVARFDGDDLEAPATDRITIELPPLEEDKTLDDNYEADTEPH |
| Ga0207706_111596282 | 3300025933 | Corn Rhizosphere | GEDNITVVLAHFSGDDLEEAASDRITIELPPLEEDKTLDDTYEADTEPQ |
| Ga0207670_109877791 | 3300025936 | Switchgrass Rhizosphere | GGEDNITVVLARFLGDDLDEPSTDRITIELPPLEEDKTLDDNYEADTEPH |
| Ga0207665_115154791 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TVILARFTGDELEEPASDRITIELPPLEEDMTLDDSYESDTEPR |
| Ga0207711_105031181 | 3300025941 | Switchgrass Rhizosphere | VVIARFSGSDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0207679_118448092 | 3300025945 | Corn Rhizosphere | VVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0207679_119783792 | 3300025945 | Corn Rhizosphere | NRGGEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPR |
| Ga0207640_117362561 | 3300025981 | Corn Rhizosphere | DDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0207658_114973712 | 3300025986 | Switchgrass Rhizosphere | ANNRGGEDNITVILARFSGDELQEPATDRITIELPALTEEDKTLDDTYDPDTEPR |
| Ga0207703_103158011 | 3300026035 | Switchgrass Rhizosphere | GGEGNITVVLARFLGDDLDEPSTDRITIELPPLEEDKTLDDSYEADTEPQH |
| Ga0207639_105661202 | 3300026041 | Corn Rhizosphere | LARFSGDDLDAPSTDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0207676_113906741 | 3300026095 | Switchgrass Rhizosphere | NNRGGEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0207676_120622681 | 3300026095 | Switchgrass Rhizosphere | ANNRGGEDNITVILARFSGDELEEPSADKITIELPLLEEDKTLDDTYDPDTEPR |
| Ga0207674_100762241 | 3300026116 | Corn Rhizosphere | ARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0207698_119779171 | 3300026142 | Corn Rhizosphere | NNRGGEDNITVILARFSGDELEEPDTDRITIELPPLEEDMTLDDNYEPDTEPR |
| Ga0209438_10349343 | 3300026285 | Grasslands Soil | VLARFLGDDLEAPSTERITIELPPLEEDKTLDDNYEADTEPQQ |
| Ga0209761_11582381 | 3300026313 | Grasslands Soil | ILARVDGDDLDEPTTDRITIELPALEEDKTLEDTFEPDTEPH |
| Ga0209689_13543122 | 3300027748 | Soil | ARFLGDDLEEPVSDRITIELPALEEDKTLEDTFEPDTEPH |
| Ga0209486_112199251 | 3300027886 | Agricultural Soil | EANNRGGEDNITVVLARFDGEDLEAPSTDRITIELPPLEEDKTLDDNYEADTEPH |
| Ga0209382_111947301 | 3300027909 | Populus Rhizosphere | ITVVLAQFSGDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ |
| Ga0268264_125234892 | 3300028381 | Switchgrass Rhizosphere | GGEDNITVVLARFSGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0137415_103036751 | 3300028536 | Vadose Zone Soil | ARFTGEELREASEDRITVELPPLEEDKTLDETEADTASH |
| Ga0307504_104159902 | 3300028792 | Soil | GEELEEPASDRITIELPPLEEDKTLDDNYESDTEPR |
| Ga0299913_101554071 | 3300031229 | Soil | DNITVVLARFDGEDLEEATSDRITIELPPLEDDKTLDDNFEADTEPH |
| Ga0310813_109613462 | 3300031716 | Soil | ITVVLARFSGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0307405_104831311 | 3300031731 | Rhizosphere | NNRGGEDNITVVLARFQGEDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH |
| Ga0307468_1021390902 | 3300031740 | Hardwood Forest Soil | NRGGEDNITVVLARFTGDELRDAKDDRITVELAPQEEDKTLDETEIDKPHDTPPL |
| Ga0307410_113652731 | 3300031852 | Rhizosphere | AQFSGDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ |
| Ga0307416_1012010221 | 3300032002 | Rhizosphere | FLGDDLEEPANDRVTIELPQLEEDKTLDDTYEADTEPQS |
| Ga0310897_104428761 | 3300032003 | Soil | ITVVVARFDGDDLEAPTTDRITIELPPLEEDKTLDDNYEADTEPH |
| Ga0307414_109893642 | 3300032004 | Rhizosphere | ARFHGDDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH |
| Ga0307411_104538911 | 3300032005 | Rhizosphere | NITVVLARFDGDDLEAPSTDRITIELPPLEEDKTLDDNYEADTEPH |
| Ga0307415_1002869791 | 3300032126 | Rhizosphere | VVLARFSGGDLQEPASERITIELPPMEEDSTLGDTEPPTEPNPNN |
| Ga0307471_1034146072 | 3300032180 | Hardwood Forest Soil | SGEGLRDPSNDRITIELPPLEEDKTLDETEADTQNPD |
| Ga0310810_107277663 | 3300033412 | Soil | ITVVIARFFGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH |
| Ga0310810_107891643 | 3300033412 | Soil | DNITVILARFSGDELEEPSADKITIELPLLEEDKTLDDTYDPDTEPR |
| Ga0310810_114062612 | 3300033412 | Soil | DLEEPSNDRITIELPPLEEDKTLDDTYDADTEPRI |
| ⦗Top⦘ |