| Basic Information | |
|---|---|
| Family ID | F023806 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 208 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTYPNGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPWC |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 208 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 42.93 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 90.38 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.769 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.115 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.731 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.49% β-sheet: 0.00% Coil/Unstructured: 84.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 208 Family Scaffolds |
|---|---|---|
| PF16778 | Phage_tail_APC | 3.37 |
| PF09636 | XkdW | 2.40 |
| PF03406 | Phage_fiber_2 | 0.96 |
| PF13884 | Peptidase_S74 | 0.48 |
| PF13385 | Laminin_G_3 | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.77 % |
| All Organisms | root | All Organisms | 44.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000405|LV_Brine_h2_0102DRAFT_1014387 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1016496 | Not Available | 1483 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1037161 | Not Available | 872 | Open in IMG/M |
| 3300001523|JGI1221J15618_1005718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2641 | Open in IMG/M |
| 3300002408|B570J29032_108899005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300002408|B570J29032_109136533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300002835|B570J40625_100371198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
| 3300002835|B570J40625_101089386 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300002835|B570J40625_101095705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300002835|B570J40625_101103679 | Not Available | 670 | Open in IMG/M |
| 3300003277|JGI25908J49247_10043213 | Not Available | 1207 | Open in IMG/M |
| 3300003393|JGI25909J50240_1041713 | Not Available | 974 | Open in IMG/M |
| 3300004125|Ga0066182_10120921 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300004151|Ga0066602_10608577 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300004481|Ga0069718_15673638 | Not Available | 747 | Open in IMG/M |
| 3300004481|Ga0069718_15990746 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300005580|Ga0049083_10127865 | Not Available | 875 | Open in IMG/M |
| 3300005581|Ga0049081_10195903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300005662|Ga0078894_10636679 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300006802|Ga0070749_10557645 | Not Available | 620 | Open in IMG/M |
| 3300006917|Ga0075472_10153687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 1130 | Open in IMG/M |
| 3300007363|Ga0075458_10065042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
| 3300007516|Ga0105050_10160924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → unclassified Cryobacterium → Cryobacterium sp. Hh7 | 1428 | Open in IMG/M |
| 3300007516|Ga0105050_10200709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
| 3300007516|Ga0105050_10254546 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300007516|Ga0105050_10254550 | Not Available | 1083 | Open in IMG/M |
| 3300007516|Ga0105050_10269866 | Not Available | 1045 | Open in IMG/M |
| 3300007516|Ga0105050_10273305 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300007516|Ga0105050_10384949 | Not Available | 843 | Open in IMG/M |
| 3300007523|Ga0105052_10265425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1146 | Open in IMG/M |
| 3300007523|Ga0105052_10273886 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
| 3300007523|Ga0105052_10354701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300007542|Ga0099846_1075770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1253 | Open in IMG/M |
| 3300007708|Ga0102859_1143121 | Not Available | 700 | Open in IMG/M |
| 3300007722|Ga0105051_10213808 | Not Available | 1473 | Open in IMG/M |
| 3300007722|Ga0105051_10215923 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300007722|Ga0105051_10520119 | Not Available | 880 | Open in IMG/M |
| 3300007722|Ga0105051_10889470 | Not Available | 642 | Open in IMG/M |
| 3300007722|Ga0105051_10994262 | Not Available | 601 | Open in IMG/M |
| 3300008448|Ga0114876_1078062 | Not Available | 1384 | Open in IMG/M |
| 3300008448|Ga0114876_1092697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
| 3300008448|Ga0114876_1156426 | Not Available | 824 | Open in IMG/M |
| 3300008450|Ga0114880_1109785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| 3300008450|Ga0114880_1182013 | Not Available | 724 | Open in IMG/M |
| 3300009026|Ga0102829_1205936 | Not Available | 640 | Open in IMG/M |
| 3300009056|Ga0102860_1045606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1175 | Open in IMG/M |
| 3300009075|Ga0105090_11025974 | Not Available | 504 | Open in IMG/M |
| 3300009161|Ga0114966_10261365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1064 | Open in IMG/M |
| 3300009161|Ga0114966_10486217 | Not Available | 706 | Open in IMG/M |
| 3300009163|Ga0114970_10062213 | Not Available | 2379 | Open in IMG/M |
| 3300009163|Ga0114970_10255927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300009169|Ga0105097_10065669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1965 | Open in IMG/M |
| 3300009181|Ga0114969_10221551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
| 3300009181|Ga0114969_10242549 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300009185|Ga0114971_10268529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
| 3300009187|Ga0114972_10518493 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010160|Ga0114967_10512851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 584 | Open in IMG/M |
| 3300010885|Ga0133913_10248402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4724 | Open in IMG/M |
| 3300010885|Ga0133913_10325245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4071 | Open in IMG/M |
| 3300010885|Ga0133913_11170279 | Not Available | 1974 | Open in IMG/M |
| 3300012017|Ga0153801_1010866 | Not Available | 1658 | Open in IMG/M |
| 3300012666|Ga0157498_1022408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300012667|Ga0157208_10032945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300012706|Ga0157627_1106329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
| 3300012709|Ga0157608_1172161 | Not Available | 676 | Open in IMG/M |
| 3300012714|Ga0157601_1030416 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
| 3300012775|Ga0138280_1083252 | Not Available | 545 | Open in IMG/M |
| 3300013005|Ga0164292_10033810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4109 | Open in IMG/M |
| 3300013005|Ga0164292_10958753 | Not Available | 535 | Open in IMG/M |
| 3300013092|Ga0163199_1262589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300013310|Ga0157622_1172484 | Not Available | 618 | Open in IMG/M |
| 3300013372|Ga0177922_10845810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300014811|Ga0119960_1069326 | Not Available | 617 | Open in IMG/M |
| 3300017701|Ga0181364_1023437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
| 3300017716|Ga0181350_1117865 | Not Available | 640 | Open in IMG/M |
| 3300017723|Ga0181362_1077373 | Not Available | 672 | Open in IMG/M |
| 3300017736|Ga0181365_1006520 | Not Available | 2884 | Open in IMG/M |
| 3300017777|Ga0181357_1180608 | Not Available | 763 | Open in IMG/M |
| 3300017778|Ga0181349_1086557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
| 3300017778|Ga0181349_1120828 | Not Available | 965 | Open in IMG/M |
| 3300017778|Ga0181349_1304648 | Not Available | 516 | Open in IMG/M |
| 3300017780|Ga0181346_1075954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300017780|Ga0181346_1287976 | Not Available | 561 | Open in IMG/M |
| 3300017784|Ga0181348_1084068 | Not Available | 1259 | Open in IMG/M |
| 3300017784|Ga0181348_1208965 | Not Available | 695 | Open in IMG/M |
| 3300017784|Ga0181348_1271570 | Not Available | 578 | Open in IMG/M |
| 3300017785|Ga0181355_1103200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
| 3300017785|Ga0181355_1111675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300017785|Ga0181355_1136415 | Not Available | 996 | Open in IMG/M |
| 3300017785|Ga0181355_1148036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
| 3300017785|Ga0181355_1273014 | Not Available | 643 | Open in IMG/M |
| 3300017785|Ga0181355_1300916 | Not Available | 602 | Open in IMG/M |
| 3300019784|Ga0181359_1228465 | Not Available | 580 | Open in IMG/M |
| 3300020159|Ga0211734_10275193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300020172|Ga0211729_10906452 | Not Available | 502 | Open in IMG/M |
| 3300020551|Ga0208360_1022189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300020553|Ga0208855_1022436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300021141|Ga0214163_1130536 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021963|Ga0222712_10590320 | Not Available | 643 | Open in IMG/M |
| 3300021963|Ga0222712_10660737 | Not Available | 595 | Open in IMG/M |
| 3300022190|Ga0181354_1131007 | Not Available | 799 | Open in IMG/M |
| 3300022190|Ga0181354_1182252 | Not Available | 637 | Open in IMG/M |
| 3300022223|Ga0224501_10385930 | Not Available | 696 | Open in IMG/M |
| 3300022407|Ga0181351_1088224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
| 3300022407|Ga0181351_1140204 | Not Available | 883 | Open in IMG/M |
| 3300023184|Ga0214919_10150831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1845 | Open in IMG/M |
| 3300023184|Ga0214919_10390162 | Not Available | 908 | Open in IMG/M |
| 3300023301|Ga0209414_1020580 | All Organisms → Viruses → Predicted Viral | 2185 | Open in IMG/M |
| 3300023301|Ga0209414_1026415 | All Organisms → Viruses → Predicted Viral | 1842 | Open in IMG/M |
| 3300024502|Ga0255181_1059280 | Not Available | 643 | Open in IMG/M |
| 3300024513|Ga0255144_1026719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
| 3300024513|Ga0255144_1070349 | Not Available | 579 | Open in IMG/M |
| 3300024515|Ga0255183_1081777 | Not Available | 655 | Open in IMG/M |
| 3300025451|Ga0208426_1030670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300025645|Ga0208643_1124186 | Not Available | 681 | Open in IMG/M |
| 3300025889|Ga0208644_1031658 | Not Available | 3160 | Open in IMG/M |
| 3300025896|Ga0208916_10266247 | Not Available | 745 | Open in IMG/M |
| 3300027155|Ga0255081_1115468 | Not Available | 500 | Open in IMG/M |
| 3300027468|Ga0209247_1034551 | Not Available | 711 | Open in IMG/M |
| 3300027503|Ga0255182_1068416 | Not Available | 878 | Open in IMG/M |
| 3300027508|Ga0255072_1008895 | Not Available | 2174 | Open in IMG/M |
| 3300027578|Ga0255075_1003337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3571 | Open in IMG/M |
| 3300027578|Ga0255075_1013522 | All Organisms → Viruses → Predicted Viral | 1634 | Open in IMG/M |
| 3300027581|Ga0209651_1102527 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300027586|Ga0208966_1057952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300027679|Ga0209769_1117105 | Not Available | 855 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1134434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300027734|Ga0209087_1096002 | Not Available | 1264 | Open in IMG/M |
| 3300027736|Ga0209190_1232153 | Not Available | 740 | Open in IMG/M |
| 3300027754|Ga0209596_1041673 | Not Available | 2477 | Open in IMG/M |
| 3300027754|Ga0209596_1122596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
| 3300027769|Ga0209770_10338372 | Not Available | 567 | Open in IMG/M |
| 3300027782|Ga0209500_10207272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300027782|Ga0209500_10384519 | Not Available | 569 | Open in IMG/M |
| 3300027785|Ga0209246_10118799 | Not Available | 1037 | Open in IMG/M |
| 3300027797|Ga0209107_10382665 | Not Available | 645 | Open in IMG/M |
| 3300027804|Ga0209358_10325149 | Not Available | 748 | Open in IMG/M |
| 3300027816|Ga0209990_10407304 | Not Available | 590 | Open in IMG/M |
| 3300027899|Ga0209668_11172044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300027976|Ga0209702_10110641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
| 3300027976|Ga0209702_10138204 | Not Available | 1090 | Open in IMG/M |
| 3300027976|Ga0209702_10140623 | Not Available | 1076 | Open in IMG/M |
| 3300027976|Ga0209702_10142381 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300027976|Ga0209702_10152495 | Not Available | 1019 | Open in IMG/M |
| 3300027976|Ga0209702_10187767 | Not Available | 888 | Open in IMG/M |
| 3300027976|Ga0209702_10263325 | Not Available | 711 | Open in IMG/M |
| 3300027976|Ga0209702_10294248 | Not Available | 662 | Open in IMG/M |
| 3300027976|Ga0209702_10409223 | Not Available | 534 | Open in IMG/M |
| 3300027983|Ga0209284_10052090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2252 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1126340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10183199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
| 3300031772|Ga0315288_11730523 | Not Available | 502 | Open in IMG/M |
| 3300031784|Ga0315899_11596126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300031857|Ga0315909_10199660 | Not Available | 1586 | Open in IMG/M |
| 3300031857|Ga0315909_10387204 | Not Available | 1007 | Open in IMG/M |
| 3300031857|Ga0315909_10893666 | Not Available | 549 | Open in IMG/M |
| 3300031951|Ga0315904_10665480 | Not Available | 882 | Open in IMG/M |
| 3300031952|Ga0315294_11200228 | Not Available | 616 | Open in IMG/M |
| 3300031963|Ga0315901_10883154 | Not Available | 638 | Open in IMG/M |
| 3300031999|Ga0315274_10126312 | Not Available | 3282 | Open in IMG/M |
| 3300031999|Ga0315274_10295562 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| 3300032053|Ga0315284_10280653 | Not Available | 2108 | Open in IMG/M |
| 3300032053|Ga0315284_12063755 | Not Available | 575 | Open in IMG/M |
| 3300032053|Ga0315284_12518241 | Not Available | 501 | Open in IMG/M |
| 3300032116|Ga0315903_10622052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300032116|Ga0315903_11176991 | Not Available | 519 | Open in IMG/M |
| 3300032462|Ga0335396_10065929 | Not Available | 2404 | Open in IMG/M |
| 3300032462|Ga0335396_10244097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
| 3300032462|Ga0335396_10274107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1102 | Open in IMG/M |
| 3300032462|Ga0335396_10355729 | Not Available | 950 | Open in IMG/M |
| 3300032462|Ga0335396_10418425 | Not Available | 862 | Open in IMG/M |
| 3300033233|Ga0334722_10466009 | Not Available | 909 | Open in IMG/M |
| 3300033994|Ga0334996_0031325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3397 | Open in IMG/M |
| 3300033994|Ga0334996_0209244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
| 3300033996|Ga0334979_0173328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
| 3300034012|Ga0334986_0477448 | Not Available | 617 | Open in IMG/M |
| 3300034020|Ga0335002_0126317 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
| 3300034022|Ga0335005_0087797 | Not Available | 2043 | Open in IMG/M |
| 3300034060|Ga0334983_0466161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300034061|Ga0334987_0124034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1939 | Open in IMG/M |
| 3300034062|Ga0334995_0300390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| 3300034062|Ga0334995_0340595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300034066|Ga0335019_0299265 | Not Available | 1010 | Open in IMG/M |
| 3300034082|Ga0335020_0220569 | Not Available | 944 | Open in IMG/M |
| 3300034082|Ga0335020_0393995 | Not Available | 668 | Open in IMG/M |
| 3300034101|Ga0335027_0328026 | Not Available | 1021 | Open in IMG/M |
| 3300034102|Ga0335029_0133813 | Not Available | 1714 | Open in IMG/M |
| 3300034102|Ga0335029_0574139 | Not Available | 638 | Open in IMG/M |
| 3300034103|Ga0335030_0826488 | Not Available | 540 | Open in IMG/M |
| 3300034104|Ga0335031_0247585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1183 | Open in IMG/M |
| 3300034104|Ga0335031_0560735 | Not Available | 682 | Open in IMG/M |
| 3300034104|Ga0335031_0631030 | Not Available | 627 | Open in IMG/M |
| 3300034105|Ga0335035_0553087 | Not Available | 619 | Open in IMG/M |
| 3300034105|Ga0335035_0676830 | Not Available | 533 | Open in IMG/M |
| 3300034106|Ga0335036_0577019 | Not Available | 687 | Open in IMG/M |
| 3300034106|Ga0335036_0583878 | Not Available | 681 | Open in IMG/M |
| 3300034106|Ga0335036_0599425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300034112|Ga0335066_0280160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300034120|Ga0335056_0347589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300034166|Ga0335016_0478338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300034167|Ga0335017_0675465 | Not Available | 527 | Open in IMG/M |
| 3300034200|Ga0335065_0276080 | Not Available | 1069 | Open in IMG/M |
| 3300034283|Ga0335007_0586966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300034356|Ga0335048_0408169 | Not Available | 672 | Open in IMG/M |
| 3300034356|Ga0335048_0475894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.12% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 14.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.13% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.85% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.88% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 2.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.44% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.44% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.44% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.48% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.48% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.48% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LV_Brine_h2_0102DRAFT_10143874 | 3300000405 | Hypersaline | MIYPQGTSAALIAVALAEVGTVETGNNLTKYGKHGR* |
| LV_Brine_h2_0102DRAFT_10164964 | 3300000405 | Hypersaline | MIYPQGTSAALIEAALAEVGTVETGNNLTKYGKHGR* |
| LV_Brine_h2_0102DRAFT_10371611 | 3300000405 | Hypersaline | MIYPQGTSAALIEVALAEVGTVETGENLTKYGKFTK |
| JGI1221J15618_10057181 | 3300001523 | Hypersaline | MIYPQGTRAAMIEVALAEVGTVETGENLTEYGKHMKANGLPW |
| B570J29032_1088990051 | 3300002408 | Freshwater | MIYPIGTSAALIEIAKAEIGTIEEGNNLTKYGKFTKADGLPWCGSFINWC |
| B570J29032_1091365333 | 3300002408 | Freshwater | LNNPVGTAAALIEVALIEIGTVETGNNLTKYGKYTKADGLPWCGSFV |
| B570J40625_1003711981 | 3300002835 | Freshwater | VTYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNW |
| B570J40625_1010893863 | 3300002835 | Freshwater | MQNTNLNYPSGTAAAIIEVAIAEVGTVEKGENLTKYGKFTKADGLPWCGSFVNWCA |
| B570J40625_1010957051 | 3300002835 | Freshwater | VTYPAGTNARLIEVAAAEVGTVEEGDNLTKYGKFTKADGLPWCG |
| B570J40625_1011036791 | 3300002835 | Freshwater | MTYPDGTNARLIEVALAEVGTVETGDNLTKYGKFTKADGLPWCGSF |
| JGI25908J49247_100432132 | 3300003277 | Freshwater Lake | MTYPQGTAAAVINVALAEVGTVEKGENLTKYGKFTKADGLR* |
| JGI25909J50240_10417133 | 3300003393 | Freshwater Lake | MTYPQGTAAAVINVALAEVGTVEKGENLTKYGKFTKADGLPWC |
| Ga0066182_101209211 | 3300004125 | Freshwater Lake | MSYPQGTSAALIEAAAAEVGTVEEGDNLTKYGKFTKADGLPWCGSFVNW |
| Ga0066602_106085773 | 3300004151 | Freshwater | MSYPIGTAAAVVEVALKEVGTIEEGDNLTKYGKFTKADGLPWC |
| Ga0069718_156736383 | 3300004481 | Sediment | MSNYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPW |
| Ga0069718_159907461 | 3300004481 | Sediment | MTYPIGTAAAVVEVALKEVGYVEEPDNITKFGKFTKADGLPWCGSFCNWVF |
| Ga0049083_101278653 | 3300005580 | Freshwater Lentic | MTYPQGTAAAVINVALAEVGTVEKGENLTKYGKFTKADG |
| Ga0049081_101959031 | 3300005581 | Freshwater Lentic | MYPEGTAARIIEVALAEVGTVETGDNLTKYGKFTKADG |
| Ga0078894_106366791 | 3300005662 | Freshwater Lake | MTYPQGTNARLIEIAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNW |
| Ga0070749_105576451 | 3300006802 | Aqueous | MSYPESSAARLIEVALNEVGYVEEPINLTKYGKHTMADGLPWCGSFVM |
| Ga0075472_101536872 | 3300006917 | Aqueous | MAYPQGTAPALIEVAKAEIGTIEEGDNLTKYGEFT |
| Ga0075458_100650421 | 3300007363 | Aqueous | MTYPIGTAAHFIDVALAEVGTVEEGDNLTKYGKFTKADGLPWC |
| Ga0105050_101609241 | 3300007516 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTKA |
| Ga0105050_102007091 | 3300007516 | Freshwater | MIYPQGTSAGLIEVALAEVGTVETGENLTKYGQHMKANGLPWCGS |
| Ga0105050_102545463 | 3300007516 | Freshwater | MIYPQGTSAALIEVALAEVGTVETGENLTKYGKFTKA |
| Ga0105050_102545503 | 3300007516 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGKNLTKYGKFTKADGLPWCGSFVNWC |
| Ga0105050_102698661 | 3300007516 | Freshwater | MIYPQGTRAAMIEVALAQVGTVETGENLTKYGKHMK |
| Ga0105050_102733051 | 3300007516 | Freshwater | MIYPQGTRAAMVEVALAEVGTVETGENLTKYGKHMK |
| Ga0105050_103849493 | 3300007516 | Freshwater | LSFPNGTSAALIAVALAEVGTVETGENLTKYGKFTKADG |
| Ga0105052_102654253 | 3300007523 | Freshwater | MIYPQGTRAAMVEVALAEVGTVETGENLTKYGKHMKAN |
| Ga0105052_102738863 | 3300007523 | Freshwater | MIYPQGTSAALIEVALAEVGTVETGENLTKYGKFTKADGLPWCGSFVNWCA |
| Ga0105052_103547011 | 3300007523 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTKADGLPWCGSFV |
| Ga0099846_10757701 | 3300007542 | Aqueous | VSNYPDGTNARLIEVAIAEIGTIEEGDNLTKYGKFTKA |
| Ga0102859_11431211 | 3300007708 | Estuarine | MNYPIGTAAAALEIAKAEIGTIEEGDNLTKYGAFTKANGLPWCGS |
| Ga0105051_102138084 | 3300007722 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFT |
| Ga0105051_102159231 | 3300007722 | Freshwater | MIYPQGTAAALIAVALAEVGTVETGENLTKYGKFTKADGLPWCGSFVNWCAHQ |
| Ga0105051_105201193 | 3300007722 | Freshwater | MIYPQGTRAAMIEVALAEVGTVETGENLTKYGKFTKADGLPWCGSFVN |
| Ga0105051_108894703 | 3300007722 | Freshwater | MIYPQGTRAALVEVALAEVGTVETGENLTKYGKHMK |
| Ga0105051_109942621 | 3300007722 | Freshwater | MIYPQGTSAAMVEVALAEVGTVETGENLTKYGKFTKADGLPWCGSFVN |
| Ga0114876_10780624 | 3300008448 | Freshwater Lake | MIYPLGTSAAVIELALAEVGTIEEGDNLTKYGEFTKANG |
| Ga0114876_10926974 | 3300008448 | Freshwater Lake | MYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWC |
| Ga0114876_11564261 | 3300008448 | Freshwater Lake | MTYPIGTAAAVVEVALAEVGTVEEGDNLTKYGKFTKADGLPW |
| Ga0114880_11097851 | 3300008450 | Freshwater Lake | MTYPTGTAARLVEVALAEVGTIEEGDNLTKYGKFMKADGLPWCGSFVNWC |
| Ga0114880_11820131 | 3300008450 | Freshwater Lake | MTFPQGTNARLIEVAAAEVGTVEEGDNLTKYGKFT |
| Ga0102829_12059361 | 3300009026 | Estuarine | MSNYPDGTAARIIEVALAEVGTVETGDNLTKYGKFTKADGLPWCGSFVNWC |
| Ga0102860_10456061 | 3300009056 | Estuarine | VEHLTKIYPDGTAARIIEVALAEVGTVETGENLTKYGK |
| Ga0105090_110259741 | 3300009075 | Freshwater Sediment | VSNYPNGTNARLIEVAAAEIGTVEEGDNLTKYGKFTKAD |
| Ga0114966_102613651 | 3300009161 | Freshwater Lake | VSNYPQGTNARLIEVAAAEIGTIEEGDNLTKYGEFTKANGLPW |
| Ga0114966_104862171 | 3300009161 | Freshwater Lake | MSDYPDGTAARLIEVALKEVGTIEDGDNLVKYNDRNG |
| Ga0114970_100622131 | 3300009163 | Freshwater Lake | MFPDGTAARIIEVALAEIGTVETGENLTKYGKFTNADGLPWCGSFVN |
| Ga0114970_102559271 | 3300009163 | Freshwater Lake | MEDLTKMYPDGTAARIIEVALAEIGTVETGENLTKYGKFTKADGL |
| Ga0105097_100656691 | 3300009169 | Freshwater Sediment | MNYPVGTAAAVVEVALAEVGTVEEGDNLTKYGKFTKADGLPWCGSFVNW |
| Ga0114969_102215511 | 3300009181 | Freshwater Lake | MFPDGTAARIIEIALAEIGTIETGENLTKYGKFTKAD |
| Ga0114969_102425491 | 3300009181 | Freshwater Lake | MYPDGTAARIIEVALAEIGTVETGDNLTKYGKFTKADGLPWC |
| Ga0114971_102685291 | 3300009185 | Freshwater Lake | VEHLTKIYPEGTAARIIEVALAEIGTVETGENLTKYGKFTKADGLPWCG |
| Ga0114972_105184933 | 3300009187 | Freshwater Lake | MTYPIGSAAYAIEIALNEQGTIEEPENITKYGKFTKADGLPWCGSFC |
| Ga0114967_105128511 | 3300010160 | Freshwater Lake | VTNYPDGTAARIIEVALAEIDTVETGDNLTKYGKF |
| Ga0129333_110204691 | 3300010354 | Freshwater To Marine Saline Gradient | MNYPEQTAARLIEIALNEVGYVEEPVNVTKYGKHTMADGLPWCGS |
| Ga0133913_102484021 | 3300010885 | Freshwater Lake | MSYPIGSAAHAIEIALAEQGTIEEPENITKYGKFTKADGLPWCGSFCNWV |
| Ga0133913_103252451 | 3300010885 | Freshwater Lake | MSYPIGSAALAIEIALAEQGTIEEPENITKYGKFTKADGLPWCGSFCNWV |
| Ga0133913_111702794 | 3300010885 | Freshwater Lake | MTFPNGTLHRVIEIALGEVGTVEEGDNLTKYGKAFGVDGLPWC |
| Ga0153801_10108664 | 3300012017 | Freshwater | MYPVGTAAAVVEVALAEVGTVEEGDNLTKYGKFTKADGLPWCG |
| Ga0157498_10224081 | 3300012666 | Freshwater, Surface Ice | VTFPLGTSAAVIELAMAEVGTVETGDNLTKYGEFTKAN |
| Ga0157208_100329453 | 3300012667 | Freshwater | MTYPIGTAAHFIDVALKEVGTVEEGDNLTKYGKFTK |
| Ga0157627_11063291 | 3300012706 | Freshwater | MSNYPQGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKA |
| Ga0157608_11721611 | 3300012709 | Freshwater | MSNYPQGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNW |
| Ga0157601_10304161 | 3300012714 | Freshwater | MTYPQGTNARLIEIAAAEVGTVEEGDNLTKYGKFTKADGLPWC |
| Ga0138280_10832521 | 3300012775 | Freshwater Lake | MTYPDGTNARLIEIAAAEIGTVEEGDNLTKYGKFTKADGLPWCGSFINW |
| Ga0164292_100338105 | 3300013005 | Freshwater | MTYPIGTAAKVVEVALAEVGTVEEGNNLTKYGKFTKADGL |
| Ga0164292_109587532 | 3300013005 | Freshwater | MSYPIGTAAAVVEVALKEVGTVEEGDNLTKYGKFTK |
| Ga0163199_12625891 | 3300013092 | Freshwater | MKDLTAMYPDGTAAKIIDVALAEIGTVETGVNLTKYGK |
| Ga0157622_11724841 | 3300013310 | Freshwater | MTYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKA |
| Ga0177922_108458101 | 3300013372 | Freshwater | MTNYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKF |
| Ga0119960_10693261 | 3300014811 | Aquatic | MTYPIGSAAHAIEIAKAEIGTIEEGDNLTKYGEFTKANGLPW |
| Ga0181364_10234371 | 3300017701 | Freshwater Lake | VIYPDGTNARLIEVAAAEVGTIEESDNLTKYGKFTGFDGQPWCGSFV |
| Ga0181350_11178651 | 3300017716 | Freshwater Lake | MSNYPNGTAARIIEVALAEVGTIETGENLTKYGKFTKADGL |
| Ga0181362_10773733 | 3300017723 | Freshwater Lake | MTYPQGTAAALIAAALAEVGTVEKGENLTKYGKFTKADGLPW |
| Ga0181365_10065201 | 3300017736 | Freshwater Lake | MSQYPNGTVARIIEVALAEIGTIETGENVTKYGAFTKADGLPWCGSFVNWCYDQA |
| Ga0181357_11806081 | 3300017777 | Freshwater Lake | MYPQGTSAALIEIAKAEIGTIEEGDNLTKYGKFTKADGFP |
| Ga0181349_10865571 | 3300017778 | Freshwater Lake | MTYPDGTNARLIEVAAAEIGTIEEGDNLTKYGKFTKADG |
| Ga0181349_11208283 | 3300017778 | Freshwater Lake | MYPEGTAARIIEVALAEVGTIETGENLTKYGKFTKADGLPWCGSFCNW |
| Ga0181349_13046481 | 3300017778 | Freshwater Lake | MTYPQGTAAALIAAALAEVGTIEQGDNLTKYGKFTKADGLP |
| Ga0181346_10759541 | 3300017780 | Freshwater Lake | MTYPQGTNARLIEVAAAEVGTIEEGNNLTKYGKFTNADG |
| Ga0181346_12879761 | 3300017780 | Freshwater Lake | LVNVIPLGTAAKVIEVAVAEIGYVEKPENITKYGEYMKADGLPWCGS |
| Ga0181348_10840684 | 3300017784 | Freshwater Lake | MNQSSSYPDGTVARIIEVALAEIGTIETDENVTKYGAFTKADGLPWCGSFVNWC |
| Ga0181348_12089653 | 3300017784 | Freshwater Lake | MYPEGTAAHIIEVALAEVGTVETGDNLTKYGKFTKADGLPWCGSFCN |
| Ga0181348_12715701 | 3300017784 | Freshwater Lake | MYPDGTAARIIEVVLAEVGTIETGENLTKYGKFTKI |
| Ga0181355_11032001 | 3300017785 | Freshwater Lake | MSNYPEGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPWCGSFCNW |
| Ga0181355_11116753 | 3300017785 | Freshwater Lake | MSYPEGTAARIIEVALAEVGTVETGDNLTKYGKFTKADGLPWCGSFC |
| Ga0181355_11364153 | 3300017785 | Freshwater Lake | MIYPQGTSAAFIEIAKAEIGTIEEGDNLTKYGKFTKADG |
| Ga0181355_11480363 | 3300017785 | Freshwater Lake | MFPQGTSARLIEVAAAEVGTIEEKENLTKYGKFTFP |
| Ga0181355_12730141 | 3300017785 | Freshwater Lake | MIFPQGTAAALIAAALAEVGTVETGVNLTKYGKFTK |
| Ga0181355_13009161 | 3300017785 | Freshwater Lake | MTFPNGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKAD |
| Ga0181359_12284651 | 3300019784 | Freshwater Lake | MNKYPDGTAARIIEVALAEVGTVETGENLTKYGKFTKAD |
| Ga0211734_102751933 | 3300020159 | Freshwater | MNYPHGTSARLIEVAAAEVGTVEEGDNLTKYGKFM |
| Ga0211729_109064521 | 3300020172 | Freshwater | VSNYPQGTNARLIEVAAAEVGTIEEGDNLTKYGEFTKANGLPWCGSF |
| Ga0208360_10221893 | 3300020551 | Freshwater | VSIYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFMKADGLPWCGSFVNWCCSQ |
| Ga0208855_10224361 | 3300020553 | Freshwater | MIYPIGTAAAVVEVALKEVGTIEEGDNLTKYGKFTKADGLPWCGSFVN |
| Ga0214163_11305363 | 3300021141 | Freshwater | MTFPIGTAAHFIDVALKEVGTVEEGNNLTKYGKFTKADGLPWCGS |
| Ga0222712_105903203 | 3300021963 | Estuarine Water | MTYPDGTSARLIEVAAAEIGTIEEGNNLTKYGKFTKADGLPWCGS |
| Ga0222712_106607371 | 3300021963 | Estuarine Water | MKQNYSYPDGTAARIIDVALAEVGTVETGDNLTKYGKFTK |
| Ga0181354_11310071 | 3300022190 | Freshwater Lake | MKPNFFYPDGTAAKIIDVALAEIGTIEEGNNFTKYGKF |
| Ga0181354_11822523 | 3300022190 | Freshwater Lake | MSYPKDTSAALIEVAKAEIGTVEQGDNLTKYGKFT |
| Ga0224501_103859301 | 3300022223 | Sediment | VIPLGTAAKVIEVAVAEVGYVEKPENITKYGEYMKADGLPWCGS |
| Ga0181351_10882244 | 3300022407 | Freshwater Lake | MTYPDGTNARLIEVAAAEVGTVEEGDNLTKYGKFTKADGLPWCG |
| Ga0181351_11402043 | 3300022407 | Freshwater Lake | MNPSSSYPDGTAARIIEVALAEIGTIETGENVTKYGAFTKADGLPWCGS |
| Ga0214919_101508314 | 3300023184 | Freshwater | MYPDGTAAKIIEVALAEIGTIETGENITKYGKFTKADGLPW |
| Ga0214919_103901621 | 3300023184 | Freshwater | MYPDGTAARIIEVALAEIGTVETGDNLTKYGKFTKADGLPWCGSFC |
| Ga0209414_10205804 | 3300023301 | Hypersaline | MIYPQGTSAALIEAALAEVGTVETGNNLTKYGKHGR |
| Ga0209414_10264154 | 3300023301 | Hypersaline | MIYPQGTSAALIAVALAEVGTVETGNNLTKYGKHGR |
| Ga0255181_10592803 | 3300024502 | Freshwater | MTYPQGTAALAISIANTEVGTIEEGDNLTKYGKFMKADGLPWCGSFCN |
| Ga0255144_10267191 | 3300024513 | Freshwater | MTYPQGTAALAISIANTEVGTIEEGDNLTKYGKFMK |
| Ga0255144_10703491 | 3300024513 | Freshwater | MIYPQGTAALAIEIALKEQGTIEEPENITKYGKFMKADGLPWCGSFCNWVLAQAGVKV |
| Ga0255183_10817773 | 3300024515 | Freshwater | MTFPQGTAAHAVEIAKGEIGTVEQGENLTKYGEFTKANGLPWCGSFCN |
| Ga0208426_10306703 | 3300025451 | Aqueous | MYPEGSAARIIEVALAEIGTVETGDNLTKYGKFTKADGLP |
| Ga0208643_11241861 | 3300025645 | Aqueous | MYPDGTAARIIEVALAEIGTVETGENLTKYGKFTK |
| Ga0208644_10316581 | 3300025889 | Aqueous | MIYPKGTAAHALEIAKAEIGTIEEGDNLTKYGEFTKANGLPWCGSFC |
| Ga0208916_102662473 | 3300025896 | Aqueous | MTYPDGTAAKIIEIALAEVGTIEEGDNLTKYGKFTKADGL |
| Ga0255081_11154681 | 3300027155 | Freshwater | MTYPNGTAALAISIANGEVGNIEEGDNLTPYGKFMKADGLP |
| Ga0209247_10345511 | 3300027468 | Freshwater Lake | MTYPQGTAAAVINVALAEVGTVEKGENLTKYGKFTKADGLPW |
| Ga0255182_10684163 | 3300027503 | Freshwater | MTYPQGTAALAISIANTEVGTIEEGDNLTKYGKFMKADGLPW |
| Ga0255072_10088951 | 3300027508 | Freshwater | MSNYPDGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPW |
| Ga0255075_10033375 | 3300027578 | Freshwater | MYPEGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPWCGSFVNWC |
| Ga0255075_10135223 | 3300027578 | Freshwater | MSNYPDGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLP |
| Ga0209651_11025273 | 3300027581 | Freshwater Lake | MTYPQGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNWCA |
| Ga0208966_10579521 | 3300027586 | Freshwater Lentic | MTYPRGTAAALIATALVEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNW |
| Ga0209769_11171051 | 3300027679 | Freshwater Lake | MYPEGTAARIIEVALAEVGTIETGENLTKYGKFTKADGLPWCGSFCN |
| (restricted) Ga0247833_11344343 | 3300027730 | Freshwater | MSNYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNWC |
| Ga0209087_10960023 | 3300027734 | Freshwater Lake | VIYPQGTAAALIAAALAEVGTIEQGDNLTKYGKFTKADGLPWCGSFVNW |
| Ga0209190_12321531 | 3300027736 | Freshwater Lake | VEHLTKIYPDGTAARIIEVALAEIGTIETGENLTKYGKFTNADGLPWCGSF |
| Ga0209596_10416734 | 3300027754 | Freshwater Lake | MYPEGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPW |
| Ga0209596_11225963 | 3300027754 | Freshwater Lake | MNYPEGTAARIIEVALAEVGTVEIGENLTKYGKFTKADGLPW |
| Ga0209770_103383721 | 3300027769 | Freshwater Lake | VEHLTKIYPEGTSAALIEIAKAEIGTIEEGDNLTKYGKFTKADGLPWCG |
| Ga0209500_102072723 | 3300027782 | Freshwater Lake | MSNYPEGTIQRFIEIAAAELGTIEEGNNLTKYGKFTGF |
| Ga0209500_103845193 | 3300027782 | Freshwater Lake | VTYPDGTNARLIEVAAAEIGTIEEGDNLTKYGEFTKADGLP |
| Ga0209246_101187991 | 3300027785 | Freshwater Lake | MTYPQGTAAAVINVALAEVGTVEKGENLTKYGKFTKADGLPWCGSFVNWC |
| Ga0209107_103826651 | 3300027797 | Freshwater And Sediment | MSNYPDGTSARIIEVALAEVGTVETGDNLTKYGKFTKA |
| Ga0209358_103251491 | 3300027804 | Freshwater Lake | MYPEGTAARIIEVALAEVGTVETGDNLTKYGKFTKADGLPWCG |
| Ga0209990_104073043 | 3300027816 | Freshwater Lake | MSNYPQGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCG |
| Ga0209668_106036203 | 3300027899 | Freshwater Lake Sediment | VTYPEQTPARLIEIALSEVGYIEEPVNITKYGKHAMADGLPWCGSFVMW |
| Ga0209668_111720443 | 3300027899 | Freshwater Lake Sediment | MYPDGTAARIIEVALAEVGTVEIGENLTKYGKFTKADGLPWCGSF |
| Ga0209702_101106413 | 3300027976 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTKADGLPWCGSF |
| Ga0209702_101382041 | 3300027976 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTKAD |
| Ga0209702_101406231 | 3300027976 | Freshwater | MIYPQGTSAAMIEVALAEVGTVETGENLTKYGKHMKANGLPWCGSF |
| Ga0209702_101423811 | 3300027976 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTKADGLPWCGSFVNW |
| Ga0209702_101524951 | 3300027976 | Freshwater | MIYPQGTAAALIAVALAEVGTVETGENLTKYGKFTKA |
| Ga0209702_101877671 | 3300027976 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTKADGLPWC |
| Ga0209702_102633251 | 3300027976 | Freshwater | MIYPQGTRAAMVEVALAEVGTVETGENLTKYGKHMKA |
| Ga0209702_102942483 | 3300027976 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTKADGLPWCGSFVNWC |
| Ga0209702_104092233 | 3300027976 | Freshwater | MIYPQGTRAAMIEVALAEVGTVETGENLTKYGKHMKAN |
| Ga0209284_100520904 | 3300027983 | Freshwater | MIYPQGTRAAMVEVALAEVGTVETGENLTKYGKHMKANGLP |
| (restricted) Ga0247844_11263401 | 3300028571 | Freshwater | VSNYPDGTNARLIEVAAAEIGTVEEGNNLTKYGKFTK |
| (restricted) Ga0247840_101831991 | 3300028581 | Freshwater | MSNYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNWCAA |
| Ga0315288_117305233 | 3300031772 | Sediment | LVSVIPLGTAAKVIEVAVAEVGYVEKPENITKYGEYMKADGLPW |
| Ga0315899_115961261 | 3300031784 | Freshwater | MSNYPNGTAALALEIAKAEIGTIEEGDNLTKYGKFTKADGLPW |
| Ga0315909_101996601 | 3300031857 | Freshwater | MTYPQGTNAKLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFV |
| Ga0315909_103872041 | 3300031857 | Freshwater | MTYPIGTAAAVVEVALAEVGTVEEGDNLTKYGKFT |
| Ga0315909_108936663 | 3300031857 | Freshwater | MTYPIGTAAAVVEVALKEVGTVEEGDNLTKYGKFTKADGLP |
| Ga0315904_106654803 | 3300031951 | Freshwater | MTYPTGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPW |
| Ga0315294_112002281 | 3300031952 | Sediment | LTKIYPEGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPWCGSF |
| Ga0315901_108831541 | 3300031963 | Freshwater | MTYPVGTAAAVVEVALAEVGTVEEGNNLTKYGKFTKADGLPWCGSFVNWCFNE |
| Ga0315274_101263125 | 3300031999 | Sediment | MYPDGTAARIIEVALAEVGTVETGDNLTKYGKFTKADGLPWCGSFCN |
| Ga0315274_102955624 | 3300031999 | Sediment | MYPDGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPWCG |
| Ga0315284_102806531 | 3300032053 | Sediment | MIYAQGTAAALIDVALAEVGTIDTGDNLTKYGKFTKADGLPWC |
| Ga0315284_120637551 | 3300032053 | Sediment | MYPEGTAARIIEVALAEIGTVETGENLTKYGKFTKADGLPW |
| Ga0315284_125182413 | 3300032053 | Sediment | VEHLTKIYPDGTSARIIEVALAEVGTVETGENLTKYGK |
| Ga0315903_106220523 | 3300032116 | Freshwater | MIYPDGTNARLIEVAAAEIGTVEEGNNLTKYGKFTKADGLP |
| Ga0315903_111769911 | 3300032116 | Freshwater | MTYPNGTAALALEIAKAEVGTIEEGDNLTKYGKFTKA |
| Ga0335396_100659291 | 3300032462 | Freshwater | MIYPQGTSAAMIEVALAEVGTVETGENLTKYGKFTKADGLPWCG |
| Ga0335396_102440971 | 3300032462 | Freshwater | MIYPQGTRAAMIEVALAQVGTVETGENLTKYGKHMKANGLPWCGSF |
| Ga0335396_102741071 | 3300032462 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTK |
| Ga0335396_103557293 | 3300032462 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKFTKADGL |
| Ga0335396_104184251 | 3300032462 | Freshwater | MIYPQGTSAALIEVALAEVGTVETGENLTKYGKFTKADGLPWCGS |
| Ga0334722_104660093 | 3300033233 | Sediment | MYPDGTSARIIEVALAEVGTVETGDNLTKYGKFTK |
| Ga0334996_0031325_3282_3395 | 3300033994 | Freshwater | MSNTIYPQGTSALAMSIALAEVGTIEQKENLTKYGKFM |
| Ga0334996_0209244_876_1034 | 3300033994 | Freshwater | MSIYPDGTNARLIEVAAAEVGTVEEGDNLTKYGKFTKADGLPWCGSFVNWCAA |
| Ga0334979_0173328_2_115 | 3300033996 | Freshwater | MYPQGTSAAFIEIAKAEIGTIEEGDNLTKYGKFTKADG |
| Ga0334986_0477448_488_616 | 3300034012 | Freshwater | MYPQGTSAALIEVAKAEIGTIEEGDNLTKYGKFTKADGLPWCG |
| Ga0335002_0126317_3_131 | 3300034020 | Freshwater | MSNYPDGTNARLIEVAADEVGTIEEGDNLTKYGKFTKADGLPW |
| Ga0335005_0087797_1930_2043 | 3300034022 | Freshwater | MTYPQGTAAAVIEVALAEVGTIEQGDNLTKYGKFTGAD |
| Ga0334983_0466161_3_137 | 3300034060 | Freshwater | MYPEGTAARIIEVALAEIGTVETGENLTKYGKFTKADGLPWCGSF |
| Ga0334987_0124034_1_156 | 3300034061 | Freshwater | MNYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNWCAA |
| Ga0334995_0300390_1_138 | 3300034062 | Freshwater | MYPDGTAARIIEVALAEVGTIETGENLTKYGKFTKADGLPWCGSFC |
| Ga0334995_0340595_830_964 | 3300034062 | Freshwater | MNYPIGTAAAVVEVALAEVGTVEEGDNLTKYGKFTKADGLPWCGS |
| Ga0335019_0299265_883_1008 | 3300034066 | Freshwater | MIYPQGTAARLIEVAAAEVGTIEEGDNVTKYGKFTKADGLPW |
| Ga0335020_0220569_3_131 | 3300034082 | Freshwater | MTYPNGTNARLIEVAAAEVGTVEEGDNLTKYGKFTKADGLPWC |
| Ga0335020_0393995_548_667 | 3300034082 | Freshwater | MSYPKGTAAQALEIAKAEIGTIEEGDNLTKYGAFTKANGL |
| Ga0335027_0328026_1_150 | 3300034101 | Freshwater | MTYPLGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNWC |
| Ga0335029_0133813_1_117 | 3300034102 | Freshwater | MSSYSSGTAAAFIAAALAEVGTVEKGENLTKYGKFTKAD |
| Ga0335029_0574139_1_138 | 3300034102 | Freshwater | MPYPNGTLHRVIEIALGEVGTVEEGDNLTKYGKAFGVDGLPWCGSF |
| Ga0335030_0826488_435_539 | 3300034103 | Freshwater | MTYPDGTNARLIEVAAAEVGTVEEGDNLTKYGKFT |
| Ga0335031_0247585_1_156 | 3300034104 | Freshwater | MSNYPQGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFVNWCA |
| Ga0335031_0560735_2_124 | 3300034104 | Freshwater | MNYPDGTAARIIEVALAEIGTVETGDNLTKYGKFTKADGLP |
| Ga0335031_0631030_1_159 | 3300034104 | Freshwater | MTYPEGTNARLIEVAAAEVGTIEEGNNLTKYGKFTKADGLPWCGSFVNWCAAQ |
| Ga0335035_0553087_2_115 | 3300034105 | Freshwater | MKFPLGTSAAFIEIAKAEIGTIEEGDNLTKYGKFTKAD |
| Ga0335035_0676830_408_533 | 3300034105 | Freshwater | MTFPQGTAAAVIAAALVEVGTVEKGENLTKYGKFTKADGLPW |
| Ga0335036_0577019_1_123 | 3300034106 | Freshwater | MYPDGTAARIIEVALDEVGTVETGENLTKYGKFTKADGLPW |
| Ga0335036_0583878_2_142 | 3300034106 | Freshwater | MTYPDGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCGSFV |
| Ga0335036_0599425_3_140 | 3300034106 | Freshwater | MTTNYPDGTPARIIEVALAEVGTVETGDNLTKYGKFTKADGLPWCG |
| Ga0335066_0280160_3_110 | 3300034112 | Freshwater | MTYPQGTAAAFIKVALAEVGTIEEGNNLTKYGKFTK |
| Ga0335033_0574671_405_527 | 3300034117 | Freshwater | VSYPVGTAAALIETAKAEIGVIEEGENLTKYGEFTKANGLP |
| Ga0335056_0347589_3_113 | 3300034120 | Freshwater | MYPDGTAARIIEVALAEVGTVETGDNLTKYGKFTKAD |
| Ga0335016_0478338_589_705 | 3300034166 | Freshwater | MTYPEGTAAALVETALAEVGTVETGDNLTKYGEFTGANG |
| Ga0335017_0675465_3_149 | 3300034167 | Freshwater | MNKYPDGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPWCGSFCN |
| Ga0335065_0276080_3_131 | 3300034200 | Freshwater | MTYPNGTAARIIEVALAEVGTVETGENLTKYGKFTKADGLPWC |
| Ga0335007_0586966_3_146 | 3300034283 | Freshwater | MEHLTKMYPEGTAARIIEVALAEVGTIETGENLTKYGKFTKADGLPWC |
| Ga0335048_0408169_529_672 | 3300034356 | Freshwater | MYPDGTAARIIEVALAEVGTVETGDNLTKYGKFTKADGLPWCGSFCNW |
| Ga0335048_0475894_461_601 | 3300034356 | Freshwater | MTTNYPDGTAARIIEVALAEIGTVETGENLTKYGKFTKADGLPWCGS |
| ⦗Top⦘ |