| Basic Information | |
|---|---|
| Family ID | F023737 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 209 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MLVAVQRLVKYAIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 209 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.60 % |
| % of genes near scaffold ends (potentially truncated) | 27.27 % |
| % of genes from short scaffolds (< 2000 bps) | 77.03 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.565 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.876 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.359 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.976 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.84% β-sheet: 0.00% Coil/Unstructured: 44.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 209 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 22.97 |
| PF02518 | HATPase_c | 17.22 |
| PF00903 | Glyoxalase | 16.75 |
| PF02687 | FtsX | 11.00 |
| PF12681 | Glyoxalase_2 | 8.61 |
| PF13426 | PAS_9 | 4.78 |
| PF13535 | ATP-grasp_4 | 1.44 |
| PF02371 | Transposase_20 | 0.96 |
| PF13472 | Lipase_GDSL_2 | 0.96 |
| PF01106 | NifU | 0.96 |
| PF00005 | ABC_tran | 0.96 |
| PF13191 | AAA_16 | 0.48 |
| PF01594 | AI-2E_transport | 0.48 |
| PF02738 | MoCoBD_1 | 0.48 |
| PF08541 | ACP_syn_III_C | 0.48 |
| PF13492 | GAF_3 | 0.48 |
| PF14346 | DUF4398 | 0.48 |
| PF12704 | MacB_PCD | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
|---|---|---|---|
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.04 % |
| Unclassified | root | N/A | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10752814 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300000559|F14TC_106745703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 672 | Open in IMG/M |
| 3300000956|JGI10216J12902_105617765 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300001431|F14TB_101140070 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300002561|JGI25384J37096_10003480 | All Organisms → cellular organisms → Bacteria | 5593 | Open in IMG/M |
| 3300002562|JGI25382J37095_10065259 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1368 | Open in IMG/M |
| 3300002912|JGI25386J43895_10152236 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 577 | Open in IMG/M |
| 3300004267|Ga0066396_10022492 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 862 | Open in IMG/M |
| 3300004268|Ga0066398_10002441 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300004268|Ga0066398_10213740 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 514 | Open in IMG/M |
| 3300004479|Ga0062595_101417334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
| 3300004633|Ga0066395_10061827 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300004633|Ga0066395_10166037 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1131 | Open in IMG/M |
| 3300004633|Ga0066395_10307463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 869 | Open in IMG/M |
| 3300005167|Ga0066672_10076262 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300005171|Ga0066677_10207714 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005179|Ga0066684_10304820 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300005180|Ga0066685_10001424 | All Organisms → cellular organisms → Bacteria | 10329 | Open in IMG/M |
| 3300005180|Ga0066685_10556251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 791 | Open in IMG/M |
| 3300005186|Ga0066676_10436573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 886 | Open in IMG/M |
| 3300005330|Ga0070690_100825297 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
| 3300005332|Ga0066388_100003378 | All Organisms → cellular organisms → Bacteria | 10314 | Open in IMG/M |
| 3300005332|Ga0066388_101392045 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005332|Ga0066388_102810082 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005355|Ga0070671_101289185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300005356|Ga0070674_100188169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1586 | Open in IMG/M |
| 3300005367|Ga0070667_101008864 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 777 | Open in IMG/M |
| 3300005440|Ga0070705_100548062 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300005445|Ga0070708_100048551 | All Organisms → cellular organisms → Bacteria | 3752 | Open in IMG/M |
| 3300005446|Ga0066686_10069828 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300005446|Ga0066686_10833449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300005467|Ga0070706_101406684 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 638 | Open in IMG/M |
| 3300005540|Ga0066697_10315825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300005552|Ga0066701_10613627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 661 | Open in IMG/M |
| 3300005554|Ga0066661_10017378 | All Organisms → cellular organisms → Bacteria | 3752 | Open in IMG/M |
| 3300005556|Ga0066707_10096499 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin122 | 1809 | Open in IMG/M |
| 3300005559|Ga0066700_10333806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300005598|Ga0066706_11330771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
| 3300005713|Ga0066905_100047696 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
| 3300005718|Ga0068866_10675710 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 706 | Open in IMG/M |
| 3300005719|Ga0068861_102583450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 512 | Open in IMG/M |
| 3300005764|Ga0066903_100028471 | All Organisms → cellular organisms → Bacteria | 6236 | Open in IMG/M |
| 3300005764|Ga0066903_100148057 | All Organisms → cellular organisms → Bacteria | 3363 | Open in IMG/M |
| 3300005983|Ga0081540_1043500 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300006032|Ga0066696_10716625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 642 | Open in IMG/M |
| 3300006049|Ga0075417_10576256 | Not Available | 571 | Open in IMG/M |
| 3300006163|Ga0070715_10150321 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1140 | Open in IMG/M |
| 3300006194|Ga0075427_10037757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300006196|Ga0075422_10024230 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2080 | Open in IMG/M |
| 3300006794|Ga0066658_10404006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
| 3300006844|Ga0075428_101297354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 766 | Open in IMG/M |
| 3300006844|Ga0075428_102423096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 538 | Open in IMG/M |
| 3300006844|Ga0075428_102631665 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006845|Ga0075421_100118668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3321 | Open in IMG/M |
| 3300006852|Ga0075433_10001981 | All Organisms → cellular organisms → Bacteria | 15405 | Open in IMG/M |
| 3300006852|Ga0075433_10236593 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300006852|Ga0075433_11312792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300006854|Ga0075425_101148777 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300006854|Ga0075425_101242977 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300006880|Ga0075429_100116502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2335 | Open in IMG/M |
| 3300006903|Ga0075426_10155665 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300006904|Ga0075424_100034762 | All Organisms → cellular organisms → Bacteria | 5229 | Open in IMG/M |
| 3300006904|Ga0075424_100111744 | All Organisms → cellular organisms → Bacteria | 2885 | Open in IMG/M |
| 3300007076|Ga0075435_100003704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10408 | Open in IMG/M |
| 3300007255|Ga0099791_10413657 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 650 | Open in IMG/M |
| 3300009137|Ga0066709_100000231 | All Organisms → cellular organisms → Bacteria | 26021 | Open in IMG/M |
| 3300009137|Ga0066709_101505726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300009137|Ga0066709_101697047 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300009143|Ga0099792_10322900 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300009147|Ga0114129_10039255 | All Organisms → cellular organisms → Bacteria | 6675 | Open in IMG/M |
| 3300009147|Ga0114129_12322661 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 643 | Open in IMG/M |
| 3300009162|Ga0075423_10470871 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300009162|Ga0075423_10512971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1261 | Open in IMG/M |
| 3300009162|Ga0075423_11097493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300009177|Ga0105248_13085695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 530 | Open in IMG/M |
| 3300009792|Ga0126374_10201874 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300010043|Ga0126380_10675990 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300010043|Ga0126380_11664391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 572 | Open in IMG/M |
| 3300010046|Ga0126384_10179544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1657 | Open in IMG/M |
| 3300010046|Ga0126384_11268188 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 682 | Open in IMG/M |
| 3300010046|Ga0126384_11483188 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300010047|Ga0126382_10410357 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300010047|Ga0126382_10767601 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 818 | Open in IMG/M |
| 3300010304|Ga0134088_10000389 | All Organisms → cellular organisms → Bacteria | 14519 | Open in IMG/M |
| 3300010336|Ga0134071_10193156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1002 | Open in IMG/M |
| 3300010359|Ga0126376_10140167 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1920 | Open in IMG/M |
| 3300010360|Ga0126372_12499046 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300010361|Ga0126378_11893379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300010362|Ga0126377_10322612 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1531 | Open in IMG/M |
| 3300010362|Ga0126377_10527059 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300010366|Ga0126379_10577725 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1206 | Open in IMG/M |
| 3300010376|Ga0126381_102145895 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 804 | Open in IMG/M |
| 3300010397|Ga0134124_10425507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1269 | Open in IMG/M |
| 3300010398|Ga0126383_13099892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 543 | Open in IMG/M |
| 3300010403|Ga0134123_13537841 | Not Available | 506 | Open in IMG/M |
| 3300012199|Ga0137383_10195797 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300012202|Ga0137363_10384264 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1167 | Open in IMG/M |
| 3300012203|Ga0137399_10014632 | All Organisms → cellular organisms → Bacteria | 4905 | Open in IMG/M |
| 3300012205|Ga0137362_10097187 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
| 3300012208|Ga0137376_10551470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 999 | Open in IMG/M |
| 3300012355|Ga0137369_11109195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300012582|Ga0137358_10188791 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300012582|Ga0137358_10388183 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300012685|Ga0137397_10057128 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
| 3300012918|Ga0137396_10000558 | All Organisms → cellular organisms → Bacteria | 18025 | Open in IMG/M |
| 3300012925|Ga0137419_10002049 | All Organisms → cellular organisms → Bacteria | 9067 | Open in IMG/M |
| 3300012929|Ga0137404_12117173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
| 3300012948|Ga0126375_10046374 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300012948|Ga0126375_11929964 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300012960|Ga0164301_10402093 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 959 | Open in IMG/M |
| 3300014150|Ga0134081_10085744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 977 | Open in IMG/M |
| 3300015264|Ga0137403_10030499 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 5706 | Open in IMG/M |
| 3300015371|Ga0132258_13155604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1138 | Open in IMG/M |
| 3300015372|Ga0132256_100782365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300015373|Ga0132257_100397572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1674 | Open in IMG/M |
| 3300016404|Ga0182037_10263534 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300017659|Ga0134083_10000286 | All Organisms → cellular organisms → Bacteria | 11915 | Open in IMG/M |
| 3300017792|Ga0163161_10822170 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300017966|Ga0187776_10006489 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 6178 | Open in IMG/M |
| 3300017966|Ga0187776_11168115 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 575 | Open in IMG/M |
| 3300018060|Ga0187765_10147745 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300018431|Ga0066655_10006723 | All Organisms → cellular organisms → Bacteria | 4769 | Open in IMG/M |
| 3300018431|Ga0066655_11047543 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300018433|Ga0066667_10017929 | All Organisms → cellular organisms → Bacteria | 3672 | Open in IMG/M |
| 3300018433|Ga0066667_10075224 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300018468|Ga0066662_11126979 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 787 | Open in IMG/M |
| 3300019789|Ga0137408_1121855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300020170|Ga0179594_10078853 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1158 | Open in IMG/M |
| 3300021476|Ga0187846_10199396 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300021560|Ga0126371_10212054 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300025899|Ga0207642_10538301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 720 | Open in IMG/M |
| 3300025922|Ga0207646_11300108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300026075|Ga0207708_12058009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 500 | Open in IMG/M |
| 3300026277|Ga0209350_1011775 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2803 | Open in IMG/M |
| 3300026285|Ga0209438_1074222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1103 | Open in IMG/M |
| 3300026296|Ga0209235_1016329 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 4036 | Open in IMG/M |
| 3300026297|Ga0209237_1113515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1158 | Open in IMG/M |
| 3300026309|Ga0209055_1088229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1268 | Open in IMG/M |
| 3300026317|Ga0209154_1053817 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300026331|Ga0209267_1109524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1170 | Open in IMG/M |
| 3300026334|Ga0209377_1008634 | All Organisms → cellular organisms → Bacteria | 5885 | Open in IMG/M |
| 3300026360|Ga0257173_1033543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 688 | Open in IMG/M |
| 3300026475|Ga0257147_1080723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 504 | Open in IMG/M |
| 3300026523|Ga0209808_1259957 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300026537|Ga0209157_1167990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 966 | Open in IMG/M |
| 3300026540|Ga0209376_1081139 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin122 | 1725 | Open in IMG/M |
| 3300026557|Ga0179587_10652825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 693 | Open in IMG/M |
| 3300027527|Ga0209684_1014963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1213 | Open in IMG/M |
| 3300027646|Ga0209466_1022437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1309 | Open in IMG/M |
| 3300027655|Ga0209388_1082004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
| 3300027821|Ga0209811_10161174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 836 | Open in IMG/M |
| 3300027873|Ga0209814_10001884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7572 | Open in IMG/M |
| 3300027873|Ga0209814_10010798 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3591 | Open in IMG/M |
| 3300027874|Ga0209465_10006043 | All Organisms → cellular organisms → Bacteria | 5295 | Open in IMG/M |
| 3300027874|Ga0209465_10282405 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 831 | Open in IMG/M |
| 3300027880|Ga0209481_10078621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1569 | Open in IMG/M |
| 3300027880|Ga0209481_10255268 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300027903|Ga0209488_10251313 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300027907|Ga0207428_10000682 | All Organisms → cellular organisms → Bacteria | 39734 | Open in IMG/M |
| 3300027909|Ga0209382_10099404 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3411 | Open in IMG/M |
| 3300027909|Ga0209382_11789933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300028380|Ga0268265_10288081 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300028381|Ga0268264_10785643 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300028536|Ga0137415_10018627 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 6887 | Open in IMG/M |
| 3300031184|Ga0307499_10019800 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1436 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10027014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1481 | Open in IMG/M |
| 3300031538|Ga0310888_10016593 | All Organisms → cellular organisms → Bacteria | 2983 | Open in IMG/M |
| 3300031547|Ga0310887_10104233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1412 | Open in IMG/M |
| 3300031573|Ga0310915_10915487 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
| 3300031668|Ga0318542_10730249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300031680|Ga0318574_10149517 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 1326 | Open in IMG/M |
| 3300031719|Ga0306917_10016201 | All Organisms → cellular organisms → Bacteria | 4466 | Open in IMG/M |
| 3300031720|Ga0307469_10070888 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
| 3300031720|Ga0307469_10423340 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300031720|Ga0307469_11167024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300031723|Ga0318493_10013095 | All Organisms → cellular organisms → Bacteria | 3493 | Open in IMG/M |
| 3300031723|Ga0318493_10716519 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300031724|Ga0318500_10094096 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300031724|Ga0318500_10455629 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
| 3300031724|Ga0318500_10601134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300031736|Ga0318501_10496564 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 665 | Open in IMG/M |
| 3300031740|Ga0307468_102272472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300031747|Ga0318502_10588898 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 669 | Open in IMG/M |
| 3300031778|Ga0318498_10000743 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 9759 | Open in IMG/M |
| 3300031820|Ga0307473_10017500 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
| 3300031820|Ga0307473_10149954 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300031831|Ga0318564_10137278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1089 | Open in IMG/M |
| 3300031832|Ga0318499_10032092 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
| 3300031858|Ga0310892_10580933 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 756 | Open in IMG/M |
| 3300031892|Ga0310893_10019966 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300031912|Ga0306921_12792569 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300031947|Ga0310909_10864291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 744 | Open in IMG/M |
| 3300032010|Ga0318569_10113229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1233 | Open in IMG/M |
| 3300032060|Ga0318505_10576192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
| 3300032066|Ga0318514_10219265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 998 | Open in IMG/M |
| 3300032068|Ga0318553_10061307 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1868 | Open in IMG/M |
| 3300032174|Ga0307470_10075469 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300032174|Ga0307470_10333070 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300032174|Ga0307470_10354103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1019 | Open in IMG/M |
| 3300032174|Ga0307470_10826077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 720 | Open in IMG/M |
| 3300032174|Ga0307470_11724483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300032179|Ga0310889_10405523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
| 3300032180|Ga0307471_100590086 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300032180|Ga0307471_100698898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300032180|Ga0307471_100816777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1099 | Open in IMG/M |
| 3300032205|Ga0307472_101757727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
| 3300032205|Ga0307472_101840765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 602 | Open in IMG/M |
| 3300032770|Ga0335085_11671890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 657 | Open in IMG/M |
| 3300034678|Ga0314803_065097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 658 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.48% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.48% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.48% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_107528143 | 3300000550 | Soil | MLVAVQRFVKCAIVLYLVTHGLPIAAEIELRDLATALCWSLLAQFRISG* |
| F14TC_1067457031 | 3300000559 | Soil | MLVAVQHAVKHLPLFYLVTHGLPAASEIELRDLATAIGWSLLAHFRIST* |
| JGI10216J12902_1056177652 | 3300000956 | Soil | MLVAVQGLVKYVIVLYLVTHGLPIAGEIELRELLSAIGWSLLAQLRISG* |
| F14TB_1011400701 | 3300001431 | Soil | MLVAVQRLVKCAIVLYLVTHGLPVAAEIELRDLATALCWSLLAQFRISG* |
| JGI25384J37096_100034803 | 3300002561 | Grasslands Soil | MLVAVQGLVKCAVVIYLVTHGLPIAAEIELRDLASALCWSLLAQLRLSG* |
| JGI25382J37095_100652593 | 3300002562 | Grasslands Soil | MLVAVQRLVKCAVVIYLVTHGLPIAGEIELRDLASALCWSLLAQLRLSG* |
| JGI25386J43895_101522361 | 3300002912 | Grasslands Soil | GMGMLVAVQRLVKCAVVIYLVTHGLPIAGEIELRDLASALCWSLLAQLRLSG* |
| Ga0066396_100224922 | 3300004267 | Tropical Forest Soil | KMLVAVQGLVKYVIVLYLVTHGLPIAGEIELPDLLSALGWSLLAQLRIGG* |
| Ga0066398_100024412 | 3300004268 | Tropical Forest Soil | MLVAVQGLVKYVIVLYLVTHGLPIAGEIELPDLLSALGWSLLAQLRIGG* |
| Ga0066398_102137401 | 3300004268 | Tropical Forest Soil | MLVAVQRLVKYVIVLYLVTHGLPAAAEIELSDLATAIGWSLLSQFRISG* |
| Ga0062595_1014173342 | 3300004479 | Soil | MLVAVQRLVKCAVVLYLVTHGLPIAAEVELRELGAALFWSLLAQLRLSG* |
| Ga0066395_100618273 | 3300004633 | Tropical Forest Soil | MLVVVQRLVKYVVVLYLVTHGVPAAAEIELRDLATAIGWSLLAQLRISG* |
| Ga0066395_101660372 | 3300004633 | Tropical Forest Soil | YVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG* |
| Ga0066395_103074632 | 3300004633 | Tropical Forest Soil | MLAAVQRLVKYVIVLYLVTHGLPVAADIELRDLATAIGWSLLAQLRISG* |
| Ga0066672_100762622 | 3300005167 | Soil | MLVVVQRLVKCAIVLYLVTHGLPIAAEVELRDLAAALCWSLLAQLRLSG* |
| Ga0066677_102077143 | 3300005171 | Soil | MLVAVERLVKCAIVLYLVTHGLPVAAEIELRDLASAIGWSLLAQLRISGSS* |
| Ga0066684_103048203 | 3300005179 | Soil | MLVAVERLVKCAIVLYLATHGLPIAAEVELRDLAAALCWSLLAQLRLSG* |
| Ga0066685_100014247 | 3300005180 | Soil | MLVAVQRLVKYAIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG* |
| Ga0066685_105562512 | 3300005180 | Soil | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAHFRIST* |
| Ga0066676_104365732 | 3300005186 | Soil | RLVKCAIVLYLVTHGLPIAAEVELRDLAAALCWSLLAQLRLSG* |
| Ga0070690_1008252972 | 3300005330 | Switchgrass Rhizosphere | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRIPT* |
| Ga0066388_1000033785 | 3300005332 | Tropical Forest Soil | MLAAVQRLVKYVIMLYLVTHGLPVAADIELRDLATAIGWSLLAQLRISG* |
| Ga0066388_1013920453 | 3300005332 | Tropical Forest Soil | MLVTLRNVVKYLVVLYLVTHGLPAASEIELRDLVTAIAWSLLARFRVSG* |
| Ga0066388_1028100822 | 3300005332 | Tropical Forest Soil | MLLAVQRLVKYVIVLYLVTHGLPTAGEIELRDLASAIGWSLLAQLRISG* |
| Ga0070671_1012891852 | 3300005355 | Switchgrass Rhizosphere | MLVAVQRVVKYLIVLYLVTHGLPAASEIELRDLFTAIAWSVLAQLRMSS* |
| Ga0070674_1001881692 | 3300005356 | Miscanthus Rhizosphere | MLVAVQHAVKHLIVFYLVTHGLPAASEIELRDLATAIGWSLLAYFRIST* |
| Ga0070667_1010088642 | 3300005367 | Switchgrass Rhizosphere | MLVAVQHAVKHLIVFYLVTHGLPAASEIELRDLATAIGWSLLAYFRIPT* |
| Ga0070705_1005480621 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVAVQRLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLR |
| Ga0070708_1000485513 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVAVQHLVKGAIVIYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG* |
| Ga0066686_100698283 | 3300005446 | Soil | MLVAVQHLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG* |
| Ga0066686_108334492 | 3300005446 | Soil | MLVAVERLVKCAIVLYLVTHGLPVAAEIELRDLAFAIGWSLLAQLRISGSS* |
| Ga0070706_1014066842 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVAVQRLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRFYG* |
| Ga0066697_103158252 | 3300005540 | Soil | MLVAVQRLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG* |
| Ga0066701_106136272 | 3300005552 | Soil | MLVAVQRLVKCAVVIYLVTHGLPIAAEIELRDLASALCWSLLAQLRLSG* |
| Ga0066661_100173783 | 3300005554 | Soil | MLVVVQRLVKCAIVLYLATHGLPIAAEVELRDLAAALCWSLLAQLRLSG* |
| Ga0066707_100964992 | 3300005556 | Soil | LVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG* |
| Ga0066700_103338062 | 3300005559 | Soil | MLVAVQHLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRFYG* |
| Ga0066706_113307712 | 3300005598 | Soil | MLVAVQGLVKCAVVIYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG* |
| Ga0066905_1000476962 | 3300005713 | Tropical Forest Soil | MLVTVQRLVKYVIVLYLVTHGLPVAADIELRDLATAIGWSLLAQLRISG* |
| Ga0068866_106757102 | 3300005718 | Miscanthus Rhizosphere | DMLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRIPT* |
| Ga0068861_1025834501 | 3300005719 | Switchgrass Rhizosphere | MLVAVQRLVKCAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRSGGG* |
| Ga0066903_1000284716 | 3300005764 | Tropical Forest Soil | MLVTMRNVVKYLVALYLVTHGLPAASEIELRDLVTAITWSLLAQFRVSG* |
| Ga0066903_1001480573 | 3300005764 | Tropical Forest Soil | MLLAVQRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG* |
| Ga0081540_10435004 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MLVAAQRLVKCAVVLYLVTHGLPIAAEVELRELGAALFWSLVAQLRLSG* |
| Ga0066696_107166251 | 3300006032 | Soil | VKCAIVLYLVTHGLPIAAEVELRDLAAALCWSLLAQLRLSG* |
| Ga0075417_105762561 | 3300006049 | Populus Rhizosphere | VQRLVKCAIVLYLVTHGLPVAAEIELRDLATALCWSLLAQFRISG* |
| Ga0070715_101503212 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVAVQRIVKYLIVLYLVTHGLPAASEIELRDLVTAIAWSVLAQLRMSS* |
| Ga0075427_100377572 | 3300006194 | Populus Rhizosphere | MLVAVQRLVKCAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRAGGG* |
| Ga0075422_100242301 | 3300006196 | Populus Rhizosphere | REGGVMLVAVQRLVKYAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRSGGG* |
| Ga0066658_104040062 | 3300006794 | Soil | GRGKVMLVVVQRLVKCAIVLYLATHGLPIAAEVELRDLAAALCWSLLAQLRLSG* |
| Ga0075428_1012973543 | 3300006844 | Populus Rhizosphere | MLVAVQRLVKCAIVLYLVTHGLPIAAEIELRDLATTLCWSLLAQFRISG* |
| Ga0075428_1024230962 | 3300006844 | Populus Rhizosphere | MLVAVQRLVKCAVVLYLVTHGLPMAAEIDLRDLATVLLWSVQAQLRISG* |
| Ga0075428_1026316652 | 3300006844 | Populus Rhizosphere | MLVAVQRLVKYAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRSGGG* |
| Ga0075421_1001186682 | 3300006845 | Populus Rhizosphere | RVMLVAVQRLVKCAVVLYLVTHGLPIAAEVELRELGAALFWSLLAQLRLSG* |
| Ga0075433_100019813 | 3300006852 | Populus Rhizosphere | MLVAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRISS* |
| Ga0075433_102365932 | 3300006852 | Populus Rhizosphere | MLVAVERVVKYLIVLYLVTHGLPAASEIELRDLATAIAWSLLAQLRMSS* |
| Ga0075433_113127922 | 3300006852 | Populus Rhizosphere | MLVAVQRLVKCAIVLYLVTHGLPFAAEVDLRDLASAIGWSLLAQLRISG* |
| Ga0075425_1011487772 | 3300006854 | Populus Rhizosphere | MLVAVQSVVKYLIVLYLVTHGLPAASEIELRDLATAIAWSVLAQLRMSS* |
| Ga0075425_1012429772 | 3300006854 | Populus Rhizosphere | MLVAVQRVVKYLIVLYLVTHGLPAASEIELRDLATAIAWSLLAQLRMSG* |
| Ga0075429_1001165023 | 3300006880 | Populus Rhizosphere | MLVAVQRLVKCAIVLYLVMHGLPVAAEIELRDLATALCWSLLAQFRISG* |
| Ga0075426_101556652 | 3300006903 | Populus Rhizosphere | MLVAVQSVVKYLIVLYLVTHGLPAASEIELRDLATAIAWSLLAQLRMSS* |
| Ga0075424_1000347624 | 3300006904 | Populus Rhizosphere | MLVAVQRVVKYLIVLYLVTHGLPAASEIELRDLATAIAWSLLAQLRMSS* |
| Ga0075424_1001117441 | 3300006904 | Populus Rhizosphere | MLVAVQHAVKYLIVLYLATHGLPAASEIELRDLATAIGWSFLAYFRISA* |
| Ga0075435_1000037046 | 3300007076 | Populus Rhizosphere | MLVAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRFSA* |
| Ga0099791_104136572 | 3300007255 | Vadose Zone Soil | MLVAVQRLVKYAIVLYLVTHGLPAAGEIELRELASAIGWSLLAQLRISG* |
| Ga0066709_1000002312 | 3300009137 | Grasslands Soil | MGMLVAVQGLVKCAVVIYLVTHGLPIAAEIELRDLASALCWSLLAQLRLSG* |
| Ga0066709_1015057261 | 3300009137 | Grasslands Soil | MLVAVQHLVKGAIVIYLVTHGLPIAAELELRDLAAALCWSLLVQFRLYG* |
| Ga0066709_1016970472 | 3300009137 | Grasslands Soil | MLVAVQRLVKGVIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG* |
| Ga0099792_103229002 | 3300009143 | Vadose Zone Soil | MLVAVQRLVKCAIVLYLVTHGLPIAAEIELRDLATAVCWSLLAQLRLPG* |
| Ga0114129_100392554 | 3300009147 | Populus Rhizosphere | MLVAVQRLVKCAIVLYLVTHGLPIAAEIELRDLATALCWSLLAQFRISG* |
| Ga0114129_123226612 | 3300009147 | Populus Rhizosphere | MLVAEQRLVKYAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRSGGG* |
| Ga0075423_104708713 | 3300009162 | Populus Rhizosphere | MLVAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRISA* |
| Ga0075423_105129712 | 3300009162 | Populus Rhizosphere | MLVAVQSAVKYLIVLYLVTHGLPAASEIELRDLATAIAWSLLAQLRMSS* |
| Ga0075423_110974933 | 3300009162 | Populus Rhizosphere | MLVAVQRLVKYAVVLYLVTHGLPMAAEVDLRDLATTLLWSL |
| Ga0105248_130856952 | 3300009177 | Switchgrass Rhizosphere | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRIST* |
| Ga0126374_102018742 | 3300009792 | Tropical Forest Soil | MLHAVQRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG* |
| Ga0126380_106759902 | 3300010043 | Tropical Forest Soil | MLVAVRGLVKYVIVLYLVTHGQPIAGEIELRDLLAALGWSLLAQLRISG* |
| Ga0126380_116643911 | 3300010043 | Tropical Forest Soil | MLVAVQGLVKYVIVLYLVTHGLPVAAEIELRELLFAIGWSLLAQLRISG* |
| Ga0126384_101795442 | 3300010046 | Tropical Forest Soil | MLVAVQGLVKYVIVLYLVTHGLPITGEIELRDLLSAIGWSLLAQLRIYG* |
| Ga0126384_112681881 | 3300010046 | Tropical Forest Soil | MLVTVQRLVKYVIVLYLVTHGLPAASEIELRDLATAIAWSLRAQLRISS* |
| Ga0126384_114831882 | 3300010046 | Tropical Forest Soil | MLLAVQRLVKYVIVLYLVTHGLPAAGEIELRDLVSAIGWSLLAQLRISV* |
| Ga0126382_104103573 | 3300010047 | Tropical Forest Soil | MLVAVRGLVKYVIVLYLVTHGLPIAGEIELPDLLSALGWSLLAQLRIGG* |
| Ga0126382_107676012 | 3300010047 | Tropical Forest Soil | MLVTVQRLVKYVIVLYLVTHGLPVAAEIELRDLATAIGWSLLAQLRISG* |
| Ga0134088_100003899 | 3300010304 | Grasslands Soil | MLVAVQRLVKYAIVLYLVTHGLPAAGEIELRDLTSAIGWSLLAQLRISG* |
| Ga0134071_101931563 | 3300010336 | Grasslands Soil | LVAVQRLVKCAVVIYLVTHGLPIAGEIELRDLASALCWSLLAQLRLSG* |
| Ga0126376_101401673 | 3300010359 | Tropical Forest Soil | MLLAVQRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISE* |
| Ga0126372_124990462 | 3300010360 | Tropical Forest Soil | MLVAVQGLVKYVIVLYLVTHGLPIASEIELRDLLSAFGWSLLAQFRIYG* |
| Ga0126378_118933791 | 3300010361 | Tropical Forest Soil | AVQGLVKYVIVLYLVTHGLPIAGEIELPDLLSALGWSLLAQLRIGG* |
| Ga0126377_103226122 | 3300010362 | Tropical Forest Soil | MLLAVQRLVKYVIVLYLVAHGLPAAGEIELRDLASAIGWSLLAQLRISG* |
| Ga0126377_105270592 | 3300010362 | Tropical Forest Soil | MLVTVQRLVKYVIVLYLVTHGLPVAADIELRDLATAIGSSLLAQLRISG* |
| Ga0126379_105777251 | 3300010366 | Tropical Forest Soil | MLVTVQRLVKSVIVLYLVTHGLPVAAEIELRDLATAIARSLLAQFRISG* |
| Ga0126381_1021458951 | 3300010376 | Tropical Forest Soil | MLLAVQRLVKYVIVLYLVTHGLPAVGEIELRDLASAIGWSLLAQLRISG* |
| Ga0134124_104255072 | 3300010397 | Terrestrial Soil | MLVAVQRVVKYLIVLYLVTHGLPAASEIELRDLVTAIAWSVLAQLRMSS* |
| Ga0126383_130998922 | 3300010398 | Tropical Forest Soil | MLVTVQRLVKSVIVLYLVTHGLPVAAEIELRDLATAIGWSLLAQLRISG* |
| Ga0134123_135378411 | 3300010403 | Terrestrial Soil | MLVAVQRVVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRIST* |
| Ga0137383_101957972 | 3300012199 | Vadose Zone Soil | MLVAVQRLVKGAIVLYLVTHGLPIAAELELRDLGAALCCSLLAQLRLYG* |
| Ga0137363_103842642 | 3300012202 | Vadose Zone Soil | VLYLVTHGLPIAAEVELRDLAAALCWSLLAQLRLSG* |
| Ga0137399_100146322 | 3300012203 | Vadose Zone Soil | MLIAVQRLVKGAIVLFLVTHGLPIAAEVELRDLAAALGWSLLAQLRLSG* |
| Ga0137362_100971872 | 3300012205 | Vadose Zone Soil | MLVAVQRFVKCAVVLYLVTHGLPIAAEVELRDLAAALCWSLLAQLRLSG* |
| Ga0137376_105514701 | 3300012208 | Vadose Zone Soil | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLALFRIST* |
| Ga0137369_111091951 | 3300012355 | Vadose Zone Soil | RVRDMLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRISA* |
| Ga0137358_101887912 | 3300012582 | Vadose Zone Soil | MLVAVQRLVKYAIVFYLVTHGLPAAGEIELRELDSAIGWSLLAQLRISG* |
| Ga0137358_103881832 | 3300012582 | Vadose Zone Soil | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLVTAIGWSLLAHFRIST* |
| Ga0137397_100571281 | 3300012685 | Vadose Zone Soil | MLVAVQRLVKCAIVLYLVTHGLPFAAEIDFRDLASAIGWSLLAQLRISG* |
| Ga0137396_1000055811 | 3300012918 | Vadose Zone Soil | MLIAVQRLVKCAIVLYLVTHGLPIAAEVELRDLAAALGWSLLAHLRLPG* |
| Ga0137419_100020493 | 3300012925 | Vadose Zone Soil | MLIAVQRLVKCAIVLYLVTHGLPIAAEVELRDLAAALGWSLLAQLRLSG* |
| Ga0137404_121171731 | 3300012929 | Vadose Zone Soil | TGGEGVMLVAVQRLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG* |
| Ga0126375_100463741 | 3300012948 | Tropical Forest Soil | MLVAVRGLVKYVIVLYLVTHGLPIAGEIELRDLLAALGWSLLAQLRISG* |
| Ga0126375_119299642 | 3300012948 | Tropical Forest Soil | GGKMLVAVQGLVKYVIVLYLVTHGLPIAGEIELPDLLSALGWSLLAQLRIGG* |
| Ga0164301_104020931 | 3300012960 | Soil | MLVAVQHAVKHLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRTSS* |
| Ga0134081_100857443 | 3300014150 | Grasslands Soil | MLVAVQHLVKGAIVLYLVTHGLPIAAEVELRDLAAALCWSLLAQLRLYG* |
| Ga0137403_100304996 | 3300015264 | Vadose Zone Soil | MLVAVQRLVKCAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG* |
| Ga0132258_131556042 | 3300015371 | Arabidopsis Rhizosphere | MLVAVQHAVKHLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRIST* |
| Ga0132256_1007823652 | 3300015372 | Arabidopsis Rhizosphere | MLVVVQHAVKHLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRTSS* |
| Ga0132257_1003975722 | 3300015373 | Arabidopsis Rhizosphere | MLVVVQHAVKHLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRIST* |
| Ga0182037_102635343 | 3300016404 | Soil | MLVTVRNVVTYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0134083_100002862 | 3300017659 | Grasslands Soil | MLVAVQRLVKYAIVLYLVTHGLPAAGEIELRDLTSAIGWSLLAQLRISG |
| Ga0163161_108221702 | 3300017792 | Switchgrass Rhizosphere | MLVAVQHAVKHLIVFYLVTHGLPAASEIELRDLATAIGWSLLAYFRIST |
| Ga0187776_100064897 | 3300017966 | Tropical Peatland | MLVAVGRAAKYLVVLYLVTHGLPAASEIELRDLVTAVAWSVLAQFRISG |
| Ga0187776_111681152 | 3300017966 | Tropical Peatland | MLVAVRQAVKYLVVLYLVTHGLPAASEIELRDLVTAVAWSVLAQFRISG |
| Ga0187765_101477453 | 3300018060 | Tropical Peatland | MLVTVRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0066655_100067234 | 3300018431 | Grasslands Soil | MLVAVQRLVKYAIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0066655_110475432 | 3300018431 | Grasslands Soil | MLVVVQRLVKCAIVLYLATHGLPIAAEVELRDLAAALCWSLLAQLRLSG |
| Ga0066667_100179293 | 3300018433 | Grasslands Soil | MLVAVERLVKCAIVLYLVTHGLPVAAGIGLRDLASAISWSLLAQLRISGSS |
| Ga0066667_100752242 | 3300018433 | Grasslands Soil | MLVVVQRLVKCAIVLYLVTHGLPIAAEVELRDLAAALCWSLLAQLRLSG |
| Ga0066662_111269791 | 3300018468 | Grasslands Soil | MLVAVQHLVKGAIVIYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG |
| Ga0137408_11218551 | 3300019789 | Vadose Zone Soil | MLVAVQRLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLA |
| Ga0179594_100788532 | 3300020170 | Vadose Zone Soil | MLVAVQRFVKCAVVLYLVTHGLPIAAEVELRDLAAALCWSLLAQLRLSG |
| Ga0187846_101993962 | 3300021476 | Biofilm | MLVAVQGLVKYVIVLYLVTHGLPIAGEIELRDLLTALGWSLLAQFRIYG |
| Ga0126371_102120543 | 3300021560 | Tropical Forest Soil | MLVTMRNVVKYLVALYLVTHGLPAASEIELRDLVTAITWSLLAQFRVSG |
| Ga0207642_105383012 | 3300025899 | Miscanthus Rhizosphere | HLIVFYLVTHGLPAASEIELRDLATAIGWSLLAYFRIPT |
| Ga0207646_113001081 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVAVQHLVKGAIVIYLVTHGLPIAAELELRDLAAALCWSLLAQLRFYG |
| Ga0207708_120580092 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVAVQHAVKHLIVFYLVTHGLPAASEIELRDLATAIGWSLLAYFR |
| Ga0209350_10117752 | 3300026277 | Grasslands Soil | MLVAVERLVKCAIVLYLVTHGLPVAAEIELRDLASAISWSLLAQLRISGSS |
| Ga0209438_10742221 | 3300026285 | Grasslands Soil | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAHFRIST |
| Ga0209235_10163293 | 3300026296 | Grasslands Soil | MLVAVQGLVKCAVVIYLVTHGLPIAAEIELRDLASALCWSLLAQLRLSG |
| Ga0209237_11135151 | 3300026297 | Grasslands Soil | RWEEGMGMLVAVQRLVKCAVVIYLVTHGLPIAGEIELRDLASALCWSLLAQLRLSG |
| Ga0209055_10882292 | 3300026309 | Soil | MLVAVQHLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRFYG |
| Ga0209154_10538173 | 3300026317 | Soil | MLVAVQHLVKGAIVLYLATHGLPIAAEVELRDLAAALCWSLLAQLRLSG |
| Ga0209267_11095242 | 3300026331 | Soil | MLVAVERLVKCAIVLYLVTHGLPVAAEIELRDLASAIGWSLLAQLRISGSS |
| Ga0209377_10086342 | 3300026334 | Soil | MLVAVQRLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG |
| Ga0257173_10335432 | 3300026360 | Soil | MLVAVQCLVKCAIVLYLVTHGLPIAAEIELRDLATAVCWSLLAQLRQPG |
| Ga0257147_10807231 | 3300026475 | Soil | MLAAVQHAVKYLIVLYLVTHGLPAASEIELPDLATAIGWSLLAHFRIST |
| Ga0209808_12599571 | 3300026523 | Soil | GRVRDMLVAVERLVKCAIVLYLVTHGLPVAAEIELRDLAFAIGWSLLAQLRISGSS |
| Ga0209157_11679902 | 3300026537 | Soil | MLVAVERLVKCAIVLYLVTHGLPVAAEIELRDLAFAIGWSLLAQLRISGSS |
| Ga0209376_10811391 | 3300026540 | Soil | VLYLVTHGLPVAAEIELRDLAFAIGWSLLAQLRISGSS |
| Ga0179587_106528252 | 3300026557 | Vadose Zone Soil | MLAAVQHAVKYLIVLYLVTHGLPAASEIEPRDLATAIGWSLLALFRIST |
| Ga0209684_10149632 | 3300027527 | Tropical Forest Soil | MLLAVQRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0209466_10224371 | 3300027646 | Tropical Forest Soil | VAVQGLVKYVIVLYLVTHGQPIAGEIELRDLLAALGWSLLAQLRISG |
| Ga0209388_10820042 | 3300027655 | Vadose Zone Soil | MLVAVQRLVKCAIVLYLVTHGLPFAAEVDLRDLASAIGWSLLAQLRISG |
| Ga0209811_101611742 | 3300027821 | Surface Soil | MLVAVQHAVKHLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRTSS |
| Ga0209814_100018843 | 3300027873 | Populus Rhizosphere | MLVAVQRLVKCAVVLYLVTHGLPIAAEVELRELGAALFWSLLAQLRLSG |
| Ga0209814_100107983 | 3300027873 | Populus Rhizosphere | MLVAVQRLVKCAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRAGGG |
| Ga0209465_100060432 | 3300027874 | Tropical Forest Soil | MLAAVQRLVKYVIVLYLVTHGLPVAADIELRDLATAIGWSLLAQLRISG |
| Ga0209465_102824051 | 3300027874 | Tropical Forest Soil | IVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0209481_100786212 | 3300027880 | Populus Rhizosphere | SGISRGEGRVMLVAVQRLVKCAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRAGGG |
| Ga0209481_102552681 | 3300027880 | Populus Rhizosphere | MLVAVQRLVKCAVVLYLVTHGLPMAAEVDLRDFATTLLWSLQA |
| Ga0209488_102513132 | 3300027903 | Vadose Zone Soil | MLVAVQRLVKCAIVLYLVTHGLPIAAEIELRDLATAVCWSLLAQLRLPG |
| Ga0207428_1000068217 | 3300027907 | Populus Rhizosphere | MLVAVQRLVKYAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRSGGG |
| Ga0209382_100994041 | 3300027909 | Populus Rhizosphere | RVMLVAVQRLVKCAVVLYLVTHGLPIAAEVELRELGAALFWSLLAQLRLSG |
| Ga0209382_117899332 | 3300027909 | Populus Rhizosphere | MLVAVQRLVKCAIVLYLVTHGLPIAAEIELRDLATTLCWSLLAQFRISG |
| Ga0268265_102880811 | 3300028380 | Switchgrass Rhizosphere | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAY |
| Ga0268264_107856432 | 3300028381 | Switchgrass Rhizosphere | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRIPT |
| Ga0137415_100186277 | 3300028536 | Vadose Zone Soil | MLIAVQRLVKCAIVLYLVTHGLPIAAEVELRDLAAALGWSLLAQLRLSG |
| Ga0307499_100198001 | 3300031184 | Soil | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGRSLLAYFRSST |
| (restricted) Ga0255310_100270142 | 3300031197 | Sandy Soil | MLVAVQRLVKCAIVLYLVTHGLPIAAEIELRDLATAVCWSLLAQLRMPG |
| Ga0310888_100165933 | 3300031538 | Soil | MLVAVQRLVKCAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRISG |
| Ga0310887_101042331 | 3300031547 | Soil | KHLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRTSS |
| Ga0310915_109154871 | 3300031573 | Soil | RLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0318542_107302492 | 3300031668 | Soil | YVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0318574_101495172 | 3300031680 | Soil | GDMLVTVRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0306917_100162011 | 3300031719 | Soil | LYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0307469_100708883 | 3300031720 | Hardwood Forest Soil | MLVAVQRLVKYAIVLYLVTHGLPAAGEIELRELASAIGWSLLAQLRISG |
| Ga0307469_104233402 | 3300031720 | Hardwood Forest Soil | MLVAVQRLVKCAIVLYLVTHGLPFAAEVDLRDLASAIGWSLLAQLHISG |
| Ga0307469_111670242 | 3300031720 | Hardwood Forest Soil | MLVAVQRLVKCAIVLYLVTHGLPFAADIDFRDLASAIGWSLLAQLRISG |
| Ga0318493_100130953 | 3300031723 | Soil | MLLAVQRLVKYVIVLYPVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0318493_107165192 | 3300031723 | Soil | PGEGGDMLVTVRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0318500_100940963 | 3300031724 | Soil | MLLAVQRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRSSG |
| Ga0318500_104556291 | 3300031724 | Soil | VQRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRSSG |
| Ga0318500_106011342 | 3300031724 | Soil | KYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0318501_104965642 | 3300031736 | Soil | GGDMLVTVRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0307468_1022724722 | 3300031740 | Hardwood Forest Soil | MLVAVQRLVKYAIVLYLVTHGLPAAGEIELRELASAIGWSFLAQLRISG |
| Ga0318502_105888981 | 3300031747 | Soil | EGGDMLVTVRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0318498_100007433 | 3300031778 | Soil | MLLAVQRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLVQLRISG |
| Ga0307473_100175002 | 3300031820 | Hardwood Forest Soil | MLVAVQHLVKGAIVLYLVTHGLPIAAELELRDLAAALCWSLLAQLRLYG |
| Ga0307473_101499542 | 3300031820 | Hardwood Forest Soil | MLVAVQGLVKYVIVLYLVTHGLPIAGEIELRELLSAIGWSLLAQLRISG |
| Ga0318564_101372782 | 3300031831 | Soil | LVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0318499_100320923 | 3300031832 | Soil | MLLAVQRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLVQLRIS |
| Ga0310892_105809332 | 3300031858 | Soil | VVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRISG |
| Ga0310893_100199662 | 3300031892 | Soil | MLVAVQRLVKCAVVLYLVTHGLPMAAEIDLRDLATTLLWSFQAQLRISG |
| Ga0306921_127925691 | 3300031912 | Soil | KYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0310909_108642912 | 3300031947 | Soil | GEGGDMLVTVRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0318569_101132292 | 3300032010 | Soil | QRLVKYVIVLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0318505_105761922 | 3300032060 | Soil | RKQPGEGGDMLVTVRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0318514_102192651 | 3300032066 | Soil | KQPGEGGDMLVTVRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0318553_100613072 | 3300032068 | Soil | VRNVVKYLVVLYLVTHGLPAASEIELRDLVTAMAWSLLAQFRISG |
| Ga0307470_100754691 | 3300032174 | Hardwood Forest Soil | DMLVAVQHAVKHLIVFYLVTHGLPVASEIELRDLATAIGWSLLAHFRIST |
| Ga0307470_103330701 | 3300032174 | Hardwood Forest Soil | GISWGEGRVMLVAVQRLVKCAVVLYLVTHGLPMAAEVDLRDLATTLLWSLQAQLRSGGG |
| Ga0307470_103541031 | 3300032174 | Hardwood Forest Soil | RDMLVAVQHAVKHLIVLYLVTHGLPAASEIELRDLATAIGWSILAYFRIST |
| Ga0307470_108260771 | 3300032174 | Hardwood Forest Soil | MLAAVQHAVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRISA |
| Ga0307470_117244831 | 3300032174 | Hardwood Forest Soil | VKYLIVLYLVTHGLPAASEIELRDLVTAIAWSVLAQLRMSS |
| Ga0310889_104055232 | 3300032179 | Soil | RVRDMLVAVQHAVKHLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRTSS |
| Ga0307471_1005900862 | 3300032180 | Hardwood Forest Soil | MLVAVQRVVKYLIVLYLVTHGLPAASEIELRDLATAIGWSLLAQLRISG |
| Ga0307471_1006988982 | 3300032180 | Hardwood Forest Soil | MLVAVQRLVKYAIMLYLVTHGLPAAGEIELRDLASAIGWSLLAQLRISG |
| Ga0307471_1008167772 | 3300032180 | Hardwood Forest Soil | MLVAVQHAVKHLIVLYLVTHGLPAASEIELRDLATAIGWSLLAYFRISN |
| Ga0307472_1017577271 | 3300032205 | Hardwood Forest Soil | LIVLYLVTHGLPAASEIELRDLVTAIAWSVLAQLRMSS |
| Ga0307472_1018407652 | 3300032205 | Hardwood Forest Soil | MLVAVQHAVKHLIVFYLVTHGLPVASEIELRDLATAIGWSLLAHFRIST |
| Ga0335085_116718902 | 3300032770 | Soil | MLVAVQNVVKYLIVLYLVTHGLPAASEIELRDLATAVGRSLLAQLRISS |
| Ga0314803_065097_72_221 | 3300034678 | Soil | MLVAVQRLVKCAVVLYLVTHGLPMAAEVDLRDLATPLLWSLQAQLRISG |
| ⦗Top⦘ |