Basic Information | |
---|---|
Family ID | F023729 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 209 |
Average Sequence Length | 40 residues |
Representative Sequence | LARLERLGLVARSAGGGTLALTERGRFLGGGVTAELLA |
Number of Associated Samples | 182 |
Number of Associated Scaffolds | 209 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.49 % |
% of genes near scaffold ends (potentially truncated) | 97.13 % |
% of genes from short scaffolds (< 2000 bps) | 92.34 % |
Associated GOLD sequencing projects | 178 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (70.813 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.268 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.445 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.502 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.27% β-sheet: 9.09% Coil/Unstructured: 63.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 209 Family Scaffolds |
---|---|---|
PF03444 | HrcA_DNA-bdg | 31.58 |
PF01628 | HrcA | 30.14 |
PF01726 | LexA_DNA_bind | 7.66 |
PF00226 | DnaJ | 4.31 |
PF08220 | HTH_DeoR | 2.87 |
PF00684 | DnaJ_CXXCXGXG | 1.91 |
PF01556 | DnaJ_C | 0.96 |
PF04055 | Radical_SAM | 0.96 |
PF01636 | APH | 0.48 |
PF02522 | Antibiotic_NAT | 0.48 |
PF13683 | rve_3 | 0.48 |
PF12146 | Hydrolase_4 | 0.48 |
PF01569 | PAP2 | 0.48 |
PF14791 | DNA_pol_B_thumb | 0.48 |
PF08442 | ATP-grasp_2 | 0.48 |
PF00873 | ACR_tran | 0.48 |
PF01594 | AI-2E_transport | 0.48 |
PF02562 | PhoH | 0.48 |
COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
---|---|---|---|
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 31.58 |
COG1420 | Transcriptional regulator of heat shock response | Transcription [K] | 30.14 |
COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 2.87 |
COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 0.96 |
COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 0.48 |
COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.48 |
COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.48 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.48 |
COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 0.48 |
COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.48 |
COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.48 |
COG2746 | Aminoglycoside N3'-acetyltransferase | Defense mechanisms [V] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 70.81 % |
All Organisms | root | All Organisms | 29.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459019|G14TP7Y01CKYVK | Not Available | 619 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_13524965 | Not Available | 603 | Open in IMG/M |
3300000891|JGI10214J12806_12035522 | Not Available | 605 | Open in IMG/M |
3300000956|JGI10216J12902_100332423 | Not Available | 671 | Open in IMG/M |
3300000956|JGI10216J12902_108189257 | Not Available | 582 | Open in IMG/M |
3300000956|JGI10216J12902_108577842 | Not Available | 1078 | Open in IMG/M |
3300000956|JGI10216J12902_121276934 | Not Available | 900 | Open in IMG/M |
3300001431|F14TB_100022750 | Not Available | 1401 | Open in IMG/M |
3300001431|F14TB_100859473 | Not Available | 1135 | Open in IMG/M |
3300001537|A2065W1_10456938 | Not Available | 506 | Open in IMG/M |
3300001686|C688J18823_10023353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4181 | Open in IMG/M |
3300001686|C688J18823_10065128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2526 | Open in IMG/M |
3300002568|C688J35102_118563892 | Not Available | 572 | Open in IMG/M |
3300002568|C688J35102_119088453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
3300002568|C688J35102_119112187 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300004157|Ga0062590_100101973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1821 | Open in IMG/M |
3300004479|Ga0062595_100555201 | Not Available | 881 | Open in IMG/M |
3300004479|Ga0062595_101604515 | Not Available | 607 | Open in IMG/M |
3300005093|Ga0062594_103202625 | Not Available | 513 | Open in IMG/M |
3300005093|Ga0062594_103326120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300005187|Ga0066675_11080274 | Not Available | 600 | Open in IMG/M |
3300005329|Ga0070683_101903677 | Not Available | 572 | Open in IMG/M |
3300005341|Ga0070691_10120833 | Not Available | 1319 | Open in IMG/M |
3300005356|Ga0070674_100686271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
3300005440|Ga0070705_100640025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
3300005445|Ga0070708_101887197 | Not Available | 554 | Open in IMG/M |
3300005447|Ga0066689_10445637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
3300005454|Ga0066687_10180168 | Not Available | 1140 | Open in IMG/M |
3300005456|Ga0070678_102149444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
3300005457|Ga0070662_100304760 | Not Available | 1295 | Open in IMG/M |
3300005459|Ga0068867_100147680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1844 | Open in IMG/M |
3300005468|Ga0070707_100008025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9808 | Open in IMG/M |
3300005468|Ga0070707_100718190 | Not Available | 962 | Open in IMG/M |
3300005536|Ga0070697_100335377 | Not Available | 1304 | Open in IMG/M |
3300005545|Ga0070695_100148173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1635 | Open in IMG/M |
3300005545|Ga0070695_100430984 | Not Available | 1006 | Open in IMG/M |
3300005556|Ga0066707_10943207 | Not Available | 528 | Open in IMG/M |
3300005568|Ga0066703_10574884 | Not Available | 659 | Open in IMG/M |
3300005568|Ga0066703_10787462 | Not Available | 544 | Open in IMG/M |
3300005575|Ga0066702_10963831 | Not Available | 510 | Open in IMG/M |
3300005713|Ga0066905_101519302 | Not Available | 610 | Open in IMG/M |
3300005764|Ga0066903_100538330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1997 | Open in IMG/M |
3300005937|Ga0081455_10223658 | Not Available | 1393 | Open in IMG/M |
3300005981|Ga0081538_10060086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2190 | Open in IMG/M |
3300006163|Ga0070715_10494094 | Not Available | 699 | Open in IMG/M |
3300006358|Ga0068871_100493523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1103 | Open in IMG/M |
3300006755|Ga0079222_11967164 | Not Available | 573 | Open in IMG/M |
3300006796|Ga0066665_10421638 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300006804|Ga0079221_10970877 | Not Available | 633 | Open in IMG/M |
3300006854|Ga0075425_100274071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1942 | Open in IMG/M |
3300006880|Ga0075429_100192471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1787 | Open in IMG/M |
3300006953|Ga0074063_13734163 | Not Available | 507 | Open in IMG/M |
3300009012|Ga0066710_104421055 | Not Available | 525 | Open in IMG/M |
3300009088|Ga0099830_10438544 | Not Available | 1060 | Open in IMG/M |
3300009090|Ga0099827_10203063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1649 | Open in IMG/M |
3300009090|Ga0099827_11479069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 591 | Open in IMG/M |
3300009094|Ga0111539_12872071 | Not Available | 558 | Open in IMG/M |
3300009137|Ga0066709_101206718 | Not Available | 1113 | Open in IMG/M |
3300009147|Ga0114129_11247073 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300009147|Ga0114129_11616251 | Not Available | 793 | Open in IMG/M |
3300009156|Ga0111538_11726996 | Not Available | 788 | Open in IMG/M |
3300009162|Ga0075423_12840114 | Not Available | 531 | Open in IMG/M |
3300009488|Ga0114925_10559383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
3300009551|Ga0105238_12121031 | Not Available | 596 | Open in IMG/M |
3300010037|Ga0126304_10104721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1793 | Open in IMG/M |
3300010038|Ga0126315_10332068 | Not Available | 944 | Open in IMG/M |
3300010038|Ga0126315_10680100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
3300010038|Ga0126315_10854908 | Not Available | 602 | Open in IMG/M |
3300010039|Ga0126309_10714475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
3300010046|Ga0126384_11955333 | Not Available | 560 | Open in IMG/M |
3300010322|Ga0134084_10474117 | Not Available | 503 | Open in IMG/M |
3300010362|Ga0126377_13090331 | Not Available | 537 | Open in IMG/M |
3300010364|Ga0134066_10244012 | Not Available | 618 | Open in IMG/M |
3300010366|Ga0126379_13640814 | Not Available | 516 | Open in IMG/M |
3300010373|Ga0134128_10307315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1775 | Open in IMG/M |
3300010373|Ga0134128_12561674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300010373|Ga0134128_12651968 | Not Available | 552 | Open in IMG/M |
3300010375|Ga0105239_13600835 | Not Available | 503 | Open in IMG/M |
3300010376|Ga0126381_102161050 | Not Available | 801 | Open in IMG/M |
3300011003|Ga0138514_100078078 | Not Available | 700 | Open in IMG/M |
3300011106|Ga0151489_1091702 | Not Available | 589 | Open in IMG/M |
3300012010|Ga0120118_1118979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300012011|Ga0120152_1108540 | Not Available | 777 | Open in IMG/M |
3300012014|Ga0120159_1003253 | All Organisms → cellular organisms → Bacteria | 8383 | Open in IMG/M |
3300012198|Ga0137364_10087134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2172 | Open in IMG/M |
3300012204|Ga0137374_10586007 | Not Available | 852 | Open in IMG/M |
3300012204|Ga0137374_11152128 | Not Available | 547 | Open in IMG/M |
3300012354|Ga0137366_10199357 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
3300012356|Ga0137371_10564891 | Not Available | 875 | Open in IMG/M |
3300012358|Ga0137368_10098856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2270 | Open in IMG/M |
3300012361|Ga0137360_10824635 | Not Available | 799 | Open in IMG/M |
3300012477|Ga0157336_1040318 | Not Available | 501 | Open in IMG/M |
3300012482|Ga0157318_1018894 | Not Available | 595 | Open in IMG/M |
3300012508|Ga0157315_1012984 | Not Available | 777 | Open in IMG/M |
3300012679|Ga0136616_10097814 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
3300012684|Ga0136614_10479850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 899 | Open in IMG/M |
3300012897|Ga0157285_10063347 | Not Available | 935 | Open in IMG/M |
3300012904|Ga0157282_10367285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300012912|Ga0157306_10103977 | Not Available | 828 | Open in IMG/M |
3300012922|Ga0137394_10430277 | Not Available | 1124 | Open in IMG/M |
3300012931|Ga0153915_13377158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300012960|Ga0164301_10110124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1602 | Open in IMG/M |
3300012961|Ga0164302_10820050 | Not Available | 705 | Open in IMG/M |
3300012972|Ga0134077_10308598 | Not Available | 666 | Open in IMG/M |
3300012975|Ga0134110_10179559 | Not Available | 882 | Open in IMG/M |
3300012976|Ga0134076_10554457 | Not Available | 531 | Open in IMG/M |
3300013102|Ga0157371_10249331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
3300013105|Ga0157369_11437332 | Not Available | 702 | Open in IMG/M |
3300013105|Ga0157369_11499992 | Not Available | 686 | Open in IMG/M |
3300013763|Ga0120179_1118248 | Not Available | 583 | Open in IMG/M |
3300013772|Ga0120158_10260065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 862 | Open in IMG/M |
3300014031|Ga0120173_1001119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3644 | Open in IMG/M |
3300014157|Ga0134078_10455241 | Not Available | 586 | Open in IMG/M |
3300014488|Ga0182001_10462982 | Not Available | 572 | Open in IMG/M |
3300014745|Ga0157377_10961595 | Not Available | 643 | Open in IMG/M |
3300014823|Ga0120170_1020978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1827 | Open in IMG/M |
3300014827|Ga0120171_1152515 | Not Available | 527 | Open in IMG/M |
3300015077|Ga0173483_10061369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1469 | Open in IMG/M |
3300015200|Ga0173480_11012191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
3300015356|Ga0134073_10178685 | Not Available | 690 | Open in IMG/M |
3300015371|Ga0132258_11953858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1477 | Open in IMG/M |
3300015372|Ga0132256_103244505 | Not Available | 547 | Open in IMG/M |
3300015374|Ga0132255_103771529 | Not Available | 644 | Open in IMG/M |
3300015374|Ga0132255_105329590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
3300017789|Ga0136617_10221818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1585 | Open in IMG/M |
3300017974|Ga0187777_11419809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300018081|Ga0184625_10347680 | Not Available | 771 | Open in IMG/M |
3300018432|Ga0190275_10359344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1451 | Open in IMG/M |
3300018468|Ga0066662_10471596 | Not Available | 1132 | Open in IMG/M |
3300018482|Ga0066669_10411446 | Not Available | 1149 | Open in IMG/M |
3300019767|Ga0190267_10515606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
3300019868|Ga0193720_1022055 | Not Available | 904 | Open in IMG/M |
3300021418|Ga0193695_1092364 | Not Available | 652 | Open in IMG/M |
3300022756|Ga0222622_10803921 | Not Available | 687 | Open in IMG/M |
3300022915|Ga0247790_10114976 | Not Available | 672 | Open in IMG/M |
3300023057|Ga0247797_1012158 | Not Available | 1037 | Open in IMG/M |
3300024286|Ga0247687_1016239 | Not Available | 1034 | Open in IMG/M |
3300024310|Ga0247681_1021141 | Not Available | 937 | Open in IMG/M |
3300024317|Ga0247660_1087275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300025504|Ga0208356_1007477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2539 | Open in IMG/M |
3300025910|Ga0207684_11616733 | Not Available | 524 | Open in IMG/M |
3300025916|Ga0207663_10337145 | Not Available | 1138 | Open in IMG/M |
3300025921|Ga0207652_11642028 | Not Available | 547 | Open in IMG/M |
3300025938|Ga0207704_11129340 | Not Available | 667 | Open in IMG/M |
3300025941|Ga0207711_11306516 | Not Available | 667 | Open in IMG/M |
3300025942|Ga0207689_10790843 | Not Available | 801 | Open in IMG/M |
3300025944|Ga0207661_11663365 | Not Available | 583 | Open in IMG/M |
3300025972|Ga0207668_12072702 | Not Available | 512 | Open in IMG/M |
3300025993|Ga0208415_1010262 | Not Available | 876 | Open in IMG/M |
3300026023|Ga0207677_10504049 | Not Available | 1047 | Open in IMG/M |
3300026075|Ga0207708_11419740 | Not Available | 609 | Open in IMG/M |
3300026078|Ga0207702_12341347 | Not Available | 522 | Open in IMG/M |
3300026121|Ga0207683_12000586 | Not Available | 528 | Open in IMG/M |
3300026308|Ga0209265_1047858 | Not Available | 1321 | Open in IMG/M |
3300026312|Ga0209153_1151350 | Not Available | 865 | Open in IMG/M |
3300026316|Ga0209155_1279569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
3300026318|Ga0209471_1287325 | Not Available | 547 | Open in IMG/M |
3300026327|Ga0209266_1191054 | Not Available | 758 | Open in IMG/M |
3300026552|Ga0209577_10329619 | Not Available | 1131 | Open in IMG/M |
3300027379|Ga0209842_1005326 | Not Available | 2553 | Open in IMG/M |
3300027736|Ga0209190_1162872 | Not Available | 954 | Open in IMG/M |
3300027862|Ga0209701_10705173 | Not Available | 520 | Open in IMG/M |
3300027897|Ga0209254_10373717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1065 | Open in IMG/M |
3300028138|Ga0247684_1047753 | Not Available | 691 | Open in IMG/M |
3300028138|Ga0247684_1071747 | Not Available | 569 | Open in IMG/M |
3300028577|Ga0265318_10265906 | Not Available | 626 | Open in IMG/M |
3300028587|Ga0247828_10923988 | Not Available | 564 | Open in IMG/M |
3300028596|Ga0247821_10546383 | Not Available | 742 | Open in IMG/M |
3300028708|Ga0307295_10191042 | Not Available | 578 | Open in IMG/M |
3300028715|Ga0307313_10098045 | Not Available | 890 | Open in IMG/M |
3300028719|Ga0307301_10111542 | Not Available | 870 | Open in IMG/M |
3300028744|Ga0307318_10082067 | Not Available | 1082 | Open in IMG/M |
3300028754|Ga0307297_10031917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1553 | Open in IMG/M |
3300028755|Ga0307316_10040146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1552 | Open in IMG/M |
3300028755|Ga0307316_10157644 | Not Available | 810 | Open in IMG/M |
3300028771|Ga0307320_10174177 | Not Available | 837 | Open in IMG/M |
3300028771|Ga0307320_10476664 | Not Available | 504 | Open in IMG/M |
3300028784|Ga0307282_10332398 | Not Available | 734 | Open in IMG/M |
3300028784|Ga0307282_10490583 | Not Available | 596 | Open in IMG/M |
3300028791|Ga0307290_10244283 | Not Available | 658 | Open in IMG/M |
3300028793|Ga0307299_10223613 | Not Available | 707 | Open in IMG/M |
3300028799|Ga0307284_10441685 | Not Available | 532 | Open in IMG/M |
3300028807|Ga0307305_10040944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2129 | Open in IMG/M |
3300028807|Ga0307305_10047410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1980 | Open in IMG/M |
3300028811|Ga0307292_10358395 | Not Available | 616 | Open in IMG/M |
3300028814|Ga0307302_10462909 | Not Available | 628 | Open in IMG/M |
3300028819|Ga0307296_10768342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
3300028876|Ga0307286_10118208 | Not Available | 939 | Open in IMG/M |
3300030619|Ga0268386_10432362 | Not Available | 917 | Open in IMG/M |
3300031199|Ga0307495_10122587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
3300031200|Ga0307496_10076290 | Not Available | 615 | Open in IMG/M |
3300031344|Ga0265316_10456877 | Not Available | 916 | Open in IMG/M |
3300031715|Ga0307476_11279431 | Not Available | 536 | Open in IMG/M |
3300031720|Ga0307469_10534634 | Not Available | 1035 | Open in IMG/M |
3300031747|Ga0318502_10881447 | Not Available | 544 | Open in IMG/M |
3300031769|Ga0318526_10447134 | Not Available | 528 | Open in IMG/M |
3300031781|Ga0318547_10649812 | Not Available | 655 | Open in IMG/M |
3300031799|Ga0318565_10442440 | Not Available | 629 | Open in IMG/M |
3300031910|Ga0306923_11795989 | Not Available | 630 | Open in IMG/M |
3300032004|Ga0307414_11161841 | Not Available | 714 | Open in IMG/M |
3300032180|Ga0307471_101748875 | Not Available | 774 | Open in IMG/M |
3300032893|Ga0335069_11014292 | Not Available | 920 | Open in IMG/M |
3300032955|Ga0335076_10007515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10978 | Open in IMG/M |
3300033158|Ga0335077_11293203 | Not Available | 709 | Open in IMG/M |
3300034820|Ga0373959_0052717 | Not Available | 882 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.09% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.22% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.74% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.35% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.35% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.91% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.44% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.44% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.48% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.48% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.48% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.48% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.48% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.48% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.48% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.48% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.48% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.48% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.48% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.48% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.48% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4MG_04740550 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | AVERLERLGLVRHARRESLALTGRGRFLGGGVTAELLA |
ICChiseqgaiiFebDRAFT_135249651 | 3300000363 | Soil | EALDRMASLGLAMVAGGQADRTLALTSRGRFLGGGVTAELLA* |
JGI10214J12806_120355221 | 3300000891 | Soil | VERLERLGLVAREGGELTLTERGRYLGGGVTVELLA* |
JGI10216J12902_1003324231 | 3300000956 | Soil | ERHGLLAATDETLTLTRRGRFLGGGVTAELLTAAG* |
JGI10216J12902_1081892571 | 3300000956 | Soil | LEGLGLAARAGANGDETLVLSERGRFLGGGVTADLLA* |
JGI10216J12902_1085778422 | 3300000956 | Soil | ERLGLALRSGANGVETLVLTERGRFLGGGVTADLLA* |
JGI10216J12902_1212769341 | 3300000956 | Soil | ERLERLGLAAREGLNGDETIVLTDRGRFLGGGVTADLLA* |
F14TB_1000227503 | 3300001431 | Soil | LEQLGLIRRAETGDALALTERGRFLGGGVTAELLV* |
F14TB_1008594731 | 3300001431 | Soil | VDQAALGRLEGLGLLARRVDENGEEDLALTHRGRLLGGGVTAELLV* |
A2065W1_104569382 | 3300001537 | Permafrost | LERLGLVKRGSAGAELALTERGRFLGGGVTAELLA* |
C688J18823_100233531 | 3300001686 | Soil | LRSALDAEGLARAEELGLAVDGGETLALTRRGRFLGGGVTAEIVA* |
C688J18823_100651283 | 3300001686 | Soil | LERLGLAAVTGRSPSRTLELTTRGRFLGGGVTAELLA* |
C688J35102_1185638922 | 3300002568 | Soil | ERVRAAVDEEALARLVRLGLVEPVAGDGRLGRTLTLTARGRLLGGGVTAELLA* |
C688J35102_1190884531 | 3300002568 | Soil | DAQELARLEGLGLAVRDGQTLALTPRGRFLGGGVTARLVA* |
C688J35102_1191121872 | 3300002568 | Soil | RALDPHELERLERLGLAELRDHTLALTPRGRFLGGGVTAALLA* |
Ga0062590_1001019731 | 3300004157 | Soil | LSRLERLGLARVGGDGGVRSLTLTARGRFLGDGVTAELLA* |
Ga0062595_1005552011 | 3300004479 | Soil | ALDTTGLARVEELGLAVDGGETLALTRRGRFLGGAVTAEILA* |
Ga0062595_1016045151 | 3300004479 | Soil | AVGLARAEKLGLAVDGGRTLVLTRRGRFLGGAVTAEILA* |
Ga0062594_1032026252 | 3300005093 | Soil | NGDAVRKLERLGLASLEDGERSLSLTRRGRFLGGGVTAELLA* |
Ga0062594_1033261202 | 3300005093 | Soil | ERLERLGLAETSAAGAELALTRRGRFLGGGVTAELLSDG* |
Ga0066675_110802741 | 3300005187 | Soil | LQSTLDWSAVGRLERLGLVRRHAGSSLGSAGGALTLTARGRFVGGGVTAELLA* |
Ga0070683_1019036771 | 3300005329 | Corn Rhizosphere | AGLSEALDGVAIERLERLGLVARGPAEDELALTERGRFLGGGVTAELLA* |
Ga0070691_101208332 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVDRLERLGLVQRGEAGDALALTERGRFLGGGVTAELLA* |
Ga0070674_1006862712 | 3300005356 | Miscanthus Rhizosphere | ASVERLERLGLVQRRAGGAELALTERGRFLGGGVTADLLT* |
Ga0070705_1006400251 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PASVERLERLGLVQRRAGGAELALTERGRFLGGGVTADLLT* |
Ga0070708_1018871972 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AVDPASVERLERLGLVLRSGGGAELALTERGRFLGGGVTADLLT* |
Ga0066689_104456371 | 3300005447 | Soil | VDWSSVERLERLGLVRSGGFPDGTLTLTTRGRLLGGGVTAELLA* |
Ga0066687_101801682 | 3300005454 | Soil | ESALDWRAVDRLERLGLLKGGDAGVLALTPRGRFLGGGVTAEILA* |
Ga0070678_1021494442 | 3300005456 | Miscanthus Rhizosphere | LRSALDAQGLARAERLGLAVAAGETLALTRRGRFLGGAVTAEIVA* |
Ga0070662_1003047602 | 3300005457 | Corn Rhizosphere | SLDGLESAVDPASVERLERLGLVLRSGGGAELALTERGRFLGGGVTADLLT* |
Ga0068867_1001476801 | 3300005459 | Miscanthus Rhizosphere | VDPAAIERLERLGLVARGPAGDELALTDRGRFLGGGVTAELLA* |
Ga0070707_1000080251 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DPAGLARVEQFGLAVDRGETLALTRRGRFLGGAVTAEIVA* |
Ga0070707_1007181901 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AVDRLERLGLVQRRGEARALALTRQGRFLGGGVTAELLA* |
Ga0070697_1003353772 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DQGAMSRLVRLGLVRADARTVSLTSRGRYLGGGVTADLLA* |
Ga0070695_1001481733 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ASVERLERLGLVQRRGGGAELALTERGRFLGGGVTADLLT* |
Ga0070695_1004309842 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | IDRLERLGLIVRAGVNGHETLALTERGRFLGGGVTADLLA* |
Ga0070704_1010782492 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | GAVDRLERLGLVSRGSGRADALELTPRGRFLGGGVTAALLA* |
Ga0066707_109432071 | 3300005556 | Soil | SGVERMERLGLARRMGPGALALTERGRFLGGGVTAELIAG* |
Ga0058697_103990181 | 3300005562 | Agave | DLAALERLERLGLAARSQDRGREGADLVLTSRGRFLGGAVTADLLA* |
Ga0066703_105748842 | 3300005568 | Soil | PVADRVDRTALERLERLGLARVVGAPDAEALTLTPRGRRLGGGVTAELLA* |
Ga0066703_107874622 | 3300005568 | Soil | VLDERAVSRLELLGLVRSDSDRQTLALTPRGRFLGGGVTVDLLA* |
Ga0066702_109638311 | 3300005575 | Soil | GLERAERLGLAVEAEGTLTLTPRGRFLGGGVTAEILAQ* |
Ga0066905_1015193022 | 3300005713 | Tropical Forest Soil | LEDAVDDVALARLERLDLATTHGPRDGRLLTLTNRGRYLGGGVTAELLV* |
Ga0066903_1005383301 | 3300005764 | Tropical Forest Soil | RLERLGLAAIAGANGHRTLRLTERGRFLGGGVTADLLA* |
Ga0081455_102236581 | 3300005937 | Tabebuia Heterophylla Rhizosphere | QADAVVDRAALGRLEALGLLVRRAGENGEEDLALTHRGRLLGGGVTAELLV* |
Ga0081538_100600863 | 3300005981 | Tabebuia Heterophylla Rhizosphere | AWRRLVALGLVASGENADTVALTRRGRFLGGRVTAELLA* |
Ga0070715_104940942 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RLQRLGLVDSREQTLTLTPRGRMLGGGVTADLLA* |
Ga0068871_1004935231 | 3300006358 | Miscanthus Rhizosphere | LDTDGLARAERLGLAVDGGETLALTRRGRFLGGGVTAEILA* |
Ga0079222_119671642 | 3300006755 | Agricultural Soil | LGLAQRAGANGSETLVLTPRGRFLGGGVTADLLA* |
Ga0066665_104216381 | 3300006796 | Soil | ALSRLEQLGLVRSDEDSLALTPRGRFLGGGVTADLLA* |
Ga0079221_109708771 | 3300006804 | Agricultural Soil | LRSALDPDGLARAERLGLAIDSGETLALTPRGRFLGGGVTAEILA* |
Ga0075425_1002740711 | 3300006854 | Populus Rhizosphere | GCSDAIDPDGLRRMERLGLARVRRASGGTPDVALTPRGRLLGGGVTAEILA* |
Ga0075429_1001924713 | 3300006880 | Populus Rhizosphere | GDAVDRLERLGLVQRGQAGDVLALTERGRFLGGGVTAELLA* |
Ga0074063_137341632 | 3300006953 | Soil | LERLERLGLAERTGVNGDETLALTERGRFLGGGVTADLLA* |
Ga0066710_1044210551 | 3300009012 | Grasslands Soil | DHTALERLERLGLVARTNGSLALTPRGRMLGGGVTADLLA |
Ga0099830_104385441 | 3300009088 | Vadose Zone Soil | QALAHLERLGLVRSTELTLELTARGRFLGGGVTAELLV* |
Ga0099827_102030631 | 3300009090 | Vadose Zone Soil | LDGLALERLERLGLAERNGKAGAGDGATLTLTRRGRFLGGGVTAELLA* |
Ga0099827_114790691 | 3300009090 | Vadose Zone Soil | EGLARLERLGLAERASGTLALTRRGRFLGDGVTARLLA* |
Ga0111539_128720711 | 3300009094 | Populus Rhizosphere | RLVGLGLVRREGRGGRTALTLTPRGRLLGGGVTAELLA* |
Ga0066709_1012067181 | 3300009137 | Grasslands Soil | AEVVDERAVSRLALLGLVRSDAERQTLALTPRGRFLGGGVTADLLV* |
Ga0114129_112470731 | 3300009147 | Populus Rhizosphere | LDREALARLERHGLAERAGVDGSETLALTPRGRFLGGGVTVA |
Ga0114129_116162512 | 3300009147 | Populus Rhizosphere | EGLEEAVDPAALDRLRRLGLVKSGDGGAQLALTEHGRFLGGGVTADLLA* |
Ga0111538_117269962 | 3300009156 | Populus Rhizosphere | LARLERLGLVARNGVNGHETLALTERGRFLGGGVTAELLA* |
Ga0075423_128401142 | 3300009162 | Populus Rhizosphere | AVDPAAVERLRRLGLVAAGNGGTELALTKHGRFLGGGVTADLLT* |
Ga0114925_105593832 | 3300009488 | Deep Subsurface | QAAGLIEVDDPSEGLRHLCLTRRGRFLGGGVTAELLA* |
Ga0105238_121210312 | 3300009551 | Corn Rhizosphere | LARAERLGLAVAAGETLALTRRGRFLGGAVTAEIVV* |
Ga0126304_101047213 | 3300010037 | Serpentine Soil | PAAFARLSKLGLAEQVDGSLTLTERGRFLGGGVTAELLAS* |
Ga0126315_103320682 | 3300010038 | Serpentine Soil | LARLERLGLAHVDAETDGRSLVLTTRGRFLGGGVTAELLA* |
Ga0126315_106801002 | 3300010038 | Serpentine Soil | GLVEPDADGGHAGRTLTLTRRGRFLVGGVTAELLA* |
Ga0126315_108549081 | 3300010038 | Serpentine Soil | RLERLGLVERPAARGELALTDRGRFLGGGVTAELLA* |
Ga0126309_107144751 | 3300010039 | Serpentine Soil | VEVALDAAALERLERLGLATVAGGTEAPSLSLTRRGRFLGDGVTAELLA* |
Ga0126308_107611262 | 3300010040 | Serpentine Soil | DALARLVSLGLVRRDGGALALTPRGRFLGGAVTADLLA* |
Ga0126384_119553332 | 3300010046 | Tropical Forest Soil | LDRLETLGLAARDGQGMLSLTVRGRFLGGGVTAELLA* |
Ga0134084_104741171 | 3300010322 | Grasslands Soil | RAEQLGLAVDGGETLALTRRGRFLGGGVTAEIVA* |
Ga0126377_130903311 | 3300010362 | Tropical Forest Soil | DGLARAEKLGLAVDGGETLALTRRGRFLGGGVTAEILA* |
Ga0134066_102440122 | 3300010364 | Grasslands Soil | MRALGLADLAGGRGTATLALTRRGRFLGGGVTAELIA* |
Ga0126379_136408141 | 3300010366 | Tropical Forest Soil | ALDPAGLARAERLGLAVEEGDTLTLTSRGRYLGGGVTAEILA* |
Ga0134128_103073151 | 3300010373 | Terrestrial Soil | LARAEKLGLAVDGGETLELTRRGRFLGGAVTAEILA* |
Ga0134128_125616742 | 3300010373 | Terrestrial Soil | PRRLDGLRPALDAVGLARAEKLGLAVDGGRTLVLTRRGRFLGGAVTAEILA* |
Ga0134128_126519681 | 3300010373 | Terrestrial Soil | ERLGLVARSDDGGELALTARGRFLGGGVTAELLA* |
Ga0105239_136008351 | 3300010375 | Corn Rhizosphere | ADGLARAEMLGLAVDGGDTLALTRRGRFLGGGVTAEILA* |
Ga0126381_1021610501 | 3300010376 | Tropical Forest Soil | VDADGLARVERLGLAVDGGETLALTRRGRFLGGGVTADILV* |
Ga0138514_1000780781 | 3300011003 | Soil | GNALERLELLGLARTGEAAGGRTLVLTRRGRFLGGGVTAELLA* |
Ga0151489_10917021 | 3300011106 | Soil | LGDALDDAALQRLTGLGLVRHDEHTIALTRRGRFLGGGVTADLLT* |
Ga0120118_11189792 | 3300012010 | Permafrost | LELLGLVRRDDERRTLALTRRGRFLGGGVTADLLA* |
Ga0120152_11085401 | 3300012011 | Permafrost | ELLGLVRSDADRQTLALTHRGRFLGGGVTADLLT* |
Ga0120159_10032531 | 3300012014 | Permafrost | GRALERLERLGLARTGEAAGGRTLALTRRGRFLGGGVTAELLA* |
Ga0137364_100871341 | 3300012198 | Vadose Zone Soil | SALERLQRLGLVDRTGPTLALTARGRMLGGGVTADLLT* |
Ga0137374_105860071 | 3300012204 | Vadose Zone Soil | ALDHAALGRLEQLGLAAPGGEAGAETLTLTERGRFLGGGVTAELLA* |
Ga0137374_111521281 | 3300012204 | Vadose Zone Soil | ALERLERLGLAVRSNGSLALTARGRMLGGGVTADLLA* |
Ga0137366_101993574 | 3300012354 | Vadose Zone Soil | AALERLERLGLATVARAPDAPSLALTGRGRFLGDGVTAELLA* |
Ga0137371_105648911 | 3300012356 | Vadose Zone Soil | LERMEALGLAARVGLEQLQLTTRGRFLGGGVTAELLA* |
Ga0137368_100988561 | 3300012358 | Vadose Zone Soil | LGLARHELDRAGARTLALTWRGRLLGGGVTADLLA* |
Ga0137360_108246351 | 3300012361 | Vadose Zone Soil | RAVSRLELLGLVQSDADRRTLTLTPRGRFLGGGVTADLLA* |
Ga0157336_10403181 | 3300012477 | Arabidopsis Rhizosphere | EAVDPAAVDRLRRLGLVESGDGGAQLALTEHGRFLGGGVTADLLA* |
Ga0157318_10188941 | 3300012482 | Arabidopsis Rhizosphere | LRRLGLVESGDGGAQLALTEHGRFLGGGVTADLLA* |
Ga0157315_10129842 | 3300012508 | Arabidopsis Rhizosphere | EEAVDPAAVDRLRRLGLVESGDGGAQLALTEHGRFLGGGVTADLLA* |
Ga0136616_100978143 | 3300012679 | Polar Desert Sand | GALERLAGGGLVEPSAGGSTLALTTRGRFLGGGVTAELLAT* |
Ga0136614_104798502 | 3300012684 | Polar Desert Sand | LDGEAAARLERQDLVWRSADATQLTLTPRGRFLGGGVAAELIA* |
Ga0157285_100633471 | 3300012897 | Soil | LGLAEVRGRNGDARLALTRRGRFLGGGVTAELLA* |
Ga0157282_103672852 | 3300012904 | Soil | LERLERLGLAETSADGAGLFLTRRGRFLGGGVTAELLA* |
Ga0157306_101039772 | 3300012912 | Soil | ERLGLVQRGEAGDALALTERGRFLGGGVTAELLA* |
Ga0137394_104302772 | 3300012922 | Vadose Zone Soil | LELLGLVRSDVDRQTLALTRRGRFLGGGVTADLLT* |
Ga0153915_133771582 | 3300012931 | Freshwater Wetlands | VERLAGLGLAERGEGSLALTRRGRFLGGGVTARLLA* |
Ga0164301_101101241 | 3300012960 | Soil | LGLAARTGVNGDETLVLTERGRFLGGGVTADLLA* |
Ga0164302_108200501 | 3300012961 | Soil | ERLERLGLVARGPGEGELALTERGRFLGGGVTAELRA* |
Ga0134077_103085982 | 3300012972 | Grasslands Soil | RAVSRLELLGLVHSDADRQTLVLTHRGRFLGGGVTADLLT* |
Ga0134110_101795591 | 3300012975 | Grasslands Soil | ERLERLGLVRAEQTAAGRELALTERGRFLGGGVTADLLA* |
Ga0134076_105544571 | 3300012976 | Grasslands Soil | LERLQRLGLVDRTGATLALTARGRMLGGGVTADLLT* |
Ga0157371_102493313 | 3300013102 | Corn Rhizosphere | LERLQRLGLVERADDTLTLTSRGRMLGGGVTADLLA* |
Ga0157369_114373321 | 3300013105 | Corn Rhizosphere | AEALARAERLGLAVDGGETLALTRRGRFLGGGVTADILA* |
Ga0157369_114999921 | 3300013105 | Corn Rhizosphere | RAEKLGLAVDGGETLELTRRGRFLGGAVTAEILA* |
Ga0120179_11182482 | 3300013763 | Permafrost | TEALERLERLGLAARAGADEETTLALTRRGRFLGGGVTAELLA* |
Ga0120158_102600652 | 3300013772 | Permafrost | AGLERVLDGAAVEWMERLGLAQRTGDSLRLTHRGRFVGGGVTAELLV* |
Ga0120173_10011195 | 3300014031 | Permafrost | RLGLARTGEAAGGRTLALTRRGRFLGGGVTAELLA* |
Ga0134078_104552412 | 3300014157 | Grasslands Soil | LQRLGLVDRRGSAEEAELTLTRRGRFLGGGVTAELLA* |
Ga0182001_104629822 | 3300014488 | Soil | LGLAERTRGGDGAETVALTTRGRYLGGGVTAELLA* |
Ga0157377_109615951 | 3300014745 | Miscanthus Rhizosphere | LERLGLAATAGANGHRTLALTERGRFLGGGVTADLLA* |
Ga0120170_10209783 | 3300014823 | Permafrost | ALERLEGLGLARTGEAAGGRTLALTRRGRFLGGGVTAELLA* |
Ga0120171_11508572 | 3300014827 | Permafrost | QLERLEALGLVVREAGSLALTPRGRFLGGGVTARLLS* |
Ga0120171_11525151 | 3300014827 | Permafrost | LEGALDTTALARVERLGLAAVAGGPDDASLALTPRGRFLGGGVTADLLA* |
Ga0173483_100613691 | 3300015077 | Soil | RALDAEGLARAEKLGLAVDSGETLELTRRGRFLGGGVTAEILA* |
Ga0173480_110121912 | 3300015200 | Soil | DALDGAALQRLTGLGLVRHDERTIALTRRGRFLGGGVTADLLT* |
Ga0134073_101786851 | 3300015356 | Grasslands Soil | AALRRLERLGLARLDAEVDGRSLVLTPRGRFLGGGVTAELLA* |
Ga0132258_119538581 | 3300015371 | Arabidopsis Rhizosphere | RMLRLGLAVADDGTLALTPRGRFLGGGVTAELLA* |
Ga0132256_1032445052 | 3300015372 | Arabidopsis Rhizosphere | RLGLAQRAGVNGEETLVLTERGRFLGGGVTADLLA* |
Ga0132255_1037715291 | 3300015374 | Arabidopsis Rhizosphere | RLERSGLTRLGGTAATLALTRRGRFLGGGVTAQLLV* |
Ga0132255_1053295901 | 3300015374 | Arabidopsis Rhizosphere | SELGLAEVRGRNGDATLALTRRGRFLGGGVTADLLA* |
Ga0136617_102218183 | 3300017789 | Polar Desert Sand | DDAALRRLTGLGLVRHDERTIALTRRGRFLGGGVTADLLA |
Ga0187777_114198092 | 3300017974 | Tropical Peatland | ARAETLGLAVESDGTLALTPRGRFLGGGVTADILA |
Ga0184625_103476802 | 3300018081 | Groundwater Sediment | RRLELVETAGSGVLLTPRGRRLGGGVTAELLAYTDT |
Ga0190275_103593441 | 3300018432 | Soil | RLEQQGLARLLDGGARLELTERGRFLGGGVTAELLA |
Ga0066662_104715961 | 3300018468 | Grasslands Soil | LAHLERLGLVRSNESTLELTARGRFLGGGVTAELLV |
Ga0066669_104114462 | 3300018482 | Grasslands Soil | ALDAEGLARAEQLGLAVDGGETLALTRRGRFLGGGVTAEIVA |
Ga0190267_105156061 | 3300019767 | Soil | LQRLGLARTLDGGALLELTPRGRFLGGGVTAELLT |
Ga0193720_10220551 | 3300019868 | Soil | KLLGLARTGEAAGSRTLALTHRGRFLGGGVTAELLA |
Ga0193695_10923641 | 3300021418 | Soil | RAVSRLELLGLVRSDGERQTLALTRRGRFLGGGVTADLLT |
Ga0222622_108039211 | 3300022756 | Groundwater Sediment | LAVDGLARAVDWAAVERLERLGLVQHERRESLALTGRGRYLGGGVTAELLA |
Ga0247790_101149761 | 3300022915 | Soil | DLGLAEVRGRNGDATLALTRRGRFLGGGVTAELLA |
Ga0247797_10121581 | 3300023057 | Soil | DRLERLGLVQRGEAGDALALTERGRFLGGGVTAELLA |
Ga0247687_10162391 | 3300024286 | Soil | DPDALARLERLGLAATAGANGHRTLALTERGRFLGGGVTADLLA |
Ga0247681_10211412 | 3300024310 | Soil | LARLERLGLVARSAGGGTLALTERGRFLGGGVTAELLA |
Ga0247660_10872752 | 3300024317 | Soil | DGVVRAEQLGLAVDSGETLALTRRGRFLGGGVTAEIVA |
Ga0208356_10074771 | 3300025504 | Arctic Peat Soil | PAGLARVEQLGLAERGDGTLMLTERGRFLGGGVTTELLAR |
Ga0207684_116167332 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AAALERLERLGLATVAGSMGAHSLALTRRGRFLGDGVTAELLA |
Ga0207663_103371451 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RLERLGLAERAGVNGDETLVLTERGRFLGGGVTAALLA |
Ga0207652_116420282 | 3300025921 | Corn Rhizosphere | ATGLARAEKLGLAVDGGETLELTRRGRFLGGAVTAEILA |
Ga0207704_111293402 | 3300025938 | Miscanthus Rhizosphere | DGEALRRLERLGLACVGDGPSVSLTERGRFLGGGVTAELLA |
Ga0207711_113065161 | 3300025941 | Switchgrass Rhizosphere | ERLGLVVRAGVNGHETLALTERGRFLGGGVTADLLA |
Ga0207689_107908431 | 3300025942 | Miscanthus Rhizosphere | LARAVDWAAVERLERLGLMRHEQRESLALTGRGRYLGGGVTAELLA |
Ga0207661_116633651 | 3300025944 | Corn Rhizosphere | AGLSEALDGVAIERLERLGLVARGPAEDELALTERGRFLGGGVTAELLA |
Ga0207668_120727022 | 3300025972 | Switchgrass Rhizosphere | LERLGLVQRGEAGDALALTERGRFLGGGVTAELLA |
Ga0208415_10102622 | 3300025993 | Rice Paddy Soil | LRRLEQLGLARRGGRGSGAETLALTERGRFLGGGVTAELLA |
Ga0207677_105040491 | 3300026023 | Miscanthus Rhizosphere | ESAVDPASVERLERLGLVLRSGGGAELALTERGRFLGGGVTADLLT |
Ga0207708_114197401 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RLERLGLAEHAGVNGDETLALTERGRFLGGGVTADLLA |
Ga0207702_123413471 | 3300026078 | Corn Rhizosphere | EALARAERLGLAVDGGETLALTRRGRFLGGGVTADILA |
Ga0207683_120005861 | 3300026121 | Miscanthus Rhizosphere | LRSALDAQGLARAERLGLAVAAGETLALTRRGRFLGGAVTAEIVA |
Ga0209265_10478583 | 3300026308 | Soil | AAGLARAEQLGLAVDGGETLALTRRGRFLGGGVTAEIVA |
Ga0209153_11513502 | 3300026312 | Soil | LRLALDATGLARAEKLGLAVDGGETLELTRRGRFLGGAVTAEILA |
Ga0209155_12795692 | 3300026316 | Soil | ERLGLVESGRSTDGTLALTTHGRFLGGGVTAELLA |
Ga0209471_12873252 | 3300026318 | Soil | GLARAEELGLAVDSGVTLALTRRGRFLGGGVTAEIVV |
Ga0209266_11910541 | 3300026327 | Soil | EAALDADAVARMLRLGLAELAKEEGSRALALTPRGRFLGGGVTAELLA |
Ga0209577_103296192 | 3300026552 | Soil | DGAALARLESLGLAVRDGADATLALTERGRFLGGAVTAALLA |
Ga0209842_10053261 | 3300027379 | Groundwater Sand | VDSSALARLQQLGLVRSGRDATGGPTLELTPRGRLLGGGVTADLLA |
Ga0209190_11628721 | 3300027736 | Freshwater Lake | VARYRKLGLVEPDTGDGRLCLTRRGRFVGGGVTAELLA |
Ga0209701_107051731 | 3300027862 | Vadose Zone Soil | ALERLEQLGLAERRTAADGARALALTARGRFLGGGVTADLLA |
Ga0209254_103737172 | 3300027897 | Freshwater Lake Sediment | RMERLGLVERGGAGGSGWLTLTRRGRFLGGGVTVELLA |
Ga0247684_10477531 | 3300028138 | Soil | VVRAEQLGLAVDSGETLVLTRRGRFLGGGVTAEIVA |
Ga0247684_10717471 | 3300028138 | Soil | ERLGLAATAGANGHRTLALTERGRFLGGGVTADLLA |
Ga0265318_102659062 | 3300028577 | Rhizosphere | RLEQLGLAERAGANGHETLALTERGRYLGGGVTADLLA |
Ga0247828_109239882 | 3300028587 | Soil | VERLERLGLVLRSGGGAELALTERGRFLGGGVTADLLT |
Ga0247821_105463832 | 3300028596 | Soil | VERLERLGLATRTGTELTLTRRGRFLGGGVTAELLA |
Ga0307295_101910421 | 3300028708 | Soil | LLRLERLGLVESNAQTLALTQRGRFLGGGVTADLLA |
Ga0307313_100980451 | 3300028715 | Soil | VSRLELLGLVRSDAGRQTLALTHRGRFLGGGVTADLLR |
Ga0307301_101115421 | 3300028719 | Soil | ERLERLGLVERGAAGAELALTDRGRFLGGGVTAELLA |
Ga0307318_100820671 | 3300028744 | Soil | RLERLGLVERGHGAEELALTERGRFLGGGVTAELLA |
Ga0307297_100319173 | 3300028754 | Soil | ARLELLGLARTLDNGALLELTTRGRFLGGGVTAELLA |
Ga0307316_100401461 | 3300028755 | Soil | DVALERLERLGLAAVTGRSPARTLELTTRGRFLGGGVTADLLA |
Ga0307316_101576442 | 3300028755 | Soil | VDGRAVSRLELLGLVRSDGERQTLALTRRGRFLGGGVTADLLT |
Ga0307320_101741772 | 3300028771 | Soil | LEQLGLLVRPAGDSDDALALTKRGRLLGGGVTAELLA |
Ga0307320_104766642 | 3300028771 | Soil | IDGAALERLGRLGFVDGTTAAGELALTPRGRFLGGGVTAELLA |
Ga0307282_103323981 | 3300028784 | Soil | RLERLGLAQTEEAAGSRTLALTRRGRFLGGGVTAELLA |
Ga0307282_104905832 | 3300028784 | Soil | AIDGVALERLERLGLAQTDEAAAGRTLALTHRGRFLGGGVTADLLA |
Ga0307290_102442831 | 3300028791 | Soil | RLERLGLVQRRGGGAELALTERGRFLGGGVTADLLT |
Ga0307299_102236131 | 3300028793 | Soil | PASVERLERLGLVQRRGGGAELALTERGRFLGGGVTADLLT |
Ga0307284_104416852 | 3300028799 | Soil | RLERLGLAQTDEAAAGRTLALTHRGRFLGGGVTADLLA |
Ga0307305_100409443 | 3300028807 | Soil | VERLERLGLVERGAAGAELALTDRGRFLGGGVTAELLA |
Ga0307305_100474103 | 3300028807 | Soil | DEHAVSRLEVLGLVRSDAERRTLALTPRGRFLGGGVTAELLV |
Ga0307292_103583952 | 3300028811 | Soil | LELVARGRGGSEGESLTLTPRGRLLGGGVTAELLA |
Ga0307302_104629092 | 3300028814 | Soil | RLERLGLVERGAAGAELALTDRGRFLGGGVTAELLA |
Ga0307296_107683422 | 3300028819 | Soil | LELLGLARTGEAAGGRTLALTRRGRFLGGGVTAELLA |
Ga0307286_101182081 | 3300028876 | Soil | ASVERLERLGLVQRRGGGAELALTERGRFLGGGVTADLLA |
Ga0268386_104323622 | 3300030619 | Soil | LDRHGLVRLAGDGAALTLTARGRFLGGGVTAELLA |
Ga0307495_101225872 | 3300031199 | Soil | RLERLGLAEVREGGTVLELTRRGRFLGGGVTAELLV |
Ga0307496_100762902 | 3300031200 | Soil | SVAVERLERLGLVERGAAGAELALTDRGRFLGGGVTAELLA |
Ga0265316_104568772 | 3300031344 | Rhizosphere | AGLERAERLGLAVESDGSLTLTRRGRFLGGGVTAEIVA |
Ga0307476_112794312 | 3300031715 | Hardwood Forest Soil | ARAERLGLAVDGGETLALTRRGRFLGGGVTAEILA |
Ga0307469_105346341 | 3300031720 | Hardwood Forest Soil | AQGLARARHLGLAVDDGETLALTWRGRFLGGGVTAEIIA |
Ga0318502_108814471 | 3300031747 | Soil | IGRLESLGLAERHELGTLTLTPRGRFLGGGVTAELLA |
Ga0318526_104471341 | 3300031769 | Soil | ALDQPALDRLESLGLAVRQGRETLTLTPRGRLLGGGVTAELLA |
Ga0318547_106498121 | 3300031781 | Soil | AALERLERLELATTRGPRERRVLALTTRGRYLGGGVTAELLA |
Ga0318565_104424401 | 3300031799 | Soil | GVEAALDQPALDRLESLGLAVRQGRETLTLTPRGRLLGGGVTAELLA |
Ga0306923_117959891 | 3300031910 | Soil | ALDGEALARLERLGLAARSGGKTLTLTPRGRLLGGGVTAELLA |
Ga0307414_111618412 | 3300032004 | Rhizosphere | RLELLGLVRRGGAGEALTLTERGRFLGGGVTAELLA |
Ga0307471_1017488752 | 3300032180 | Hardwood Forest Soil | PARDAEALARAERLGLAVDGGETLALTRRGRFLGGGVTADILA |
Ga0335069_110142922 | 3300032893 | Soil | LARAERLGLVVDRGDTLALTRRGRFLGGGVTAEIVA |
Ga0335076_100075151 | 3300032955 | Soil | PALDPEGLARAEGLGLAVDSGETLALTRRGRFLGGAVTAEILA |
Ga0335077_112932031 | 3300033158 | Soil | LRSALDPEGLARAERLGLAVDAGETLALTRRGRFLGGGVTAEILA |
Ga0373959_0052717_9_125 | 3300034820 | Rhizosphere Soil | VKRLERLGLVARSDDGGELALTERGRFLGGGVTAELLA |
⦗Top⦘ |