| Basic Information | |
|---|---|
| Family ID | F023548 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 209 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSGDAENTRL |
| Number of Associated Samples | 181 |
| Number of Associated Scaffolds | 209 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 31.58 % |
| % of genes near scaffold ends (potentially truncated) | 97.61 % |
| % of genes from short scaffolds (< 2000 bps) | 88.52 % |
| Associated GOLD sequencing projects | 177 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.565 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.397 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.880 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.110 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 209 Family Scaffolds |
|---|---|---|
| PF06723 | MreB_Mbl | 92.82 |
| PF04085 | MreC | 1.44 |
| PF13231 | PMT_2 | 0.96 |
| PF04773 | FecR | 0.96 |
| PF00171 | Aldedh | 0.96 |
| PF00155 | Aminotran_1_2 | 0.48 |
| PF00793 | DAHP_synth_1 | 0.48 |
| PF02786 | CPSase_L_D2 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
|---|---|---|---|
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 92.82 |
| COG1792 | Cell shape-determining protein MreC | Cell cycle control, cell division, chromosome partitioning [D] | 1.44 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.96 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.04 % |
| Unclassified | root | N/A | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001471|JGI12712J15308_10138115 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300001471|JGI12712J15308_10153943 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300001593|JGI12635J15846_10257175 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100433630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1192 | Open in IMG/M |
| 3300002917|JGI25616J43925_10046558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1887 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10254884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 713 | Open in IMG/M |
| 3300004080|Ga0062385_10322835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300004139|Ga0058897_11019821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300004294|Ga0068945_1145713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 519 | Open in IMG/M |
| 3300004476|Ga0068966_1404149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 503 | Open in IMG/M |
| 3300005176|Ga0066679_10260266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300005518|Ga0070699_100017498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6152 | Open in IMG/M |
| 3300005541|Ga0070733_10450942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300005541|Ga0070733_10468449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 842 | Open in IMG/M |
| 3300005557|Ga0066704_10699017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300005560|Ga0066670_11029973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300005568|Ga0066703_10415917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 807 | Open in IMG/M |
| 3300005575|Ga0066702_10334582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 922 | Open in IMG/M |
| 3300005587|Ga0066654_10410364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300005602|Ga0070762_11047923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 560 | Open in IMG/M |
| 3300005921|Ga0070766_10313908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1010 | Open in IMG/M |
| 3300005921|Ga0070766_10361170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300006052|Ga0075029_100480956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 817 | Open in IMG/M |
| 3300006796|Ga0066665_10163484 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300006854|Ga0075425_101590019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 737 | Open in IMG/M |
| 3300006854|Ga0075425_102012528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 646 | Open in IMG/M |
| 3300006871|Ga0075434_102016354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 582 | Open in IMG/M |
| 3300006954|Ga0079219_12376252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 514 | Open in IMG/M |
| 3300009090|Ga0099827_11410829 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300009143|Ga0099792_11067285 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009521|Ga0116222_1148148 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300009522|Ga0116218_1288431 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009624|Ga0116105_1091831 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300009624|Ga0116105_1099983 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300009683|Ga0116224_10362883 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009839|Ga0116223_10294390 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300010048|Ga0126373_10913999 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300010304|Ga0134088_10714364 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300010339|Ga0074046_10085627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2044 | Open in IMG/M |
| 3300010341|Ga0074045_10684638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300010398|Ga0126383_11567204 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010398|Ga0126383_11819779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300010880|Ga0126350_10088688 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300011076|Ga0138574_1122490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300011082|Ga0138526_1080116 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300011120|Ga0150983_10242985 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300011120|Ga0150983_16601713 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300011270|Ga0137391_10527335 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300011411|Ga0153933_1019039 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300012096|Ga0137389_10136758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1992 | Open in IMG/M |
| 3300012096|Ga0137389_11705428 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012198|Ga0137364_11342274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300012202|Ga0137363_11078167 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012357|Ga0137384_11532339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
| 3300012361|Ga0137360_11290875 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012493|Ga0157355_1023793 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012512|Ga0157327_1056842 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012917|Ga0137395_10965609 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012917|Ga0137395_11308628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300014167|Ga0181528_10030765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3051 | Open in IMG/M |
| 3300014169|Ga0181531_10596082 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300014201|Ga0181537_11155899 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300014498|Ga0182019_10199048 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300014501|Ga0182024_11014868 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300015054|Ga0137420_1019504 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300015054|Ga0137420_1299285 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300015054|Ga0137420_1483832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1246 | Open in IMG/M |
| 3300015372|Ga0132256_102747151 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300016294|Ga0182041_10421027 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300016341|Ga0182035_11619388 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300017822|Ga0187802_10129564 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300017822|Ga0187802_10454572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300017823|Ga0187818_10037608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2078 | Open in IMG/M |
| 3300017924|Ga0187820_1056667 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300017924|Ga0187820_1316865 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300017936|Ga0187821_10137457 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300017943|Ga0187819_10704719 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300017947|Ga0187785_10036243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1805 | Open in IMG/M |
| 3300017961|Ga0187778_10550596 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300018023|Ga0187889_10283098 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018037|Ga0187883_10103122 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300018058|Ga0187766_10974351 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018062|Ga0187784_10987985 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300018085|Ga0187772_10025296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3474 | Open in IMG/M |
| 3300018088|Ga0187771_10838098 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300018433|Ga0066667_11861073 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300019082|Ga0187852_1234055 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300019270|Ga0181512_1300807 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300019786|Ga0182025_1164240 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300020061|Ga0193716_1165391 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300020579|Ga0210407_10014202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5917 | Open in IMG/M |
| 3300020582|Ga0210395_10584136 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300021180|Ga0210396_11590221 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021181|Ga0210388_11263630 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300021401|Ga0210393_10803475 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300021402|Ga0210385_10920583 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021404|Ga0210389_10437333 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300021405|Ga0210387_11824546 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021406|Ga0210386_10423355 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300021407|Ga0210383_10092625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2539 | Open in IMG/M |
| 3300021407|Ga0210383_10374247 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300021420|Ga0210394_10122599 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
| 3300021420|Ga0210394_10140713 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300021433|Ga0210391_10015722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6104 | Open in IMG/M |
| 3300021433|Ga0210391_10750864 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300021441|Ga0213871_10087746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 898 | Open in IMG/M |
| 3300021474|Ga0210390_11649368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300021478|Ga0210402_10453640 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300021559|Ga0210409_10981749 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300022522|Ga0242659_1098006 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300022528|Ga0242669_1016414 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300022557|Ga0212123_10425047 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300022717|Ga0242661_1062294 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300024330|Ga0137417_1493440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1565 | Open in IMG/M |
| 3300025434|Ga0208690_1045506 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300025501|Ga0208563_1081285 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300025906|Ga0207699_10901941 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300025915|Ga0207693_10004997 | All Organisms → cellular organisms → Bacteria | 11126 | Open in IMG/M |
| 3300025928|Ga0207700_10040559 | All Organisms → cellular organisms → Bacteria | 3399 | Open in IMG/M |
| 3300025928|Ga0207700_10720543 | Not Available | 891 | Open in IMG/M |
| 3300025929|Ga0207664_10101997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2372 | Open in IMG/M |
| 3300025929|Ga0207664_10186413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1784 | Open in IMG/M |
| 3300025929|Ga0207664_11160626 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300025939|Ga0207665_10175383 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300026508|Ga0257161_1062139 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026538|Ga0209056_10260579 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300026557|Ga0179587_10718763 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300026557|Ga0179587_10762484 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300027330|Ga0207777_1077403 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027371|Ga0209418_1073962 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300027381|Ga0208983_1111536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300027545|Ga0209008_1054818 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300027548|Ga0209523_1012655 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300027575|Ga0209525_1083301 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300027587|Ga0209220_1160035 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027619|Ga0209330_1126451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300027635|Ga0209625_1083302 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300027648|Ga0209420_1179092 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027698|Ga0209446_1118448 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300027701|Ga0209447_10167374 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027738|Ga0208989_10249244 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300027825|Ga0209039_10253160 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300027829|Ga0209773_10048757 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300027829|Ga0209773_10477329 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027853|Ga0209274_10254776 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300027854|Ga0209517_10438174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300027867|Ga0209167_10258036 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300027874|Ga0209465_10106910 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300027895|Ga0209624_10999935 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027905|Ga0209415_10708810 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300028015|Ga0265353_1001872 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300028556|Ga0265337_1178187 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300028673|Ga0257175_1104284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300028780|Ga0302225_10413285 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300028788|Ga0302189_10352685 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300028792|Ga0307504_10006373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2504 | Open in IMG/M |
| 3300028795|Ga0302227_10362367 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028806|Ga0302221_10175816 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300029636|Ga0222749_10394698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300029903|Ga0247271_123730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300029911|Ga0311361_10128052 | All Organisms → cellular organisms → Bacteria | 3443 | Open in IMG/M |
| 3300029923|Ga0311347_10002804 | All Organisms → cellular organisms → Bacteria | 12760 | Open in IMG/M |
| 3300029939|Ga0311328_10054000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3559 | Open in IMG/M |
| 3300029945|Ga0311330_10981830 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300029951|Ga0311371_10318559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2178 | Open in IMG/M |
| 3300029952|Ga0311346_10365327 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300029998|Ga0302271_10296441 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300030047|Ga0302286_10448319 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300030054|Ga0302182_10043278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2049 | Open in IMG/M |
| 3300030399|Ga0311353_10102706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2779 | Open in IMG/M |
| 3300030730|Ga0307482_1095977 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300030737|Ga0302310_10438619 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300030874|Ga0265742_1008742 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300030874|Ga0265742_1011705 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031010|Ga0265771_1008470 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031017|Ga0265744_113031 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031231|Ga0170824_108292307 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031231|Ga0170824_124826137 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031232|Ga0302323_100885016 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300031233|Ga0302307_10074414 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300031234|Ga0302325_10284096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2708 | Open in IMG/M |
| 3300031236|Ga0302324_102864137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300031239|Ga0265328_10327301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300031708|Ga0310686_100073361 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300031708|Ga0310686_104103692 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300031715|Ga0307476_10101804 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300031715|Ga0307476_10337820 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300031715|Ga0307476_11371533 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031718|Ga0307474_10547798 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300031720|Ga0307469_11679150 | Not Available | 612 | Open in IMG/M |
| 3300031726|Ga0302321_103576852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300031823|Ga0307478_10149069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1855 | Open in IMG/M |
| 3300031823|Ga0307478_10177112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1705 | Open in IMG/M |
| 3300031941|Ga0310912_10640646 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031942|Ga0310916_11450255 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300032009|Ga0318563_10369098 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300032043|Ga0318556_10046437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2086 | Open in IMG/M |
| 3300032174|Ga0307470_10028629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2621 | Open in IMG/M |
| 3300032180|Ga0307471_103389884 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300032515|Ga0348332_10342362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300032783|Ga0335079_11615818 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300032828|Ga0335080_10683415 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300032897|Ga0335071_10492491 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300033402|Ga0326728_10780953 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300033475|Ga0310811_11001199 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300033803|Ga0314862_0028025 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300034163|Ga0370515_0101508 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300034163|Ga0370515_0444913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300034282|Ga0370492_0249559 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.87% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.91% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.91% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.44% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.44% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.48% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.48% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.48% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.48% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.48% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.48% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004294 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 33 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_101381151 | 3300001471 | Forest Soil | MDVLGRYRNLIVLVGVLFAQILGLAVQVNVKRTTDSEPTRL |
| JGI12712J15308_101539431 | 3300001471 | Forest Soil | MESVLSRYRNLVILVGVLFLQVLGLAVQVKRGSDAQDTRLIRIWAV |
| JGI12635J15846_102571752 | 3300001593 | Forest Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRPTDNQPSRLIRIWAV |
| JGIcombinedJ26739_1004336302 | 3300002245 | Forest Soil | MESVIGRYRNLIILVGVLFLQVLGLAMQVKKNGMMRRKRA* |
| JGI25616J43925_100465583 | 3300002917 | Grasslands Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSEPTRLIRIWAVG |
| JGIcombinedJ51221_102548841 | 3300003505 | Forest Soil | MDVLGRYRNLVVLVGVLFAQVLGLAVQVRRTTDNEPTRLIRIW |
| Ga0062385_103228352 | 3300004080 | Bog Forest Soil | MESVLGRYRNLCILLGVLFLQVLGLAVQVKRSSENESSRLIRIWAV |
| Ga0058897_110198212 | 3300004139 | Forest Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAEHTRLIRIWA |
| Ga0068945_11457131 | 3300004294 | Peatlands Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAENTRLIRIWA |
| Ga0068966_14041492 | 3300004476 | Peatlands Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTTDSEPTRLIR |
| Ga0066679_102602661 | 3300005176 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAEHTRLIRIWAVD |
| Ga0070699_1000174981 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVLGRYRNLVILVGVLFLQVLGLAVQVKRGGDAENNTRLIRI |
| Ga0070733_104509421 | 3300005541 | Surface Soil | MESVLGRYRNLVILVGVLFLQVLGLAVQVKRSNDTENTRLIRVWAVD |
| Ga0070733_104684492 | 3300005541 | Surface Soil | MESVLGRYRNLIILVGVLFLQVLGLAVQVRRGNGNNEEKDT |
| Ga0066704_106990171 | 3300005557 | Soil | MESVLGRYRNLIILVGVLFLQVLGLAVQVKRNAENESSRLIRIWT |
| Ga0066670_110299732 | 3300005560 | Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKRGSDTQDTRLI |
| Ga0066703_104159173 | 3300005568 | Soil | MESVLGRYRNLIVLVGVLFLQVLGLAVQVKRTAENEP |
| Ga0066702_103345822 | 3300005575 | Soil | MESVLARYRNLIVLMAVLFVQVLGLGVQVRRAAEDEPSRLIRIW |
| Ga0066654_104103641 | 3300005587 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRTANAESTRLIRIWAVG |
| Ga0070762_110479231 | 3300005602 | Soil | MESVLGRYRNLVILMGVLFLQVLGLAVQVKRSSDT |
| Ga0070766_103139082 | 3300005921 | Soil | MESVLGRYRNLIILVGVLFLQVLGLATQVKRGGGNDPESTRLIRIWA |
| Ga0070766_103611702 | 3300005921 | Soil | MESVLGRYRNLVILVGVLFLQVLGLAVQVKRSTDTENTRLIRV |
| Ga0075029_1004809562 | 3300006052 | Watersheds | MESVLGRYRNLIILVGVLFLQVLGLAVQVKRGGSDTE |
| Ga0066665_101634841 | 3300006796 | Soil | MESVLARYRNLIVLMAVLFVQVLGLGVQVRRAAEDEPSRLIRIWTVS |
| Ga0075425_1015900192 | 3300006854 | Populus Rhizosphere | MESVLGRYRNLIILAGVLFLQVIGLAVQVKRIGSEEKDTRLIRI |
| Ga0075425_1020125282 | 3300006854 | Populus Rhizosphere | MESVLGRYRNLIILVGVLFLQVLGLAVQVKKGESQDTRLI |
| Ga0075434_1020163542 | 3300006871 | Populus Rhizosphere | MESVLGRYRNLIILVGVLFAQMLGLAVQVKRTTDTESTRLIRIW |
| Ga0079219_123762521 | 3300006954 | Agricultural Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKRGASTTEEKDTRLIRI |
| Ga0099827_114108292 | 3300009090 | Vadose Zone Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAEHTRL |
| Ga0099792_110672852 | 3300009143 | Vadose Zone Soil | MESVLGRYRNLVILVGVLFLQVLGLAMQVKRAGNDEGNTRL |
| Ga0116222_11481482 | 3300009521 | Peatlands Soil | MESLLGRYRNLIILVGVLFLQLLGLAVQVKRSESENT |
| Ga0116218_12884312 | 3300009522 | Peatlands Soil | MESVLGRYRNLVILVGVLFLQVLGLAMQVKRGGNANDAENTRL |
| Ga0116105_10918311 | 3300009624 | Peatland | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTASEPTRLIRVWAVGA |
| Ga0116105_10999831 | 3300009624 | Peatland | MDVLGRYRNLIVLVGVLFVQILGLAMQVRRTTDNEPTRL |
| Ga0116224_103628832 | 3300009683 | Peatlands Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAENTRL |
| Ga0116223_102943903 | 3300009839 | Peatlands Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSEPTRLI |
| Ga0126373_109139992 | 3300010048 | Tropical Forest Soil | MESVLGRYKNLIWLVAVLFLQVLGLAMQVKRGASAGQDTRLIR |
| Ga0134088_107143641 | 3300010304 | Grasslands Soil | MESVLGRYRNLIILMGVLFLQVLGLAVQVKRGPDLQNTRLIRIWAVS |
| Ga0074046_100856273 | 3300010339 | Bog Forest Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTSDNEPTRLIRIW |
| Ga0074045_106846382 | 3300010341 | Bog Forest Soil | MDVLGRYRNLIVLVGVLFVQILGLAVQVRRTTDNEP |
| Ga0126383_115672042 | 3300010398 | Tropical Forest Soil | MESVLGRYRNLIILAGVLFLQVIGLAVQVKRIGSEEKDT |
| Ga0126383_118197792 | 3300010398 | Tropical Forest Soil | MESVLGRYRNLIILVGVLFLQVLGLATQVKRNANDTEN |
| Ga0126350_100886882 | 3300010880 | Boreal Forest Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKKNGADEEKTRLIR |
| Ga0138574_11224902 | 3300011076 | Peatlands Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTTDSEPTR |
| Ga0138526_10801162 | 3300011082 | Peatlands Soil | MESVLARYRNLIILVGVLFLQVLGLAVQVKRSATDARDTRLIRIWA |
| Ga0150983_102429852 | 3300011120 | Forest Soil | METVLGRYRNLIILAGGLFLQVLGLAVQVKRSSDAQG |
| Ga0150983_166017132 | 3300011120 | Forest Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRGADAE |
| Ga0137391_105273351 | 3300011270 | Vadose Zone Soil | MESVLARYRNLIVLMAVLFAQVLGLGVQVRRSTEDEPSRLIRIWTVSA |
| Ga0153933_10190391 | 3300011411 | Attine Ant Fungus Gardens | MESVFGRYRNLTILVGVLFLQVLGLAVQVKRSNDAQHTRLIRIW |
| Ga0137389_101367581 | 3300012096 | Vadose Zone Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQLKRSADA |
| Ga0137389_117054282 | 3300012096 | Vadose Zone Soil | MESVLGRYRNLVILVGVLFLQVLGLAMQVKRAGND |
| Ga0137364_113422742 | 3300012198 | Vadose Zone Soil | MENFLSRYRNVSILVAVLFAQVLGLAVQVKRSTENE |
| Ga0137363_110781672 | 3300012202 | Vadose Zone Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAEHTRLIRIWAVG |
| Ga0137384_115323392 | 3300012357 | Vadose Zone Soil | MESVLGRYKNLIVLVGVLFAQVLGLAVQVKRTTDTESSRLIRIWAVNT |
| Ga0137360_112908751 | 3300012361 | Vadose Zone Soil | MESVLGRYRNLIVLVGVLFAQVLGLAVQVKRTSDSEPT |
| Ga0157355_10237932 | 3300012493 | Unplanted Soil | MESVLGRYRNLIILVGVLFAQMLGLAVQVKRTTDTESTRLIRIWT |
| Ga0157327_10568421 | 3300012512 | Arabidopsis Rhizosphere | MESFLGRYRNLTILVFVLFLQVLGLAVQVKTGAGEKAETRL |
| Ga0137395_109656092 | 3300012917 | Vadose Zone Soil | METVLGRYRNLIILVGVLFLQVLGLAVQVKRTSDAES |
| Ga0137395_113086281 | 3300012917 | Vadose Zone Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRPTDSEPTR |
| Ga0181528_100307653 | 3300014167 | Bog | MDFLLGRYRNLTILVGVLFLQVLGLAVQVKRTSDGDGTRL |
| Ga0181531_105960822 | 3300014169 | Bog | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRTDAEN |
| Ga0181537_111558991 | 3300014201 | Bog | MESVLGRYRNLTILVGVLFFQVLGLAVQVKRNGDAQSTR |
| Ga0182019_101990481 | 3300014498 | Fen | MDVLGRYRNLIVLVGVLFAQILGLAVQVNVKRTTDSEPTRLIRIWAVGM |
| Ga0182024_110148681 | 3300014501 | Permafrost | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSGDAENTRL |
| Ga0137420_10195041 | 3300015054 | Vadose Zone Soil | METVLGRYRNLIILVGVLFLQALGLAVQVKRTSDAESTRLIRVW |
| Ga0137420_12992852 | 3300015054 | Vadose Zone Soil | METVLGRYRNLIILVGVLFLQALGLAVQVKRTSDAESTR |
| Ga0137420_14838322 | 3300015054 | Vadose Zone Soil | MESVLGRYKNLIVLVAVLFAQVLGLAVQVKRTTDTESSA* |
| Ga0132256_1027471511 | 3300015372 | Arabidopsis Rhizosphere | MESFLGRYRNLIILMGVLFLQVLGLAVQVKTGANEAKDTR |
| Ga0182041_104210272 | 3300016294 | Soil | MESVLGRYRNLIILVGVLFLQVLGLAIQVKTGAER |
| Ga0182035_116193882 | 3300016341 | Soil | MESLFGRYRNLIILLGALFLQAMGLALQVRRTVDNEP |
| Ga0187802_101295642 | 3300017822 | Freshwater Sediment | MDVLGRYRNLVVLVGVLFAQVLGLAVQVRRTTDSEPT |
| Ga0187802_104545722 | 3300017822 | Freshwater Sediment | MESVLGRYKNLIWFVAVLFLQVLGLAVQVKRSGNDAENTRLIRI |
| Ga0187818_100376081 | 3300017823 | Freshwater Sediment | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRPTDSGSTHLIR |
| Ga0187820_10566672 | 3300017924 | Freshwater Sediment | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTNDSES |
| Ga0187820_13168651 | 3300017924 | Freshwater Sediment | MESVLSRYRNLIVLVGVLFLQVLGLAMQVKRGSNEAQDTRL |
| Ga0187821_101374572 | 3300017936 | Freshwater Sediment | MESVLGRYRNLIILVGVLFLQVLGLAMQVKKSGGDVEKTR |
| Ga0187819_107047192 | 3300017943 | Freshwater Sediment | MESVLVRYRNLIILVGVLFLQVLGLAVQVKRGGGD |
| Ga0187785_100362431 | 3300017947 | Tropical Peatland | MESVFSRYKNLIVLVVILFAQVLGLAVQVKRTTDT |
| Ga0187778_105505961 | 3300017961 | Tropical Peatland | MESVLGRYKNLIVLVVVLFAQVLGLAVQVKRTTDTES |
| Ga0187889_102830981 | 3300018023 | Peatland | MESVLGRYRNLIILVGVLFLQVLGLAVQVKRSADAENTRLIRIW |
| Ga0187883_101031221 | 3300018037 | Peatland | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTASDPTRRIRVWAV |
| Ga0187766_109743512 | 3300018058 | Tropical Peatland | MESVLGRYKNLIILVGVLFLQVLGLAVQVKRAGEAE |
| Ga0187784_109879852 | 3300018062 | Tropical Peatland | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSEPTRLIRVW |
| Ga0187772_100252964 | 3300018085 | Tropical Peatland | MESVLSRYRNLIVLVGVLFLQVLGLAMQVKRGSNQAQD |
| Ga0187771_108380982 | 3300018088 | Tropical Peatland | MESVLGRYRNLIILVGVLFLQVLGLAVQVKRGSTDAQD |
| Ga0066667_118610732 | 3300018433 | Grasslands Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKRGSDTQDTRLIR |
| Ga0187852_12340551 | 3300019082 | Peatland | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSGEAENTRLIR |
| Ga0181512_13008072 | 3300019270 | Peatland | MESVLGRYRNLIILVGVLFLQVLGLATQVKRGGATS |
| Ga0182025_11642402 | 3300019786 | Permafrost | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSGDAESTRLIRIWA |
| Ga0193716_11653911 | 3300020061 | Soil | MENLLGRYRNFIILMVVIFLQIFGLAVQVRRNSDQESGRLIRIW |
| Ga0210407_100142025 | 3300020579 | Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKKSGNDEE |
| Ga0210395_105841361 | 3300020582 | Soil | MESVLGRYRNLVILVGVLFLQVLGLAMQVKRAGNDAENTRL |
| Ga0210396_115902212 | 3300021180 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSNDAEHTRLIRIWAVDD |
| Ga0210388_112636301 | 3300021181 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSGDAESTRLIRIWAV |
| Ga0210393_108034752 | 3300021401 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSGEAEN |
| Ga0210385_109205832 | 3300021402 | Soil | MESVLGRYRNLIILVGVLFLQVLGLATQVKRGGNDPENTRLI |
| Ga0210389_104373331 | 3300021404 | Soil | MESVLGRYRNLVILVGVLFLQVLGLAMQVKRNGGNDV |
| Ga0210387_118245461 | 3300021405 | Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKRMGNEAQDT |
| Ga0210386_104233551 | 3300021406 | Soil | MESVLGRYRNLTILVGILFLQVLGLAIQVKRSSENESSRLIRVWAV |
| Ga0210383_100926253 | 3300021407 | Soil | MLGRYRNLTILVGVLFLQVLGLAVQVKRSADAENTRLI |
| Ga0210383_103742471 | 3300021407 | Soil | MLGRYRNLTILVGVLFLQVLGLAVQVKRSADAQDTRLI |
| Ga0210394_101225993 | 3300021420 | Soil | METVLGRYRNLTILVGVLFLQVLGLAVQVKRSADEQSTRLIRVWAVDLI |
| Ga0210394_101407133 | 3300021420 | Soil | MESVLGRYRNLTILVGVLFLQILGLAVQVKRSGDA |
| Ga0210391_100157221 | 3300021433 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSGEAENTRLIRIWAVDT |
| Ga0210391_107508641 | 3300021433 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADA |
| Ga0213871_100877462 | 3300021441 | Rhizosphere | MESVLGRYKNLIVLVGVLFAQVLGLAIQVKRTTDTESTRLIRIWAVDAV |
| Ga0210390_116493682 | 3300021474 | Soil | MESVIGRYRNLIFLVGVLFLQVLGLAVQVKKSGGDIEKTRLIRIW |
| Ga0210402_104536401 | 3300021478 | Soil | MESVLGRYKNLIVLVCVLFAQVLGLAVQVKRTTDTESSRL |
| Ga0210409_109817491 | 3300021559 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSNDAEHTRLI |
| Ga0242659_10980062 | 3300022522 | Soil | METLISRYRNVTILAVMLFLQVLGLAVQVKRGGGG |
| Ga0242669_10164142 | 3300022528 | Soil | MESFLGRYRNLIILVGVLFLQVLGLAVQVKTGANE |
| Ga0212123_104250472 | 3300022557 | Iron-Sulfur Acid Spring | MESVLGRYRNLIILVGVLFLQLLGLAVQVKRGNSEGQDTR |
| Ga0242661_10622941 | 3300022717 | Soil | MESVLGRYKNLIVLVCVLFAQVLGLAVQVKRTTDTESSRLIR |
| Ga0137417_14934402 | 3300024330 | Vadose Zone Soil | MESVLGRYKNLIVLVAVLFAQVLGLAVQVKRTTDTDSSA |
| Ga0208690_10455062 | 3300025434 | Peatland | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTASEP |
| Ga0208563_10812851 | 3300025501 | Peatland | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSE |
| Ga0207699_109019412 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVLGRYKNLIVLACVLVAQVLGLAVQVKRTTDTESSRLIR |
| Ga0207693_100049971 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MESFLGRYRNLTILVFVLFLQVLGLAVQVKTGAGEKAETRLIRM |
| Ga0207700_100405594 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MESFLGRYRNLTILVFVLFLQVLGLAVQVKTGAGEKAETRLI |
| Ga0207700_107205431 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVLGRYRNLIILVCVLFLQVLGLATQVKRTGNDEEHTRLIRIWVV |
| Ga0207664_101019973 | 3300025929 | Agricultural Soil | MESVLGRYKNLIVLVCVLFAQVLGLAVQVKRTTDT |
| Ga0207664_101864133 | 3300025929 | Agricultural Soil | MESVLGRYRNLIILMGVLFLQVLGLAMQVKRANEVQDTRL |
| Ga0207664_111606261 | 3300025929 | Agricultural Soil | MESVLGRYRNLIILMGVLFLQVLGLAMQVKRGNEV |
| Ga0207665_101753831 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MESVLGRYRNLIILMGVLFLQVLGLAMQVKRGNEIEDTRLI |
| Ga0257161_10621391 | 3300026508 | Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRPTDSE |
| Ga0209056_102605791 | 3300026538 | Soil | METVLGRYRNLIILVGVLFLQVLGLAVQVKRTSDAESTRLI |
| Ga0179587_107187631 | 3300026557 | Vadose Zone Soil | METVLGRYRNLIILVGVLFLQVLGLAVQVKRGNDA |
| Ga0179587_107624842 | 3300026557 | Vadose Zone Soil | METVLGRYRNLIVLVGVLFVQVLGLAIQVKRTTDTDSSRLIR |
| Ga0207777_10774031 | 3300027330 | Tropical Forest Soil | MESVLGRYRNLIILVGVLFLQVLGLATQVKRTGGTDA |
| Ga0209418_10739622 | 3300027371 | Forest Soil | MESVLGRYKNLIVLVGVLFAQVLGLAVQVKRTTDTE |
| Ga0208983_11115361 | 3300027381 | Forest Soil | MESVLGRYRNLVILVGVLFLQVLGLAVQVKRGGDAEN |
| Ga0209008_10548181 | 3300027545 | Forest Soil | MESVLGRYRNLVILVGVLFLQMLGLAVQVKRSNDTE |
| Ga0209523_10126551 | 3300027548 | Forest Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKKNGMDEEKT |
| Ga0209525_10833012 | 3300027575 | Forest Soil | MESVFGRYKNLIWLVIVLFVQVLGLAMQVKRGNDQEHTR |
| Ga0209220_11600351 | 3300027587 | Forest Soil | METVLGRYRNLIILVGVLFLQVLGLAVQVKRASDAEST |
| Ga0209330_11264512 | 3300027619 | Forest Soil | MESVFGRYRNLVVLVVVLFVQILGLAVQVRRARDKDSEPTRLI |
| Ga0209625_10833021 | 3300027635 | Forest Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTTDSEPTRLIRIWA |
| Ga0209420_11790921 | 3300027648 | Forest Soil | MESVLGRYRNLTILVGVLFLQALGLAVQVKRGAEAGNTRLIRI |
| Ga0209446_11184482 | 3300027698 | Bog Forest Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKRSGNDVEST |
| Ga0209447_101673742 | 3300027701 | Bog Forest Soil | MDVLGRYRNLIVLVGVLFAQILGLAVQVNVKRTTD |
| Ga0208989_102492442 | 3300027738 | Forest Soil | MESVLGRYRNLVILVGVLFLQVLGLAVQVKRGGDA |
| Ga0209039_102531601 | 3300027825 | Bog Forest Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSESTRLIRIWAVG |
| Ga0209773_100487571 | 3300027829 | Bog Forest Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAENTRLIRI |
| Ga0209773_104773292 | 3300027829 | Bog Forest Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSAEAEHTRLI |
| Ga0209274_102547762 | 3300027853 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADTENTRLI |
| Ga0209517_104381743 | 3300027854 | Peatlands Soil | MESVLGRYRNLVILVGVLFLQVLGLAMQVKRGGNANDAENTR |
| Ga0209167_102580362 | 3300027867 | Surface Soil | MESVLGRYRNLIILVGVLFLQVLGLAVQVKRSGEAEHTRLIRVWAVDAI |
| Ga0209465_101069101 | 3300027874 | Tropical Forest Soil | MESFLGRYRNLTILVFVLFLQVLGLAVQVKTGAGEKAE |
| Ga0209624_109999351 | 3300027895 | Forest Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSAEAEN |
| Ga0209415_107088102 | 3300027905 | Peatlands Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTTDSEPTRLI |
| Ga0265353_10018721 | 3300028015 | Soil | MESVLGRYRNLVILVGVLFLQMLGLAVQVKRSNDTEHTRLIRVWA |
| Ga0265337_11781871 | 3300028556 | Rhizosphere | MESVLGRYRNLIILVGVLFLQVLGLATQVKRSGNDTENTRLIRI |
| Ga0257175_11042841 | 3300028673 | Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTNDSEST |
| Ga0302225_104132852 | 3300028780 | Palsa | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTSDSESSTRLIR |
| Ga0302189_103526852 | 3300028788 | Bog | MESFLGRYRNLTILVGVLFLQVLGLAVQVKRSGDAEN |
| Ga0307504_100063733 | 3300028792 | Soil | METVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDIESSRL |
| Ga0302227_103623671 | 3300028795 | Palsa | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAENTRLI |
| Ga0302221_101758162 | 3300028806 | Palsa | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTTDSEPTRLIRVW |
| Ga0222749_103946981 | 3300029636 | Soil | MESVLGRYRNLVILVGVLFLQVLGLAMQVKRGGNANDAANTRLIRI |
| Ga0247271_1237302 | 3300029903 | Soil | MDVLGRYRNLIVLVGVLFVQILGLAVQVRRTTDNEPTRLIRVWADQNLQRQYLA |
| Ga0311361_101280524 | 3300029911 | Bog | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRTANAQST |
| Ga0311347_100028041 | 3300029923 | Fen | METVLGRYKNLIVLTAVLFAQILGLAVQVRRTTESESSSLIRVWA |
| Ga0311328_100540001 | 3300029939 | Bog | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRTANAQS |
| Ga0311330_109818301 | 3300029945 | Bog | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRGNDADSTRLIRIWA |
| Ga0311371_103185593 | 3300029951 | Palsa | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTSDSESSTRLIRV |
| Ga0311346_103653271 | 3300029952 | Bog | MDFLFGRYRNLTILVGVLFLQVLGLAVQVKRSGDAENTRLIRI |
| Ga0302271_102964412 | 3300029998 | Bog | METVLGRYKNLIVLTAVLFAQILGLAVQVRRTTESESSSLI |
| Ga0302286_104483192 | 3300030047 | Fen | METVLGRYKNLIVLTAVLFAQILGLAVQVRRTTES |
| Ga0302182_100432783 | 3300030054 | Palsa | MDSLLGRYRNLSILVGILFLQVLGLAVQVKRGSSED |
| Ga0311353_101027061 | 3300030399 | Palsa | MDVLGRYRNLIVLVGVLFAQVLGLAVQVRRTTDNEPTRL |
| Ga0307482_10959772 | 3300030730 | Hardwood Forest Soil | MESFLGRYRNLIILVGVLFLQVLGLAVQVKTGANEE |
| Ga0302310_104386192 | 3300030737 | Palsa | MESVLGRYRNLTILVGVLFLQLLGLAVQVKRSADVENTRLIRL |
| Ga0265742_10087422 | 3300030874 | Soil | MESVLGRYRNLVILVGVLFLQVLGLAVQVKRSNDTENTV |
| Ga0265742_10117051 | 3300030874 | Soil | MESVFGRYRNLTILVGVLFLQVLGLAVQVKRSNDA |
| Ga0265771_10084702 | 3300031010 | Soil | MESVLGRYRNLIILVGVLFLQVLGLATQVKRAGGND |
| Ga0265744_1130311 | 3300031017 | Soil | MESVLGRYRNLVILVGVLFLQILGLAVQVKRSNDTENTRLIRVWAVDL |
| Ga0170824_1082923071 | 3300031231 | Forest Soil | MESVLGRYRNLVILVGVLFLQALGLAVQVKRGSTDA |
| Ga0170824_1248261372 | 3300031231 | Forest Soil | MESVFGRYRNLTILVGVLFLQVLGLAVQIKRNVENEPTRLIRVW |
| Ga0302323_1008850161 | 3300031232 | Fen | MENFITRYRNVTFLVAVLFAQVLGLAVQVKRNTDN |
| Ga0302307_100744141 | 3300031233 | Palsa | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAE |
| Ga0302325_102840963 | 3300031234 | Palsa | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTSDSEPTRLIRVWAVG |
| Ga0302324_1028641371 | 3300031236 | Palsa | MESFLGRYRNLTILVAVLFLQVLGLAVQVKRSSDPQNTRLIRIW |
| Ga0265328_103273012 | 3300031239 | Rhizosphere | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDGESTHLIRIWAVGASPLW |
| Ga0310686_1000733611 | 3300031708 | Soil | MESFLGRYRNLTILVGVLFLQVLGLAMQVKRSGDSE |
| Ga0310686_1041036922 | 3300031708 | Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSAEAENTRLIR |
| Ga0307476_101018041 | 3300031715 | Hardwood Forest Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSPDAEHTRLIR |
| Ga0307476_103378201 | 3300031715 | Hardwood Forest Soil | MESFLGRYRNLIILVGVLFLQVLGLAVQVKTGANEEK |
| Ga0307476_113715331 | 3300031715 | Hardwood Forest Soil | MESVLGRYRNLIILVGVLFLQVLGLAMQVKRMGNEAQDTR |
| Ga0307474_105477982 | 3300031718 | Hardwood Forest Soil | METVLGRYRNLIILVGVLFLQVLGLAVQVKRSADAEHTR |
| Ga0307469_116791501 | 3300031720 | Hardwood Forest Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDMEPTRLIRV |
| Ga0302321_1035768522 | 3300031726 | Fen | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSESTRLIRIWAVGS |
| Ga0307478_101490693 | 3300031823 | Hardwood Forest Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSEPTR |
| Ga0307478_101771121 | 3300031823 | Hardwood Forest Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSEPTRLIRVWAVD |
| Ga0310912_106406462 | 3300031941 | Soil | MESLFGRYRNLIILLGALFLQAMGLALQVRRTVDNEPTRLIRVWTVA |
| Ga0310916_114502551 | 3300031942 | Soil | MESLLGRYKNLIVLVVVLFAQVLGLAVQVKRPTDTNSSRL |
| Ga0318563_103690981 | 3300032009 | Soil | MESVLGRYKNLIVLACVLVAQVLGLAMQVKRTTDTESTR |
| Ga0318556_100464373 | 3300032043 | Soil | MESVLGRYKNLIVLACVLVAQVLGLAMQVKRTTDT |
| Ga0307470_100286293 | 3300032174 | Hardwood Forest Soil | MESVLGRYKNLIVLVAVLFAQVLGLAVQVKRTTDTESSRLIR |
| Ga0307471_1033898842 | 3300032180 | Hardwood Forest Soil | MESVLGRYKNLIVLVLVLFAQVLGLAVQVKRTTDTE |
| Ga0348332_103423622 | 3300032515 | Plant Litter | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRGADAENTRLIRVWAVDK |
| Ga0335079_116158181 | 3300032783 | Soil | MESVLGRYRNLIVLTAVLFAQVLGLAVQVRRTTDTES |
| Ga0335080_106834152 | 3300032828 | Soil | MESVLGRYRNLIILVGVLFLQVLGLAVQVKRSGSETDTR |
| Ga0335071_104924911 | 3300032897 | Soil | MESVLGRYRNLIILVGVLFLQVLGLAIQVKRNTSDVENTRLIRIWAVD |
| Ga0326728_107809531 | 3300033402 | Peat Soil | MDVLGRYRNLIVLVGVLFAQVLGLAVQVKRTTDSESTRLIR |
| Ga0310811_110011991 | 3300033475 | Soil | MESVLGRYRNLIILMGVLFLQVLGLAMQVKRGNEVEDT |
| Ga0314862_0028025_1018_1140 | 3300033803 | Peatland | MESVLGRYRNLIVLVGVLFAQVLGLAVQVKRTNDLESTRLI |
| Ga0370515_0101508_1132_1242 | 3300034163 | Untreated Peat Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRSADAEN |
| Ga0370515_0444913_437_547 | 3300034163 | Untreated Peat Soil | MDVLGRYRNLIVLVGVLFAQILGLAVQVKHTTDSEST |
| Ga0370492_0249559_590_721 | 3300034282 | Untreated Peat Soil | MESVLGRYRNLTILVGVLFLQVLGLAVQVKRGNDADSTRLIRIW |
| ⦗Top⦘ |