| Basic Information | |
|---|---|
| Family ID | F023474 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 210 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FHPEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGVLVP |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 210 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.93 % |
| % of genes near scaffold ends (potentially truncated) | 96.19 % |
| % of genes from short scaffolds (< 2000 bps) | 90.95 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.476 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.762 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.94% Coil/Unstructured: 84.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 210 Family Scaffolds |
|---|---|---|
| PF03640 | Lipoprotein_15 | 22.38 |
| PF04828 | GFA | 4.29 |
| PF01391 | Collagen | 3.33 |
| PF13561 | adh_short_C2 | 1.90 |
| PF13472 | Lipase_GDSL_2 | 1.90 |
| PF13090 | PP_kinase_C | 1.90 |
| PF00561 | Abhydrolase_1 | 1.43 |
| PF00291 | PALP | 0.95 |
| PF02518 | HATPase_c | 0.95 |
| PF01872 | RibD_C | 0.95 |
| PF02826 | 2-Hacid_dh_C | 0.95 |
| PF00127 | Copper-bind | 0.95 |
| PF00070 | Pyr_redox | 0.48 |
| PF07040 | DUF1326 | 0.48 |
| PF13378 | MR_MLE_C | 0.48 |
| PF13340 | DUF4096 | 0.48 |
| PF03411 | Peptidase_M74 | 0.48 |
| PF13450 | NAD_binding_8 | 0.48 |
| PF13424 | TPR_12 | 0.48 |
| PF08402 | TOBE_2 | 0.48 |
| PF04672 | Methyltransf_19 | 0.48 |
| PF05988 | DUF899 | 0.48 |
| PF00109 | ketoacyl-synt | 0.48 |
| PF01161 | PBP | 0.48 |
| PF00211 | Guanylate_cyc | 0.48 |
| PF01494 | FAD_binding_3 | 0.48 |
| PF02469 | Fasciclin | 0.48 |
| PF01042 | Ribonuc_L-PSP | 0.48 |
| PF00353 | HemolysinCabind | 0.48 |
| PF07626 | PSD3 | 0.48 |
| PF00293 | NUDIX | 0.48 |
| PF03795 | YCII | 0.48 |
| PF05378 | Hydant_A_N | 0.48 |
| PF00072 | Response_reg | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
|---|---|---|---|
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 22.38 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 4.29 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 0.95 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.95 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.95 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.95 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.48 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.48 |
| COG3770 | Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.48 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.48 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.48 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.48 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.48 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.48 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.48 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.33 % |
| Unclassified | root | N/A | 26.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02FPWKK | Not Available | 525 | Open in IMG/M |
| 2084038016|SPCE_L_FSPRUNR02G0A9U | Not Available | 521 | Open in IMG/M |
| 2170459003|FZ032L002IMDU9 | Not Available | 554 | Open in IMG/M |
| 2170459017|G14TP7Y01EBXF2 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100539578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105575121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300000890|JGI11643J12802_10601352 | Not Available | 1111 | Open in IMG/M |
| 3300000890|JGI11643J12802_11551287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1889 | Open in IMG/M |
| 3300000955|JGI1027J12803_102173185 | Not Available | 614 | Open in IMG/M |
| 3300000956|JGI10216J12902_106656723 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300001361|A30PFW6_1460585 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300004114|Ga0062593_101775834 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300004157|Ga0062590_100677459 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300004157|Ga0062590_101496754 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300004157|Ga0062590_102649106 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004479|Ga0062595_101599843 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300004480|Ga0062592_100539618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 975 | Open in IMG/M |
| 3300005167|Ga0066672_10870081 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005332|Ga0066388_100360308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2101 | Open in IMG/M |
| 3300005338|Ga0068868_101229309 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005364|Ga0070673_101782261 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005366|Ga0070659_100577325 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005435|Ga0070714_101958581 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005553|Ga0066695_10372814 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005558|Ga0066698_10795950 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005569|Ga0066705_10527690 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005587|Ga0066654_10657335 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005616|Ga0068852_101088670 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005719|Ga0068861_100707322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 937 | Open in IMG/M |
| 3300005834|Ga0068851_10739250 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005840|Ga0068870_10354370 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005840|Ga0068870_10646315 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006028|Ga0070717_11300250 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300006032|Ga0066696_10015439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3806 | Open in IMG/M |
| 3300006032|Ga0066696_10781667 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006034|Ga0066656_11006511 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006046|Ga0066652_100948928 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300006046|Ga0066652_101640834 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006058|Ga0075432_10476699 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006163|Ga0070715_10086847 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300006175|Ga0070712_100671747 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300006175|Ga0070712_101545759 | Not Available | 580 | Open in IMG/M |
| 3300006581|Ga0074048_10042760 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300006605|Ga0074057_11218939 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300006796|Ga0066665_11367595 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006797|Ga0066659_10681052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300006847|Ga0075431_100687939 | Not Available | 1001 | Open in IMG/M |
| 3300006852|Ga0075433_11448244 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006871|Ga0075434_101456678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300009012|Ga0066710_100536078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinocrispum → Actinocrispum wychmicini | 1769 | Open in IMG/M |
| 3300009012|Ga0066710_100973492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1308 | Open in IMG/M |
| 3300009012|Ga0066710_104876765 | Not Available | 502 | Open in IMG/M |
| 3300009090|Ga0099827_10659414 | Not Available | 904 | Open in IMG/M |
| 3300009090|Ga0099827_10984810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300009098|Ga0105245_10506857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1224 | Open in IMG/M |
| 3300009100|Ga0075418_10872121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces viridosporus → Streptomyces viridosporus ATCC 14672 | 973 | Open in IMG/M |
| 3300009162|Ga0075423_10955746 | Not Available | 909 | Open in IMG/M |
| 3300009174|Ga0105241_10196716 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300009553|Ga0105249_11224620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 822 | Open in IMG/M |
| 3300009789|Ga0126307_10159694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1806 | Open in IMG/M |
| 3300009821|Ga0105064_1072647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300009822|Ga0105066_1031446 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300010037|Ga0126304_10063557 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
| 3300010037|Ga0126304_10929667 | Not Available | 592 | Open in IMG/M |
| 3300010042|Ga0126314_11093433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300010043|Ga0126380_12207010 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG1_02_56_21 | 509 | Open in IMG/M |
| 3300010044|Ga0126310_10507007 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300010166|Ga0126306_10000043 | All Organisms → cellular organisms → Bacteria | 33637 | Open in IMG/M |
| 3300010166|Ga0126306_10182769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1575 | Open in IMG/M |
| 3300010301|Ga0134070_10155555 | Not Available | 822 | Open in IMG/M |
| 3300010320|Ga0134109_10350575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300010323|Ga0134086_10244554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300010329|Ga0134111_10495350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300010337|Ga0134062_10611245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300010375|Ga0105239_11786657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
| 3300010376|Ga0126381_104152574 | Not Available | 562 | Open in IMG/M |
| 3300010401|Ga0134121_10755208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 929 | Open in IMG/M |
| 3300010403|Ga0134123_12716881 | Not Available | 563 | Open in IMG/M |
| 3300011119|Ga0105246_10732961 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300012015|Ga0120187_1011715 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300012198|Ga0137364_10216791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1406 | Open in IMG/M |
| 3300012198|Ga0137364_10901438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300012198|Ga0137364_11394136 | Not Available | 519 | Open in IMG/M |
| 3300012199|Ga0137383_10790301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
| 3300012201|Ga0137365_10386129 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300012201|Ga0137365_10553268 | Not Available | 844 | Open in IMG/M |
| 3300012201|Ga0137365_10676401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300012204|Ga0137374_10059388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3855 | Open in IMG/M |
| 3300012204|Ga0137374_10213243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinocrispum → Actinocrispum wychmicini | 1651 | Open in IMG/M |
| 3300012206|Ga0137380_10052477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3739 | Open in IMG/M |
| 3300012206|Ga0137380_11360141 | Not Available | 595 | Open in IMG/M |
| 3300012207|Ga0137381_10471883 | Not Available | 1095 | Open in IMG/M |
| 3300012208|Ga0137376_10394515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1202 | Open in IMG/M |
| 3300012208|Ga0137376_10955377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
| 3300012208|Ga0137376_11295465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300012209|Ga0137379_10602228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1005 | Open in IMG/M |
| 3300012210|Ga0137378_10577298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1034 | Open in IMG/M |
| 3300012210|Ga0137378_11283800 | Not Available | 648 | Open in IMG/M |
| 3300012211|Ga0137377_11114428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
| 3300012211|Ga0137377_11612729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300012211|Ga0137377_11715083 | Not Available | 549 | Open in IMG/M |
| 3300012353|Ga0137367_10110330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinocrispum → Actinocrispum wychmicini | 2024 | Open in IMG/M |
| 3300012353|Ga0137367_10167726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1598 | Open in IMG/M |
| 3300012353|Ga0137367_10197109 | Not Available | 1460 | Open in IMG/M |
| 3300012353|Ga0137367_10792756 | Not Available | 658 | Open in IMG/M |
| 3300012354|Ga0137366_10926885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300012355|Ga0137369_10625421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
| 3300012356|Ga0137371_10217935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1493 | Open in IMG/M |
| 3300012356|Ga0137371_10498206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 940 | Open in IMG/M |
| 3300012358|Ga0137368_10849537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. DBS9H8 | 561 | Open in IMG/M |
| 3300012359|Ga0137385_10042312 | All Organisms → cellular organisms → Bacteria | 4081 | Open in IMG/M |
| 3300012359|Ga0137385_10828074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300012469|Ga0150984_118265825 | Not Available | 693 | Open in IMG/M |
| 3300012891|Ga0157305_10067587 | Not Available | 810 | Open in IMG/M |
| 3300012913|Ga0157298_10222080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300012914|Ga0157297_10224253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
| 3300012916|Ga0157310_10472249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300012931|Ga0153915_10587496 | Not Available | 1279 | Open in IMG/M |
| 3300012931|Ga0153915_10967506 | Not Available | 991 | Open in IMG/M |
| 3300012943|Ga0164241_11008857 | Not Available | 611 | Open in IMG/M |
| 3300012955|Ga0164298_10688426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300012957|Ga0164303_10084728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1523 | Open in IMG/M |
| 3300012957|Ga0164303_11032338 | Not Available | 588 | Open in IMG/M |
| 3300012960|Ga0164301_11890105 | Not Available | 504 | Open in IMG/M |
| 3300012961|Ga0164302_10402964 | Not Available | 934 | Open in IMG/M |
| 3300012975|Ga0134110_10269978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300012975|Ga0134110_10384706 | Not Available | 620 | Open in IMG/M |
| 3300012984|Ga0164309_10266929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
| 3300012985|Ga0164308_10485304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1030 | Open in IMG/M |
| 3300012987|Ga0164307_11485575 | Not Available | 572 | Open in IMG/M |
| 3300012988|Ga0164306_11823646 | Not Available | 529 | Open in IMG/M |
| 3300012989|Ga0164305_10665623 | Not Available | 846 | Open in IMG/M |
| 3300012989|Ga0164305_11004593 | Not Available | 709 | Open in IMG/M |
| 3300012989|Ga0164305_12111166 | Not Available | 517 | Open in IMG/M |
| 3300013306|Ga0163162_13186624 | Not Available | 526 | Open in IMG/M |
| 3300013772|Ga0120158_10240856 | Not Available | 911 | Open in IMG/M |
| 3300014745|Ga0157377_10167701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1371 | Open in IMG/M |
| 3300014968|Ga0157379_10487904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1141 | Open in IMG/M |
| 3300014968|Ga0157379_10560294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1064 | Open in IMG/M |
| 3300014969|Ga0157376_11465132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300015200|Ga0173480_10278104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
| 3300015357|Ga0134072_10459664 | Not Available | 515 | Open in IMG/M |
| 3300015371|Ga0132258_11220318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1901 | Open in IMG/M |
| 3300015372|Ga0132256_100207909 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300017659|Ga0134083_10236345 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300018071|Ga0184618_10487371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300018073|Ga0184624_10178009 | Not Available | 944 | Open in IMG/M |
| 3300018469|Ga0190270_10546665 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300018476|Ga0190274_13990869 | Not Available | 500 | Open in IMG/M |
| 3300018482|Ga0066669_11655378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300020015|Ga0193734_1043991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
| 3300021073|Ga0210378_10326934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300021344|Ga0193719_10018475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2964 | Open in IMG/M |
| 3300021510|Ga0222621_1024171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1233 | Open in IMG/M |
| 3300022756|Ga0222622_10005088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5867 | Open in IMG/M |
| 3300025905|Ga0207685_10088851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1296 | Open in IMG/M |
| 3300025911|Ga0207654_10826712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
| 3300025912|Ga0207707_10087530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2721 | Open in IMG/M |
| 3300025915|Ga0207693_11486482 | Not Available | 500 | Open in IMG/M |
| 3300025917|Ga0207660_11177472 | Not Available | 624 | Open in IMG/M |
| 3300025921|Ga0207652_11261491 | Not Available | 641 | Open in IMG/M |
| 3300025923|Ga0207681_10167112 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300025929|Ga0207664_11302373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300025929|Ga0207664_12003111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300025935|Ga0207709_11257005 | Not Available | 611 | Open in IMG/M |
| 3300025944|Ga0207661_10303782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1431 | Open in IMG/M |
| 3300025949|Ga0207667_10762742 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300025960|Ga0207651_11982223 | Not Available | 523 | Open in IMG/M |
| 3300026095|Ga0207676_10653078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1015 | Open in IMG/M |
| 3300026142|Ga0207698_11683493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300026295|Ga0209234_1284458 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026324|Ga0209470_1230823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300026538|Ga0209056_10399374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
| 3300027577|Ga0209874_1020130 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300027949|Ga0209860_1015876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1009 | Open in IMG/M |
| 3300027952|Ga0209889_1000461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 11190 | Open in IMG/M |
| 3300028380|Ga0268265_11199627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300028596|Ga0247821_10833350 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300028711|Ga0307293_10075445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
| 3300028713|Ga0307303_10008315 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300028713|Ga0307303_10079919 | Not Available | 729 | Open in IMG/M |
| 3300028716|Ga0307311_10237273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300028720|Ga0307317_10059251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
| 3300028720|Ga0307317_10209029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300028784|Ga0307282_10020669 | All Organisms → cellular organisms → Bacteria | 2763 | Open in IMG/M |
| 3300028784|Ga0307282_10033322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2236 | Open in IMG/M |
| 3300028784|Ga0307282_10355220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300028799|Ga0307284_10065751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1304 | Open in IMG/M |
| 3300028799|Ga0307284_10275659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300028812|Ga0247825_10880711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300028814|Ga0307302_10318168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. KBS0703 | 766 | Open in IMG/M |
| 3300028824|Ga0307310_10015803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2922 | Open in IMG/M |
| 3300028824|Ga0307310_10109158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1239 | Open in IMG/M |
| 3300028824|Ga0307310_10707987 | Not Available | 517 | Open in IMG/M |
| 3300028828|Ga0307312_10207041 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300028828|Ga0307312_11027875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300028872|Ga0307314_10016358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1654 | Open in IMG/M |
| 3300028872|Ga0307314_10229556 | Not Available | 569 | Open in IMG/M |
| 3300028875|Ga0307289_10097203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1200 | Open in IMG/M |
| 3300028889|Ga0247827_11198613 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300030336|Ga0247826_11124919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300031731|Ga0307405_11881384 | Not Available | 533 | Open in IMG/M |
| 3300031847|Ga0310907_10842228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300031854|Ga0310904_11338105 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031943|Ga0310885_10388477 | Not Available | 741 | Open in IMG/M |
| 3300034150|Ga0364933_205536 | Not Available | 518 | Open in IMG/M |
| 3300034819|Ga0373958_0093916 | Not Available | 695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.29% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.38% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.48% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.48% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil | 0.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.48% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2084038016 | Soil microbial communities from Hopland, California, USA, that is PCE polluted - amended with lactate | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_02906600 | 2065487018 | Soil | VTAKGLVPAIGILHPEAANDRLEINTLDGVDTVDATGLAAGAIQLF |
| SPCE_L_00147830 | 2084038016 | Soil | LVGILHPEVANDRLEINTLAGNDTVDPSGLAAGAIQLFVDGVLVP |
| E4A_04064300 | 2170459003 | Grass Soil | LHPEAANDRLEINTLAGTDTVNSAGLATGAIQLFVDGLLVP |
| 4ZMR_04738530 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | EVANDRLDVNTLAGRDTVGFVGLAAGAIQHFVDGALIP |
| INPhiseqgaiiFebDRAFT_1005395783 | 3300000364 | Soil | DRLEINTLDGTDTVNSDGLALGAIQLLVDGLPAA* |
| INPhiseqgaiiFebDRAFT_1055751211 | 3300000364 | Soil | EVANDRLEIKTLAGTDTVDSADLAAGAIQLFVDGLPVX* |
| JGI11643J12802_106013525 | 3300000890 | Soil | EAANDRLEINTLAGTDTVNSAGLAAGVIQLFVDGVLVP* |
| JGI11643J12802_115512872 | 3300000890 | Soil | EPANDRLEIETAGGADSITTAGLSAGVIQLFVDGVLVP* |
| JGI1027J12803_1021731851 | 3300000955 | Soil | VIVNQEPARDRLEINTLGGSDAVTTDDLAAGAIQLFVDDVPVN* |
| JGI10216J12902_1066567231 | 3300000956 | Soil | HPEGANDRLDINTLDGSDTVDSSGLAAGTIQLFVDGVPVP* |
| A30PFW6_14605851 | 3300001361 | Permafrost | IHSEAANDRLEVNTLAGADSVDSGGLAAGALQLFVDGVLVP* |
| Ga0062593_1010844571 | 3300004114 | Soil | VEVLQPEVANDRLEVNTLAGTDAVDAGGLAPGTIQLLVDGVPQP* |
| Ga0062593_1017758341 | 3300004114 | Soil | VEVLQPEVANDRLEVNTLAGADDANAGGLAPGAIQLFVDGVLQP* |
| Ga0062590_1006774593 | 3300004157 | Soil | AEVADDRLDVNTLAGTDVVDSSGLAAGAIQLFVDNVLVP* |
| Ga0062590_1014967541 | 3300004157 | Soil | VEVLQPEVANDRLEVNTLAGADDVNAGGLAPGAIQLFVDGVLQP* |
| Ga0062590_1026491062 | 3300004157 | Soil | PAVQILHAEFANDRLDINTLAGDDRVDADGLQIGVIQLFVDGLLVP* |
| Ga0062595_1015998432 | 3300004479 | Soil | VSHSEAANDRLEINTLAGNDTVDSAGLADGVIQLLVDGVLVP* |
| Ga0062592_1005396182 | 3300004480 | Soil | GVLHSEGASDRLEINTLTGAVDTVARGGLAPGAVQLIVDGALVP* |
| Ga0066672_108700811 | 3300005167 | Soil | HAEAANDRLEINTLAGSDTVDSVGLAAGAIQLFVDGVLVP* |
| Ga0066388_1003603084 | 3300005332 | Tropical Forest Soil | ILHSEAAKDSLEIHTLAGSDAVDSAGLAAGAIQLFVDGVLVP* |
| Ga0068868_1012293091 | 3300005338 | Miscanthus Rhizosphere | GLAPFVEILHPEGANDRLDINTLDGHDTVDSSGLAAGTIQLFVDGVLVP* |
| Ga0070673_1017822612 | 3300005364 | Switchgrass Rhizosphere | TTQVLHSEHANDRLEVNTLAGVDTVASAGLAADAIQFLLDGVLVK* |
| Ga0070659_1005773252 | 3300005366 | Corn Rhizosphere | LHAEAANDRLEINTLAGTDTVDSGGLAAGVIRLFVDGVLVP* |
| Ga0070714_1019585811 | 3300005435 | Agricultural Soil | GGLTPTVNLFHHEPTDRLELNALAGNDTVNSAGLAAGVIQLFVDGVLVP* |
| Ga0066695_103728141 | 3300005553 | Soil | VVILHAEAANDRLEINTLAGRDSVDSELDADAIPLFVNGILVP* |
| Ga0066698_107959502 | 3300005558 | Soil | HSEAANDRLEINTLDGRDSVDSGGLAAGAIQLFVDGVLVP* |
| Ga0066705_105276901 | 3300005569 | Soil | LHPEATDRLDINTQAGNDTVQSNGLAAGAIQLFVDGVLVP* |
| Ga0066654_106573352 | 3300005587 | Soil | HSEAANDRLEINTLAGRDSVDSSGLAAGATQLFVDGVLVP* |
| Ga0068852_1010886701 | 3300005616 | Corn Rhizosphere | DRLEVNTLAGTDTVDAGGLAPGTVQLLVDGVLQP* |
| Ga0068861_1007073221 | 3300005719 | Switchgrass Rhizosphere | EVANDRLEIATLAGADAVNTIGLAPGAIQLFVDGVLVP* |
| Ga0068851_107392502 | 3300005834 | Corn Rhizosphere | KDRLDVNTLAGMDTVGSVGLAAGTIQFFVDGLLVP* |
| Ga0068870_103543701 | 3300005840 | Miscanthus Rhizosphere | PEVANDRLDVNTLAGTDTVDAGGLAAGVIELVVNGVPQP* |
| Ga0068870_106463152 | 3300005840 | Miscanthus Rhizosphere | TVDVLHPELANDRLEINTLGGGNKVDGSGLAAGAIQLLVNGVSLP* |
| Ga0070717_113002501 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EAANDRLEINTLAGTDTVDPSGLAAGAIPLFVDGALVP* |
| Ga0066696_100154391 | 3300006032 | Soil | TVEVLHSEAANDRLEINTLAGSDKVDSSGLAAGTIQLLVNGVPVL* |
| Ga0066696_107816672 | 3300006032 | Soil | PEAANDRLEINTLAGTDAVDSSGLAAGAIQLFVDGVLVP* |
| Ga0066656_110065111 | 3300006034 | Soil | VGVFHSEAANDRLEINTLAGTDTVNSGGLAAGVIQLFVDGVLVP* |
| Ga0066652_1009489282 | 3300006046 | Soil | VANDRLEINTLAGTDSVDSAALAAGAIKLFVDGLLVP* |
| Ga0066652_1016408341 | 3300006046 | Soil | AANDRLEINTLAGTDAVSSAGLAAGVIQLFVDNVLIP* |
| Ga0075432_104766991 | 3300006058 | Populus Rhizosphere | SGLTATVAVLHAEVAHDSLEINTLAGTDTVDSSGLAAGAIKLLVDGVLVP* |
| Ga0070715_100868474 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | HSEVGKDRLDVNTLAGMDTVGSVGLAAGTIQFFVDGLLVP* |
| Ga0070712_1006717471 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GGLTPTVNLFHHEATDRLELNALDGNDTVNTAGLAAGVIQVFVDGVLVP* |
| Ga0070712_1015457593 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EAALDRVDINTLGGVDSVASAALSAGAIQLFVDGLIVH* |
| Ga0074048_100427604 | 3300006581 | Soil | IFHPEADDRLDINTLAGSDTVQSAGLAPGALQLFVDGGLVP* |
| Ga0074057_112189392 | 3300006605 | Soil | GLAATVGILHSEAAGDRLEINTLAGRDSVDRAGLAGGAIQLFVDGILVP* |
| Ga0066665_113675951 | 3300006796 | Soil | SGLAATVKILHSEAANDHLEINTLAGRDSVDSSGLAAGATQLFVDGVLVP* |
| Ga0066659_106810521 | 3300006797 | Soil | NDRLEINTLAGSDKIDSSGLAAGTIQLLVNGVPVL* |
| Ga0075431_1006879392 | 3300006847 | Populus Rhizosphere | SEGASDRLEINTLAGAVDTVALGGLAPGAVQLTVDGALVP* |
| Ga0075433_114482442 | 3300006852 | Populus Rhizosphere | NDRLEVNTLGGADTVESGGLAPGSIQLFVDGAPRP* |
| Ga0075434_1014566782 | 3300006871 | Populus Rhizosphere | LDGLDIETLGGTDSVFSAGLAAGSIRLFVDGALVS* |
| Ga0066710_1005360783 | 3300009012 | Grasslands Soil | KILHPEAANDRLDINTLAGTDTVATIGLAAGAIQLFADGIPVP |
| Ga0066710_1009734924 | 3300009012 | Grasslands Soil | EAANDRLEINTLNGNDNVNSAGLAAGVIQLFVDGVLVP |
| Ga0066710_1048767651 | 3300009012 | Grasslands Soil | VRVLHSEAANDRLEINTLAGTDTVNSGGLTAGVIQLFVDGALVP |
| Ga0099827_106594141 | 3300009090 | Vadose Zone Soil | PEAANDRLEVNTLTGADTVTSVGLTPGAIQLLVNGVLVP* |
| Ga0099827_109848101 | 3300009090 | Vadose Zone Soil | GLATTTRVLHWEVANDRLEINTLAGSDTLNTIGLAAGAIRLFLDGLLVQ* |
| Ga0105245_105068573 | 3300009098 | Miscanthus Rhizosphere | ANDRLDVNTLAGTDTVDAGGLAAGVIELVVNGVPQP* |
| Ga0075418_108721211 | 3300009100 | Populus Rhizosphere | PLVEILDPEGANDRLDVNTLDGNDTVDSSGLVAGTIQLFVDGVLVP* |
| Ga0075423_109557461 | 3300009162 | Populus Rhizosphere | TDRLELNALAGNDTVNSAGLAAGVIQLFVDGVLVP* |
| Ga0105241_101967161 | 3300009174 | Corn Rhizosphere | VGGLTPTVNLFHHEATDRLELNALAGNDTVNTAGLAAGVIQVFVDGVLVP* |
| Ga0105249_112246203 | 3300009553 | Switchgrass Rhizosphere | ERANDRLDINTLDGHDTVDSSGLAAGTIQLFVDGVLVP* |
| Ga0126307_101596941 | 3300009789 | Serpentine Soil | EFANDRLEINTLDGNDTVATDGLAAGAIQLFVDGVPVP* |
| Ga0105064_10726471 | 3300009821 | Groundwater Sand | IGILHSEAANDRLEINTLEGRDSVDSGGLASGAIQLFVDVLVP* |
| Ga0105066_10314461 | 3300009822 | Groundwater Sand | EAANDRLEVNTLAGTDSVDSGGLAAGAIQLLVDGALVP* |
| Ga0126304_100635571 | 3300010037 | Serpentine Soil | FANDRLEINTLDGNDTVATDGLAAGAIQLFVDGVPVP* |
| Ga0126304_109296671 | 3300010037 | Serpentine Soil | QPEFANDRLEINTLDGNDTVATDGLAAGAIQLFVDGVPVP* |
| Ga0126314_110934332 | 3300010042 | Serpentine Soil | ANDRLEINTLAGTDTVETVGLAAGAIQLFLDGILVP* |
| Ga0126380_122070101 | 3300010043 | Tropical Forest Soil | HHEATDRLEINTLAGNDTVETPGLAAGAIQLFVDGVVVP* |
| Ga0126310_105070072 | 3300010044 | Serpentine Soil | ILHSEVANDRLDVNTLTGTDTVGSAGLGAGVIQFFVDSVRAL* |
| Ga0126306_1000004327 | 3300010166 | Serpentine Soil | VKASGLAAGIVILHPEAANDRLEINSLAGRDAVDSNSLAAGAIQLLVDGIPVS* |
| Ga0126306_101827691 | 3300010166 | Serpentine Soil | ILQPEFANDRLEINTLDGNDTVATDGLTAEAIQLFVDGVPVP* |
| Ga0134070_101555551 | 3300010301 | Grasslands Soil | NDRLEINTLAGSDTVDSVGLAAGAIQLFVDGLLVP* |
| Ga0134109_103505752 | 3300010320 | Grasslands Soil | TAKGLAPLVSIFHPEIANDRLEINTLAGNDTVDSSGLAAGAIQLFVDGVLVP* |
| Ga0134086_102445541 | 3300010323 | Grasslands Soil | NDRLEISTLAGTDTVDSSGLAAGAIQLFVDGVLVP* |
| Ga0134111_104953502 | 3300010329 | Grasslands Soil | FHPESANDRLEGNTLAGSDVVDSSGLAPGTLQLFVDGALRP* |
| Ga0134062_106112451 | 3300010337 | Grasslands Soil | PEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGLLVP* |
| Ga0105239_117866573 | 3300010375 | Corn Rhizosphere | VKGLAPFVEILHPEGANDRLDINTLDGHDTVDSSGLAAGTIQLFVDGVLVP* |
| Ga0126381_1041525742 | 3300010376 | Tropical Forest Soil | LGHGLAPTVEVSHADAGDRLEINTLAGIDTVDSSGLAAGAIQLLVDGALVP* |
| Ga0134121_107552081 | 3300010401 | Terrestrial Soil | EAANDRLEINTPAGTDAVDSSGLAAGAIQLFEDGVLVP* |
| Ga0134123_127168811 | 3300010403 | Terrestrial Soil | ILHAEAANDRLEINTLSGRDTVDSGGLAAGAIQLFVNGLIAS* |
| Ga0105246_107329611 | 3300011119 | Miscanthus Rhizosphere | HPEVANDRLDVNTLTGTDNVDAGGLAAGVIQLVVNGVLQP* |
| Ga0120187_10117151 | 3300012015 | Terrestrial | NDRLEINTLAGTDTVDSIALAAGAIQLFVDGAPVP* |
| Ga0137364_102167911 | 3300012198 | Vadose Zone Soil | DRLEINTLAGTDTVDSAGLAAGAIQLFVDGVLVP* |
| Ga0137364_109014383 | 3300012198 | Vadose Zone Soil | LDPLVAIFHPEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGVLVP* |
| Ga0137364_113941361 | 3300012198 | Vadose Zone Soil | KVGGLAPTVAIFNHEATDRLEINTLAGNDTVATVGLAAGVIQLFVDGVPV* |
| Ga0137383_107903011 | 3300012199 | Vadose Zone Soil | SEAANDRLEINTLDGRDSVDSGGLAAGAIQLFVDGIVVP* |
| Ga0137365_103861291 | 3300012201 | Vadose Zone Soil | AANDRLEINTLAGTDIVDSAGLAAGAIQLFVDGVPLP* |
| Ga0137365_105532681 | 3300012201 | Vadose Zone Soil | APAVAIFHPEAANDRLEINTLAGTDTVDSSVLAAGAIQLFVDGVLVP* |
| Ga0137365_106764011 | 3300012201 | Vadose Zone Soil | ANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGVLVP* |
| Ga0137374_100593886 | 3300012204 | Vadose Zone Soil | PTIKILHPEVANDRLEINTLAGADTLNTIGLAAGAIQLFVDGILVP* |
| Ga0137374_102132431 | 3300012204 | Vadose Zone Soil | KILHPEVANDRLEINTLADADTLNTIGLAAGAIQLFVDGILVP* |
| Ga0137380_100524771 | 3300012206 | Vadose Zone Soil | TPTLKILHPEAANDRLEINTLAGTDTLETVGLAAGAIQLFEDGILVP* |
| Ga0137380_113601411 | 3300012206 | Vadose Zone Soil | DPRIGILHPEAANDRLEINTLAGSDTVDSVGLAAGAIQLFVDGLLIP* |
| Ga0137381_104718831 | 3300012207 | Vadose Zone Soil | TAKGLAPAIAILHPEAANDRLEINTLAGSDTVDSHGLVAGAIQLFVDGLLVP* |
| Ga0137376_103945153 | 3300012208 | Vadose Zone Soil | HPEAGNDRLEINTLAGSDTVDSDGLAAGAIQLFVDGLLVP* |
| Ga0137376_109553773 | 3300012208 | Vadose Zone Soil | LVAIFHPEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGVLVP* |
| Ga0137376_112954651 | 3300012208 | Vadose Zone Soil | KGLAPLVSIFHPEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGLLVP* |
| Ga0137379_106022283 | 3300012209 | Vadose Zone Soil | FHPEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGVLVP* |
| Ga0137378_105772981 | 3300012210 | Vadose Zone Soil | LDPLVAIFHPEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGLLVP* |
| Ga0137378_112838001 | 3300012210 | Vadose Zone Soil | PEVANDRLEVNTLAGTDAVNSVGLIAGAIQLFVDGVLVP* |
| Ga0137377_111144281 | 3300012211 | Vadose Zone Soil | IRILHPEATDRLDINTLAGNDTVQSALAAGAIQLFVDGVLVP* |
| Ga0137377_116127292 | 3300012211 | Vadose Zone Soil | GLDPLVAIFHPEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGVLVP* |
| Ga0137377_117150831 | 3300012211 | Vadose Zone Soil | EAANDRLEINTLAGSDTVDSHGLAAGAIQLFVDGLLVP* |
| Ga0137367_101103301 | 3300012353 | Vadose Zone Soil | PEVANDRLEINTLAGADTLNTIGLAAGAIQLFVDGILVP* |
| Ga0137367_101677265 | 3300012353 | Vadose Zone Soil | TRVLHSEVANDRLEINTLAGSDSVDSGGLAAGAIQLFVDGLLAP* |
| Ga0137367_101971093 | 3300012353 | Vadose Zone Soil | VQVSGLAATIGILHPEATKDQLEINTLAGSGTVDSARLAAGAIKLFVDGLLVP* |
| Ga0137367_107927562 | 3300012353 | Vadose Zone Soil | APRVAILHPEAANDRLDINTLAGTDSIDSAALAAGAIQLFVDGVLVP* |
| Ga0137366_109268851 | 3300012354 | Vadose Zone Soil | LIPAVRVLHSEPANDRLEINTLAGADTVNSAGLAAGVIQLFVDGVLVP* |
| Ga0137369_106254211 | 3300012355 | Vadose Zone Soil | EAANDRLEVNTRAGRDTVDARGLTAGAIQLLVNGVLVP* |
| Ga0137371_102179353 | 3300012356 | Vadose Zone Soil | EAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGLLVP* |
| Ga0137371_104982063 | 3300012356 | Vadose Zone Soil | AANDRLEINTLAGTDTVDSSGLAAGAIQLFVDGLLVP* |
| Ga0137368_108495372 | 3300012358 | Vadose Zone Soil | FHPEAANDRLEVNTLAGTDTVASVGLAAGAIQLFVDGVPVP* |
| Ga0137385_100423125 | 3300012359 | Vadose Zone Soil | EVVAKGLDPTIAFLHPEAANDRREINTLAGSDTVDSAGLAAGAIQLFVDGLLVP* |
| Ga0137385_108280741 | 3300012359 | Vadose Zone Soil | AIAILHPEVANERLEINTLAVSDTVDSDGLATGAIQLFVDGLLVP* |
| Ga0150984_1182658251 | 3300012469 | Avena Fatua Rhizosphere | IRILHPDAALDRVDINTLGGVDSVASAALSAGAIHLFVDGLIVH* |
| Ga0157305_100675871 | 3300012891 | Soil | ILHAEFANDRLDINTLAGDDRVDADGLQIGVIQLFVDGLLVP* |
| Ga0157298_102220802 | 3300012913 | Soil | EAALDRIDINTLGGVDSVASAALSAGVIQLFVDGVLVP* |
| Ga0157297_102242532 | 3300012914 | Soil | AATVGIRHSEAVNDRLEVNTLAGTDSVEFDGLAAGTIQLLVDGVLVP* |
| Ga0157310_104722491 | 3300012916 | Soil | EVANDRLEVNTLAGADDANAGGLAPGAIQLFVDGVLQP* |
| Ga0153915_105874961 | 3300012931 | Freshwater Wetlands | TLADPIDRLDINTLAGTDTVDTSGLAAGVIQLFVDGVPQ* |
| Ga0153915_109675062 | 3300012931 | Freshwater Wetlands | LITLADPIDRLDINTLAGTDTVDTSGLPAGVIQLFVDGVPQ* |
| Ga0164241_110088571 | 3300012943 | Soil | ELANDRLEINALGNKVDAGGLAAGAIQLLVNGVSLP* |
| Ga0164298_106884263 | 3300012955 | Soil | AANYRLDVNTLAGLDTVSSAGLGAGLVQLFVDGVLAP* |
| Ga0164303_100847281 | 3300012957 | Soil | DSLEVNTLAGRDTVDSNGLAAGSLKLLVDGIFVR* |
| Ga0164303_110323382 | 3300012957 | Soil | SGEVTVGGVTPTVNLFHHEATDRLELNALDGNDTVNTAGLAAGVIQVFVDGVLLP* |
| Ga0164301_118901051 | 3300012960 | Soil | IRHSEEANDRFEINTLAGNDTVSSGGLGAGLIQLFVDGALVP* |
| Ga0164302_104029641 | 3300012961 | Soil | TDRLELNALDGNDTVNSAGLAAGVIQLFVDGVLVP* |
| Ga0134110_102699782 | 3300012975 | Grasslands Soil | VGVFHSEAANDRLEINTLAGNDTVNSAGLAAGVIQLFADGILVP* |
| Ga0134110_103847061 | 3300012975 | Grasslands Soil | VEVLHSEAANDRLEINTLAGSDKVDSSGLAAGAIQLIVNGVPVP* |
| Ga0164309_102669293 | 3300012984 | Soil | HPEAANDRLEINTLAGTDSVQSAGLAAGAIQLFVDGVLVP* |
| Ga0164308_104853041 | 3300012985 | Soil | ANDRLDVNTLAGLDTVSSAGLGAGLVQLFVDGVLAP* |
| Ga0164307_114855752 | 3300012987 | Soil | HEATDRLELNALDGNDTVNSAGLAAGVIQLFVDGVLVP* |
| Ga0164306_118236461 | 3300012988 | Soil | KGLDPIVAIRHSEAANDRLEINTLAGTDSVQSAGLAPGAIQLLVDGLLVP* |
| Ga0164305_106656233 | 3300012989 | Soil | HPEAANDRLEINTLAGTDTVDASGLAGGAIQLFVDGVLVP* |
| Ga0164305_110045931 | 3300012989 | Soil | DRLELNALEGNDTVNTAGLAAGVIQVFVDGVLVP* |
| Ga0164305_121111662 | 3300012989 | Soil | AATVEILHAEAANDRLELNTLDGRDAVDSIGLAAGAIQLFVDGVLRP* |
| Ga0163162_131866241 | 3300013306 | Switchgrass Rhizosphere | PDIANDRLETNTLGDGNKVGAGGLAAGAIQLLVNGVSLP* |
| Ga0120158_102408561 | 3300013772 | Permafrost | FHHEPTDRLEINTLAGNDTVSSAGLVAGAIQLFVDGTLVP* |
| Ga0157377_101677014 | 3300014745 | Miscanthus Rhizosphere | GLAATVEVLQPEVANDRLEVNTLAGADDANAGGLAPGAIQLFVDGVLQP* |
| Ga0157379_104879041 | 3300014968 | Switchgrass Rhizosphere | DRLDVNTLAGMDTVGSVGLAAGTIQFFVDGLLVP* |
| Ga0157379_105602941 | 3300014968 | Switchgrass Rhizosphere | PEFANDRLDVNTLAGNDTVDSGGLSPGVIQLFVDGVQQ* |
| Ga0157376_114651322 | 3300014969 | Miscanthus Rhizosphere | DRLEVNTLAGSDTVGSGGLGAGLIQLVVDGVVVP* |
| Ga0173480_102781042 | 3300015200 | Soil | IKILHPEVANDRLEIATLAGTDAVNTIGLAPGAIQLFVDGVLVP* |
| Ga0134072_104596642 | 3300015357 | Grasslands Soil | HSEAANDRLEINTLAGSDKVDSSGLAAGAIQLLVNGVPVP* |
| Ga0132258_112203181 | 3300015371 | Arabidopsis Rhizosphere | IVAIRHPEAVNDRLEINTLAGTDSVESAGLAAGAIQLLVDGLLVP* |
| Ga0132256_1002079093 | 3300015372 | Arabidopsis Rhizosphere | SEAANDRLDVHTLAGTDTVDSSGLAAGVIQILVNDVLVP* |
| Ga0132256_1012146933 | 3300015372 | Arabidopsis Rhizosphere | LSATVEVLQPEVANDRLEVNTLAGTDAVDAGGLAPGTIQLLVDGVPQP* |
| Ga0134083_102363452 | 3300017659 | Grasslands Soil | PPLVEILHPEGANDRLDINTLDGSDTVDSSGLAAGTIPLFVDGVPVP |
| Ga0184618_104873711 | 3300018071 | Groundwater Sediment | IFHPEAANDRLEINTLAGRDTVDSAGLAVGAIELFVDGVLVP |
| Ga0184624_101780091 | 3300018073 | Groundwater Sediment | TEAANDRLEVNTLAGRDTVDSGGLAAGVIQLFVDGVLVP |
| Ga0190270_105466651 | 3300018469 | Soil | SLLHPELANDRLEINTLGGGNNVDADGLAAGAIQLLVNGVSLP |
| Ga0190274_139908692 | 3300018476 | Soil | HAEAANDRLEVNTLAGSDTVSSGGLGAGLTQLFVDGVLVP |
| Ga0066669_116553782 | 3300018482 | Grasslands Soil | HPEAANDRLEINTLAGSDTVNSDGLAAGAIQLFVDGLLVP |
| Ga0193734_10439911 | 3300020015 | Soil | ANDRLEINTLAGTDTVDSGGLAAGAIQLFEDGALVP |
| Ga0210378_103269341 | 3300021073 | Groundwater Sediment | LSPLVAIFHPEAANDRLEINTLAGTDTIDSAGLAAGAIQLFVDGVLVP |
| Ga0193719_100184757 | 3300021344 | Soil | AIFHPEAANDRLEINTLAGTDTIDSAGLAAGAIQLFVDGVLVP |
| Ga0222621_10241712 | 3300021510 | Groundwater Sediment | ILHSESADDSLEINTLAGRDTVDSNGLAAGTLKLLVDGILVL |
| Ga0222622_100050881 | 3300022756 | Groundwater Sediment | LHSESADDSLEINTLAGRDTVDSNGLAAGTLKLLVDGILVL |
| Ga0207685_100888511 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LHSEVGKDRLDVNTLAGMDTVGSVGLAAGTIQFFVDGLLVP |
| Ga0207654_108267122 | 3300025911 | Corn Rhizosphere | AEAANDRLAINTLAGTDAVDSSGLAAGAIQLFEDGVLVP |
| Ga0207707_100875301 | 3300025912 | Corn Rhizosphere | LAAGTELLHPDAADRLELNTLAGTDSVDTTGLAAGTIQLFVNGVLRP |
| Ga0207693_114864823 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ILHPEAALDRVDINTLGGVDSVASAALSAGAIQLFVDGLIVH |
| Ga0207660_111774721 | 3300025917 | Corn Rhizosphere | EAALDRIDINTLGGVDSVASAALSAGVIQLFVDGAIVR |
| Ga0207652_112614912 | 3300025921 | Corn Rhizosphere | PDAADRLELNTLAGTDSVDTTGLAAGTIQLFVNGVLRP |
| Ga0207681_101671121 | 3300025923 | Switchgrass Rhizosphere | TTRILHSEVGKDRLDVNTLAGMDTVGSVGLAAGTIQFFVDGLLVP |
| Ga0207664_113023733 | 3300025929 | Agricultural Soil | EVARDRLDVNTLAGMDSVSSAGLAAGAIQLFVDGLLVP |
| Ga0207664_120031111 | 3300025929 | Agricultural Soil | FHAEAANDRLAINTLAGTDAVDSSGLAAGAIQLFEDGVLVP |
| Ga0207709_112570053 | 3300025935 | Miscanthus Rhizosphere | NDRLEINTLAGTDSVQSAGLTAGAIQLFVDGLLVP |
| Ga0207661_103037821 | 3300025944 | Corn Rhizosphere | ANDRLDINTLAGADSVDSAALAAGTIQLFVDGLLVP |
| Ga0207667_107627421 | 3300025949 | Corn Rhizosphere | TVNVLHPEVANDRLEINTLAGKDTVNPGGLAAGVIKLFANGVPLP |
| Ga0207651_119822232 | 3300025960 | Switchgrass Rhizosphere | ATTQVLHSEHANDRLEVNTLAGVDTVASAGLAADAIQFLLDGVLVK |
| Ga0207676_106530784 | 3300026095 | Switchgrass Rhizosphere | KDRLDVNTLAGMDTVGSVGLAAGTIQFFVDGLLVP |
| Ga0207698_116834932 | 3300026142 | Corn Rhizosphere | HPEAANDRLEINTLAGKDTVNAGGLAAGVIKLFANGVPLP |
| Ga0209234_12844583 | 3300026295 | Grasslands Soil | NDKLEINTLAGTDAIDSSGLAPGAIQLLVDGVLVP |
| Ga0209470_12308231 | 3300026324 | Soil | LVAILHPEAANDRLEINTLAGTDTVDSAGLAAGAIQLFVDGLLIP |
| Ga0209056_103993743 | 3300026538 | Soil | AIFHPEAANDRLEINTLAGTDTVDSSGLAAGAIQLFVDGVLVP |
| Ga0209874_10201304 | 3300027577 | Groundwater Sand | FHSEAANDTLEINTLAGTDNVDSGGLAAGVIRLFVDGVLVL |
| Ga0209860_10158761 | 3300027949 | Groundwater Sand | AATIGILHSEVANDRLEINTLAGTDSVDSGGLAAGAIQLFVDGALVP |
| Ga0209889_10004611 | 3300027952 | Groundwater Sand | NDRLEINTLAGTDSVDSGGLAAGAIQLFVDGALVP |
| Ga0268265_111996273 | 3300028380 | Switchgrass Rhizosphere | RILHSEVGKDRLDVNTLAGMDTVGSVGLAAGTIQFFVDGLLVP |
| Ga0247821_108333501 | 3300028596 | Soil | VGVLHAESANDRLELNTLEGDDTVDSGGLAAGTIQLLVNGAVVP |
| Ga0307293_100754451 | 3300028711 | Soil | EAANDRLEINTLAGADTVGSAGLTAGAIKLFLDGVLVA |
| Ga0307303_100083154 | 3300028713 | Soil | IFHPEAANDRLEINTLAGTDTVDSGGLAAGAIQLFEDGALVL |
| Ga0307303_100799192 | 3300028713 | Soil | IFHPEAANDRLEINTLAGTDTIDSAGLAAGAIQLFVDGVLVP |
| Ga0307311_102372732 | 3300028716 | Soil | PTVKILHPEAANDRLEINTLAGRDPVESGALAAGAIQLFVDGVLVP |
| Ga0307317_100592513 | 3300028720 | Soil | HPEAANDRLEINTLAGRDPVESGALAAGAIQLFVDGVLVP |
| Ga0307317_102090291 | 3300028720 | Soil | TVNLFHHEATDRLELNALDGNDTVNSAGLTAGVIQLFVDGVLVP |
| Ga0307282_100206691 | 3300028784 | Soil | LVEILHPEGANDRLDINTLDGHDTVDSSGLAAGTIQLFVDGVLVP |
| Ga0307282_100333227 | 3300028784 | Soil | NDRLEINTLAGTDTIDSAGLAAGAIQLFVDGVLVP |
| Ga0307282_103552202 | 3300028784 | Soil | NDRLEINTLAGSDTVDSDGLAAGAIQLFVDGALVP |
| Ga0307299_103409351 | 3300028793 | Soil | LHADAALDRLDVNTLAGTDTVDSARLTAGSIQLFVNGVLFP |
| Ga0307284_100657511 | 3300028799 | Soil | LATTVAIFHPEVRNDRLEINTLAGTDRVDSSGLAAGAIQLFVDGVRVR |
| Ga0307284_102756591 | 3300028799 | Soil | ESADDSLEINTLAGRDTVDSNGLAAGTLKLLVDGILVL |
| Ga0247825_108807112 | 3300028812 | Soil | LHSEIANDRLEVNTLAGTDSVASGALAPGSIQLFVDGLLVP |
| Ga0307302_103181681 | 3300028814 | Soil | VPTVAIFHPEANDRLEVNTLAGNDTVDSAGLAARTIQLFVDGVLVP |
| Ga0307310_100158034 | 3300028824 | Soil | TPTIKILHPEAASDRLEINTLAGRDTVDTPGLAAGAIQLFVDGLLVP |
| Ga0307310_101091581 | 3300028824 | Soil | LAPLVEILHPEGANDRLDINTLDGHDTVDSSGLAAGTIQLFVDGVLVP |
| Ga0307310_107079873 | 3300028824 | Soil | EVRNDRLEINTLAGRDTVDSGGLAAGAIQLFVDGVLVP |
| Ga0307312_102070412 | 3300028828 | Soil | HSEAANDRLEINTLAGDDRVASGGLAGGVIQLFVDGVLVP |
| Ga0307312_110278752 | 3300028828 | Soil | PTVRILHPEARDELDVNTLAGTDTVDSSGLAAGAIQLFVDGVPVP |
| Ga0307314_100163584 | 3300028872 | Soil | EGAKDSLEINTLAGRDTVDSNGLAAGTLKLLVDGILVL |
| Ga0307314_102295562 | 3300028872 | Soil | AANDRLEINTLAGTDTVDSGGLAAGAIQLFVDGILVP |
| Ga0307289_100972034 | 3300028875 | Soil | ATDRLEINTLAGADTVGSAGLTAGAIKLFLDGVLVA |
| Ga0247827_111986132 | 3300028889 | Soil | ILHPESANDRLEVNTLGGADSVESGGLAPGAIQLFVDGAPRP |
| Ga0247826_111249191 | 3300030336 | Soil | HSEAANDRLDVDTKAGNDIVNSAGLAAGAIQLFVDGTLVP |
| Ga0307405_118813841 | 3300031731 | Rhizosphere | LHSEAANDRLEINPLAGTDTVDSGGFAAGVIQLFVDGVLVP |
| Ga0310907_108422282 | 3300031847 | Soil | TIGVLHAEGASDRLEINTLAGAVDTVALGGLAPGAVQLTVDGALVP |
| Ga0310904_113381052 | 3300031854 | Soil | ESANDRLELNTLEGDDTVDSGGLAAGTIQLLVNGALVP |
| Ga0310885_103884772 | 3300031943 | Soil | HEATDRLELNALAGNDTVNTAGLAAGVIQVFVDGVLVP |
| Ga0364933_205536_371_517 | 3300034150 | Sediment | LAATIGILHSEAATDRLEINTLAGTDSVDSGGLAAGAIQLFVDGGLIP |
| Ga0373958_0093916_513_671 | 3300034819 | Rhizosphere Soil | VTVGGLTPTVNLFHHEATDRLELNALAGNDTVNTAGLAAGVIQVFVDGVLVP |
| ⦗Top⦘ |