Basic Information | |
---|---|
Family ID | F023423 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 210 |
Average Sequence Length | 44 residues |
Representative Sequence | LSAVELLEGSWRTAPNHSRPASCVVDADIDAEDYPERDPQKGH |
Number of Associated Samples | 185 |
Number of Associated Scaffolds | 210 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.83 % |
% of genes near scaffold ends (potentially truncated) | 90.00 % |
% of genes from short scaffolds (< 2000 bps) | 94.76 % |
Associated GOLD sequencing projects | 178 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.857 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.476 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.45% β-sheet: 0.00% Coil/Unstructured: 91.55% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 210 Family Scaffolds |
---|---|---|
PF01609 | DDE_Tnp_1 | 46.67 |
PF13546 | DDE_5 | 35.24 |
PF05685 | Uma2 | 0.95 |
PF00106 | adh_short | 0.48 |
PF12543 | DUF3738 | 0.48 |
PF13565 | HTH_32 | 0.48 |
PF13231 | PMT_2 | 0.48 |
PF05598 | DUF772 | 0.48 |
PF13683 | rve_3 | 0.48 |
COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
---|---|---|---|
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 46.67 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 46.67 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 46.67 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 46.67 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 46.67 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 46.67 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.00 % |
Unclassified | root | N/A | 30.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y02HEE6F | Not Available | 702 | Open in IMG/M |
2170459019|G14TP7Y02GOI7Q | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
2170459020|G1P06HT02H499F | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia proteamaculans | 545 | Open in IMG/M |
3300000956|JGI10216J12902_108286501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1597 | Open in IMG/M |
3300001471|JGI12712J15308_10026435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1505 | Open in IMG/M |
3300001686|C688J18823_10145116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1631 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100284745 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300002568|C688J35102_119692848 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300002914|JGI25617J43924_10143693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 825 | Open in IMG/M |
3300004081|Ga0063454_100225703 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
3300004081|Ga0063454_101758935 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300004091|Ga0062387_100202572 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300004463|Ga0063356_105953998 | Not Available | 523 | Open in IMG/M |
3300005176|Ga0066679_10851983 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005181|Ga0066678_10215448 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300005332|Ga0066388_105923992 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005336|Ga0070680_101255287 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300005347|Ga0070668_100831494 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300005363|Ga0008090_14719506 | Not Available | 1038 | Open in IMG/M |
3300005436|Ga0070713_100487652 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300005441|Ga0070700_100159857 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300005445|Ga0070708_100228464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1746 | Open in IMG/M |
3300005530|Ga0070679_101222430 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005534|Ga0070735_10692304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 602 | Open in IMG/M |
3300005534|Ga0070735_10722570 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005534|Ga0070735_10925066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 511 | Open in IMG/M |
3300005539|Ga0068853_101541616 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300005549|Ga0070704_101480289 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300005560|Ga0066670_10753567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 590 | Open in IMG/M |
3300005602|Ga0070762_10155588 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300005602|Ga0070762_10980504 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300005616|Ga0068852_101241324 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300005618|Ga0068864_102141909 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005764|Ga0066903_108915891 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300006050|Ga0075028_100353960 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300006059|Ga0075017_101395586 | Not Available | 551 | Open in IMG/M |
3300006173|Ga0070716_100162228 | Not Available | 1450 | Open in IMG/M |
3300006237|Ga0097621_100747883 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300006797|Ga0066659_10363589 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300006846|Ga0075430_100123099 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
3300006852|Ga0075433_10598816 | Not Available | 968 | Open in IMG/M |
3300006871|Ga0075434_100946356 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300006880|Ga0075429_101018448 | Not Available | 724 | Open in IMG/M |
3300006881|Ga0068865_101528589 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300006903|Ga0075426_11006365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 630 | Open in IMG/M |
3300006904|Ga0075424_100967538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 908 | Open in IMG/M |
3300006954|Ga0079219_10562913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 821 | Open in IMG/M |
3300006954|Ga0079219_11186220 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300007076|Ga0075435_101260767 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300009038|Ga0099829_10983820 | Not Available | 700 | Open in IMG/M |
3300009081|Ga0105098_10758756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300009098|Ga0105245_12538048 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300009148|Ga0105243_11731322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
3300009148|Ga0105243_13067439 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300009792|Ga0126374_10824896 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300010037|Ga0126304_10656414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 708 | Open in IMG/M |
3300010044|Ga0126310_11770820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 515 | Open in IMG/M |
3300010046|Ga0126384_11091653 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300010048|Ga0126373_10273222 | Not Available | 1673 | Open in IMG/M |
3300010048|Ga0126373_12628897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 561 | Open in IMG/M |
3300010304|Ga0134088_10408189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
3300010358|Ga0126370_11129473 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300010359|Ga0126376_11436262 | Not Available | 716 | Open in IMG/M |
3300010359|Ga0126376_12209466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 595 | Open in IMG/M |
3300010360|Ga0126372_11946118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300010376|Ga0126381_100546058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1641 | Open in IMG/M |
3300010376|Ga0126381_101290870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1055 | Open in IMG/M |
3300010376|Ga0126381_101720396 | Not Available | 906 | Open in IMG/M |
3300010376|Ga0126381_102169204 | Not Available | 799 | Open in IMG/M |
3300010398|Ga0126383_10452031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1334 | Open in IMG/M |
3300010399|Ga0134127_12250131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
3300011120|Ga0150983_16110344 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300011432|Ga0137428_1021167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1633 | Open in IMG/M |
3300012189|Ga0137388_10627316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 999 | Open in IMG/M |
3300012199|Ga0137383_10853017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
3300012200|Ga0137382_10794781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 680 | Open in IMG/M |
3300012202|Ga0137363_10585158 | Not Available | 942 | Open in IMG/M |
3300012202|Ga0137363_10810551 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300012205|Ga0137362_10794882 | Not Available | 811 | Open in IMG/M |
3300012207|Ga0137381_10497099 | Not Available | 1064 | Open in IMG/M |
3300012212|Ga0150985_110777143 | Not Available | 1227 | Open in IMG/M |
3300012363|Ga0137390_10578876 | Not Available | 1092 | Open in IMG/M |
3300012683|Ga0137398_10588999 | Not Available | 769 | Open in IMG/M |
3300012923|Ga0137359_10139536 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
3300012929|Ga0137404_10850922 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300012957|Ga0164303_10129759 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300012958|Ga0164299_10960686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 626 | Open in IMG/M |
3300012960|Ga0164301_10397238 | Not Available | 964 | Open in IMG/M |
3300012971|Ga0126369_12341584 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300012987|Ga0164307_11488410 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300013314|Ga0175859_1067814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1036 | Open in IMG/M |
3300013503|Ga0120127_10158426 | Not Available | 545 | Open in IMG/M |
3300014158|Ga0181521_10023005 | All Organisms → cellular organisms → Bacteria | 5078 | Open in IMG/M |
3300014497|Ga0182008_10705727 | Not Available | 577 | Open in IMG/M |
3300014638|Ga0181536_10036499 | All Organisms → cellular organisms → Bacteria | 3497 | Open in IMG/M |
3300014657|Ga0181522_10553987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 695 | Open in IMG/M |
3300014745|Ga0157377_10604893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium archetypum | 782 | Open in IMG/M |
3300015051|Ga0137414_1188283 | Not Available | 802 | Open in IMG/M |
3300015261|Ga0182006_1227413 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300017695|Ga0180121_10345947 | Not Available | 570 | Open in IMG/M |
3300017926|Ga0187807_1203830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
3300017942|Ga0187808_10611361 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300018028|Ga0184608_10154327 | Not Available | 991 | Open in IMG/M |
3300018054|Ga0184621_10095447 | Not Available | 1047 | Open in IMG/M |
3300018431|Ga0066655_10338064 | Not Available | 986 | Open in IMG/M |
3300018468|Ga0066662_10394240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1214 | Open in IMG/M |
3300018469|Ga0190270_13029495 | Not Available | 531 | Open in IMG/M |
3300019789|Ga0137408_1017947 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300019887|Ga0193729_1219780 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300020579|Ga0210407_10471520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 981 | Open in IMG/M |
3300020582|Ga0210395_11341643 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300020583|Ga0210401_10621282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
3300021178|Ga0210408_11304583 | Not Available | 550 | Open in IMG/M |
3300021362|Ga0213882_10289172 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300021372|Ga0213877_10279280 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300021401|Ga0210393_11312573 | Not Available | 580 | Open in IMG/M |
3300021402|Ga0210385_10159811 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300021405|Ga0210387_11001895 | Not Available | 732 | Open in IMG/M |
3300021407|Ga0210383_10443300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1121 | Open in IMG/M |
3300021432|Ga0210384_10265515 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300021441|Ga0213871_10032486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1368 | Open in IMG/M |
3300021477|Ga0210398_11534585 | Not Available | 518 | Open in IMG/M |
3300021860|Ga0213851_1688139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
3300021861|Ga0213853_10730461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
3300023078|Ga0247756_1103560 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300024227|Ga0228598_1061937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
3300024331|Ga0247668_1060015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
3300025900|Ga0207710_10581341 | Not Available | 585 | Open in IMG/M |
3300025910|Ga0207684_11475404 | Not Available | 554 | Open in IMG/M |
3300025921|Ga0207652_10532690 | Not Available | 1056 | Open in IMG/M |
3300025922|Ga0207646_10258129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1575 | Open in IMG/M |
3300025932|Ga0207690_10743518 | Not Available | 808 | Open in IMG/M |
3300025935|Ga0207709_11824547 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300026089|Ga0207648_10069604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3066 | Open in IMG/M |
3300026089|Ga0207648_12131197 | Not Available | 521 | Open in IMG/M |
3300026271|Ga0209880_1073093 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300026318|Ga0209471_1230131 | Not Available | 667 | Open in IMG/M |
3300026817|Ga0207775_105849 | Not Available | 982 | Open in IMG/M |
3300026960|Ga0207582_1001591 | Not Available | 1678 | Open in IMG/M |
3300027003|Ga0207722_1037746 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300027181|Ga0208997_1014244 | Not Available | 1084 | Open in IMG/M |
3300027650|Ga0256866_1036516 | Not Available | 1285 | Open in IMG/M |
3300027676|Ga0209333_1129556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
3300027725|Ga0209178_1222677 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300027842|Ga0209580_10062369 | Not Available | 1757 | Open in IMG/M |
3300027853|Ga0209274_10555936 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300027884|Ga0209275_10772864 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300027884|Ga0209275_10898917 | Not Available | 510 | Open in IMG/M |
3300028536|Ga0137415_10239867 | Not Available | 1623 | Open in IMG/M |
3300028536|Ga0137415_11409399 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300028759|Ga0302224_10034875 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
3300028776|Ga0302303_10053363 | Not Available | 1570 | Open in IMG/M |
3300028781|Ga0302223_10165103 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300029999|Ga0311339_11774676 | Not Available | 537 | Open in IMG/M |
3300030006|Ga0299907_10128901 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
3300030006|Ga0299907_10278432 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300030006|Ga0299907_11209147 | Not Available | 542 | Open in IMG/M |
3300030058|Ga0302179_10484973 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300030503|Ga0311370_10961327 | Not Available | 959 | Open in IMG/M |
3300030966|Ga0075383_11263325 | Not Available | 828 | Open in IMG/M |
3300031164|Ga0307502_10092101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
3300031229|Ga0299913_10854932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
3300031525|Ga0302326_10948937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1216 | Open in IMG/M |
3300031525|Ga0302326_12503754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
3300031561|Ga0318528_10344391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
3300031562|Ga0310886_10614966 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300031572|Ga0318515_10180345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1130 | Open in IMG/M |
3300031679|Ga0318561_10088784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1611 | Open in IMG/M |
3300031716|Ga0310813_11846391 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031718|Ga0307474_10337831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1165 | Open in IMG/M |
3300031753|Ga0307477_10152587 | Not Available | 1611 | Open in IMG/M |
3300031754|Ga0307475_11170303 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300031754|Ga0307475_11255722 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300031763|Ga0318537_10257058 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031764|Ga0318535_10330137 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300031793|Ga0318548_10491435 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300031798|Ga0318523_10240391 | Not Available | 905 | Open in IMG/M |
3300031823|Ga0307478_11201903 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300031823|Ga0307478_11228390 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300031890|Ga0306925_10354698 | Not Available | 1575 | Open in IMG/M |
3300031908|Ga0310900_11046473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
3300031939|Ga0308174_10055486 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
3300031939|Ga0308174_10199989 | Not Available | 1523 | Open in IMG/M |
3300031939|Ga0308174_10365992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Hyalangium → Hyalangium minutum | 1153 | Open in IMG/M |
3300031941|Ga0310912_10164368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1682 | Open in IMG/M |
3300031942|Ga0310916_10390279 | Not Available | 1184 | Open in IMG/M |
3300031946|Ga0310910_11310227 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300031996|Ga0308176_12762052 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300032035|Ga0310911_10106162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1545 | Open in IMG/M |
3300032060|Ga0318505_10258137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 821 | Open in IMG/M |
3300032075|Ga0310890_10274810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1198 | Open in IMG/M |
3300032076|Ga0306924_11265448 | Not Available | 794 | Open in IMG/M |
3300032091|Ga0318577_10437060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
3300032180|Ga0307471_100339000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1609 | Open in IMG/M |
3300032261|Ga0306920_101526512 | Not Available | 953 | Open in IMG/M |
3300032783|Ga0335079_11778438 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300032783|Ga0335079_12135659 | Not Available | 536 | Open in IMG/M |
3300032893|Ga0335069_10199019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2442 | Open in IMG/M |
3300032898|Ga0335072_11530680 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300032955|Ga0335076_10182720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2004 | Open in IMG/M |
3300033412|Ga0310810_10119780 | All Organisms → cellular organisms → Bacteria | 3107 | Open in IMG/M |
3300033412|Ga0310810_10805161 | Not Available | 848 | Open in IMG/M |
3300033808|Ga0314867_122000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 608 | Open in IMG/M |
3300034148|Ga0364927_0195996 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300034157|Ga0370506_014927 | Not Available | 1589 | Open in IMG/M |
3300034172|Ga0334913_024065 | Not Available | 1344 | Open in IMG/M |
3300034268|Ga0372943_0097582 | Not Available | 1722 | Open in IMG/M |
3300034268|Ga0372943_0210302 | Not Available | 1209 | Open in IMG/M |
3300034354|Ga0364943_0296430 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.67% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.38% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.43% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.43% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.43% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.43% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.95% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.48% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.48% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.48% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.48% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.48% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.48% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.48% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.48% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.48% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.48% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.48% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.48% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.48% |
Moss Associated | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Moss Associated | 0.48% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013314 | Moss microbial communities from three moss species from boreal forest in Fairbanks, Alaska, USA Reanalysis | Host-Associated | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023078 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030966 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031164 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_01234810 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | VVFEKLRRVELVDGSWKTAPNHSRPATCVVDADIDADDQPERDPQKGH |
4MG_05232280 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | KLRRVELVKGSWKTAPNIPVGTCICDADIDAEDQPEREPQKGH |
2NP_02603170 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | MGSPENWRCVVLERLQAVELLEGSWITAPNQSRPAHCIVDVDIDAEDQPERGPQNGQ |
JGI10216J12902_1082865011 | 3300000956 | Soil | VIFEKLRQVELVNDSWKTTPNHSRPATCVVEADIDAEDQPGRDPQKGH* |
JGI12712J15308_100264351 | 3300001471 | Forest Soil | VELLDAPWQTAPNHSRPASCIVDVDVDAEDYPERDPQQGQ* |
C688J18823_101451162 | 3300001686 | Soil | LSGAGKLSQVKLLEDAWHTASNQSRPASCVIDANIDAEDQAERDPQKGQ* |
JGIcombinedJ26739_1002847451 | 3300002245 | Forest Soil | LDKRSRVKLVESAWCTAPNHSRPASCVTESDIDAEDHPERDPQKGH* |
C688J35102_1196928481 | 3300002568 | Soil | VKLLEDAWHTASNQSRPASSVIDANIDAEDQAERDPQKGQ* |
JGI25617J43924_101436932 | 3300002914 | Grasslands Soil | VEKLSGVELLDGSWRTAPNHSRPASCIADADVDADDYPERNPQKGH* |
Ga0063454_1002257031 | 3300004081 | Soil | LIGVELLDGSWRTAPNHSRPASCIADADIDADDYPERDPQKGH* |
Ga0063454_1017589351 | 3300004081 | Soil | MVELLDGSWKNAPNHSRPATCVIDADIDAEDQPERDPQKGH* |
Ga0062387_1002025721 | 3300004091 | Bog Forest Soil | ALDKLRSVELLDGLWRTAPNHSRPASCILDADVDAEDYPEREPQQGQ* |
Ga0063356_1059539981 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSVVEAKVQTLEKLSQVKLLDGPGRPAPNHSRPASCVTDADIDAEDHPSRDDPQNGQ* |
Ga0066679_108519831 | 3300005176 | Soil | EKLSAVELLEGSWRTAPNHSRAASCIADADIDAEDYPERDPQKGH* |
Ga0066678_102154481 | 3300005181 | Soil | RAVELLEGSWKTAPNHSRPATCVVEADIDAEDQPERDPQKGQ* |
Ga0066388_1059239921 | 3300005332 | Tropical Forest Soil | WRCVVFEKLRRVELVNDSWRTAPNHSRPAACVVEADIDAEDQLDRDPQ* |
Ga0070680_1012552871 | 3300005336 | Corn Rhizosphere | VFEKLRRVELLDGSWKTAPNHSRPATCVVKADIDAEDQPERDPQKGQ* |
Ga0070668_1008314941 | 3300005347 | Switchgrass Rhizosphere | FEKLRRVELVNDSWRTAPNHSRPATCVIEADIDAEDQPDRDPQ* |
Ga0008090_147195062 | 3300005363 | Tropical Rainforest Soil | RVKLMDDAWRTAPNHSRPASCVVEAEIDAEDHPERDPQKGH* |
Ga0070713_1004876521 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EKFSRVKLREDAWSTAPNHSRPASCVIDADIDAEDQSVDLAPQKGQ* |
Ga0070700_1001598572 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VEVLGGSWKTAPNHSRPATCVVDADIDAEDQPERDPQKGQ* |
Ga0070708_1002284641 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KLLEDTWRTAPNHSRPASCVIDADIDAEDHPERDPQKGQ* |
Ga0070679_1012224301 | 3300005530 | Corn Rhizosphere | RTVKLLLDDGWHTAPNHSRPASCIIKPDIDAEDYPERDPQKGH* |
Ga0070735_106923042 | 3300005534 | Surface Soil | VVFEKLRRVEPVNGPWKTAPNHSCPATCVIEADIDAEDQPDADPQKGQ* |
Ga0070735_107225701 | 3300005534 | Surface Soil | WRCIALEKLRKVELLDGSWKTAPNHTRPANCIVDADIDVEDPGSHEP* |
Ga0070735_109250661 | 3300005534 | Surface Soil | VVFEKLKRVEVLSGSWQTAPNHSRPATCVVETDIDAEDQPERDPQQGH* |
Ga0068853_1015416161 | 3300005539 | Corn Rhizosphere | EKLSRVKLVEDTWRTAPNHSRPASCVAEADIDAEDHPERDPQKGQ* |
Ga0070704_1014802892 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KLRCVELVNGSWKTAPNHSRPATCVVDADIDAEDQPERDPQQGH* |
Ga0066670_107535671 | 3300005560 | Soil | VFEKLRRVELLHGAWKTAPNHSRPATCVVDAHIDAEDQPERDPQNGH* |
Ga0070762_101555881 | 3300005602 | Soil | KLSKVKLLEDAWRTAPNHSRPGSCVMESDIDIEDYPEPDPQNGH* |
Ga0070762_109805041 | 3300005602 | Soil | CTALEKFSRVKLREDAWRTAPNHSRPASCVIEAEIDAENQPDGLAPQKGQ* |
Ga0068852_1012413241 | 3300005616 | Corn Rhizosphere | FEKLRRVELVDGSWNTAPNHSRPATCVVDADIDAEDQPERDPQKGH* |
Ga0068864_1021419092 | 3300005618 | Switchgrass Rhizosphere | LEKFSRVKLREDAWRTAPNHSRPASCVIDADIDAEDQPADLPPQKGQ* |
Ga0066903_1089158912 | 3300005764 | Tropical Forest Soil | ANWRCTVLEKFSQVRLREDAWRTAPNHSRPASCVIVADIDAEDQPAGLAPQ* |
Ga0075028_1003539602 | 3300006050 | Watersheds | IALDQLGSVELLDGRWRTAPNHSRPASCIIDPDVDAEDYPVRDPQQGQ* |
Ga0075017_1013955861 | 3300006059 | Watersheds | VKLLDGRWRTAPNHSRPASCIIDPDVDAEDYPVRDPQQGQ* |
Ga0070716_1001622281 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SLLTAPNHSRPASCVIEADIDAEDQPDSVPQKGQ* |
Ga0097621_1007478832 | 3300006237 | Miscanthus Rhizosphere | KVELLDGSWKTAPNHSRPATCVVEADIDAEDQPEHTPQKGQ* |
Ga0066659_103635892 | 3300006797 | Soil | VVFEKLRRVELVQGSWKTAPNHSLPATCIVEADIDAEDQRERNPQKGQ* |
Ga0075430_1001230994 | 3300006846 | Populus Rhizosphere | VEKLSQVKLLEDTWRTAPNHSRPASCVIDADIDAEDHPGRDPQNGH* |
Ga0075433_105988162 | 3300006852 | Populus Rhizosphere | ELLNDAWRTAPNHSRPATCVVDADIDAEDQPERDPQKGH* |
Ga0075434_1009463562 | 3300006871 | Populus Rhizosphere | GSWKTAPNHSRPATCVVDADIDAEDQPERDPQQGH* |
Ga0075429_1010184482 | 3300006880 | Populus Rhizosphere | KVKVLDDAWRTAPNHSRPASCVVDADIDAEVQPEGEPQNGQ* |
Ga0068865_1015285891 | 3300006881 | Miscanthus Rhizosphere | CVVFEKLCRVELLNDSWKTAPNHSRPATCVVEADIDAEDQPEGEPQNGH* |
Ga0075426_110063651 | 3300006903 | Populus Rhizosphere | LEKFRRVKLLEGAWRTAPNHSRPASCVIDADIDAEDYPERDPQNGQ* |
Ga0075424_1009675382 | 3300006904 | Populus Rhizosphere | VELVKGSWKTAPNHSRPATCIVDADIDAEDQPEREPQKGQ* |
Ga0079219_105629132 | 3300006954 | Agricultural Soil | RRVELLNEPWRTAPNHSRPATCVVKADIDAEDQPERDPQNGH* |
Ga0079219_111862201 | 3300006954 | Agricultural Soil | NRRCVALEKLSRVKLVEDAWRTAPNHSRPASCVFEADIDAEDHPGRAPQKGH* |
Ga0075435_1012607672 | 3300007076 | Populus Rhizosphere | VFEKLRCVELVNGSWKTAPNHSRPATCVVDADIDAEDQPERDPQQGH* |
Ga0099829_109838201 | 3300009038 | Vadose Zone Soil | AVELLEGSWHTAPNHSRPASCIADADIDADDYPERDPQKGH* |
Ga0105098_107587561 | 3300009081 | Freshwater Sediment | KLSHVELLEDAWRTAPNHSRLQTCVAVADVDAEDQPAALDPQKGQ* |
Ga0105245_125380481 | 3300009098 | Miscanthus Rhizosphere | VKLLLDDGWHTAPNHSRPASCIIKPDIDAEDYPERDPQKGH* |
Ga0105243_117313221 | 3300009148 | Miscanthus Rhizosphere | KLRRVELVKGSWKTAPNHSRPATCIVDADIDAEDQPEREPQKGH* |
Ga0105243_130674392 | 3300009148 | Miscanthus Rhizosphere | IVLEKLRAVKVLNDAWRTAPNHSRPASCVVDTDIDAEDQPEGEPQNGQ* |
Ga0126374_108248961 | 3300009792 | Tropical Forest Soil | ELLHGSWQTAPNHSRPGHCIVQADIDAEDQPERDPQKGH* |
Ga0126304_106564141 | 3300010037 | Serpentine Soil | MALEKLSQVKLLDDRWRTGPNHSRPASCVVEADIDAEDQAER |
Ga0126310_117708202 | 3300010044 | Serpentine Soil | MEVERLSQVELREQDVWQTAPNHSRPATCVVKADIDAEDYPE |
Ga0126384_110916531 | 3300010046 | Tropical Forest Soil | KLRRVELLEGSWKTAPNHSRPASCVVDADIDAEDPPIR* |
Ga0126373_102732223 | 3300010048 | Tropical Forest Soil | CVALEKLSRVKLVDGDWRTAPNHSRPASCVAEADIDAEDHPERVPQKGH* |
Ga0126373_126288971 | 3300010048 | Tropical Forest Soil | MLSNVEVLNERWQTAANHSRPASCVVDPDIDAEDYPDRDPQ* |
Ga0134088_104081892 | 3300010304 | Grasslands Soil | ELLEGSWKTAPNHSRPATCIVDPDIDAEDQPERDPQTGQ* |
Ga0126370_111294732 | 3300010358 | Tropical Forest Soil | SWKTAPNHSRPATCVVEADIDAEDQPVRDPQRGQ* |
Ga0126376_114362622 | 3300010359 | Tropical Forest Soil | DAWRAAPNHSRPASCVIDADIDAEDHPAGDPQKGQ* |
Ga0126376_122094661 | 3300010359 | Tropical Forest Soil | VIFEKLKRVELVDGSWKTAPNHSRPATCVVEADIDAEDQPEREPQKGH* |
Ga0126372_119461182 | 3300010360 | Tropical Forest Soil | LRRVELVNDSWRTAPNHSRPAACVVEADIDAEDQPERTPQKGH* |
Ga0126379_123578301 | 3300010366 | Tropical Forest Soil | KLRRVELLEGSWKTAPNHSRPASCVVDADIDADDPPQG* |
Ga0126381_1005460581 | 3300010376 | Tropical Forest Soil | AAGFPSNWRCTALEKFSRVKLLEDAWRTAPNHSRPAACVIDADIDAEDHPAGNPQKGQ* |
Ga0126381_1012908702 | 3300010376 | Tropical Forest Soil | MLSNVEVLNERWQTAANHSRPASCVVDPDIDAEDYPD* |
Ga0126381_1017203961 | 3300010376 | Tropical Forest Soil | VRGITAPNHWRPGSCVPEADIDAEDHRQRDRQKGH |
Ga0126381_1021692042 | 3300010376 | Tropical Forest Soil | KPEDGAWATAPNHSRPVDCVVEADIDAEDQPQRAPQNGH* |
Ga0126383_104520312 | 3300010398 | Tropical Forest Soil | VLEKFSRVRLTEDAWRSAPNHSRPASCVIDADIDAEDQPAAAPQKGH* |
Ga0134127_122501311 | 3300010399 | Terrestrial Soil | LLNDAWRTAPNHSRPATCVVIADIDAEDQPERDPQKGH* |
Ga0150983_161103442 | 3300011120 | Forest Soil | KLLRGPWRTAPNHSRPAHCVVDVDIDAEDQPLGGPQQGQ* |
Ga0137428_10211671 | 3300011432 | Soil | LWDGSWKTAPNHSRPATCVVDADIDAEDQPERDPQKGH* |
Ga0137388_106273161 | 3300012189 | Vadose Zone Soil | ELRAVELLEGSWKTAPNHSRPASCVIEADIDAEDQPPRDPQKGQ* |
Ga0137383_108530172 | 3300012199 | Vadose Zone Soil | QDRWRTAPNHSRPASCVIDADIDAEDQPERDPQNGQ* |
Ga0137382_107947811 | 3300012200 | Vadose Zone Soil | VVLEKLNQVKLKEDAWRTAPNHFRPASCIIDADIDAEDQPEGEPQQGQ* |
Ga0137363_105851582 | 3300012202 | Vadose Zone Soil | SWRTAPNHSRPASCIADADIDAEDYPERDPQKGH* |
Ga0137363_108105512 | 3300012202 | Vadose Zone Soil | TVLDDAWRTAPNHTRPQTCIARVDVDAEDYPEHDPQNGH* |
Ga0137362_107948821 | 3300012205 | Vadose Zone Soil | LEGSWRTAPNHSRPASCIADADIDAEDYPKRDPQKGH* |
Ga0137381_104970991 | 3300012207 | Vadose Zone Soil | VEKLSTVELLEGSWRTAPNHSRPASCIADADIDAEDYPERDPQKGH* |
Ga0150985_1107771431 | 3300012212 | Avena Fatua Rhizosphere | VKLVQGAWRTAPNHLRPASCVAEADRDGEDHPERDPQKGH* |
Ga0137390_105788761 | 3300012363 | Vadose Zone Soil | RCIALDQLRGVKLLEEAWRTAPNHSRPQTCVAEVDGDAEDQPERAPQKGQ* |
Ga0137398_105889992 | 3300012683 | Vadose Zone Soil | LREDAWRTAPNHCRPASCVIEADIDAEDQPVGLAPQKGQ* |
Ga0137359_101395361 | 3300012923 | Vadose Zone Soil | LEGSWRTAPNHSRPASCIADADIDAEDYPERDPQKGH* |
Ga0137404_108509221 | 3300012929 | Vadose Zone Soil | ERFSRVTLREDAWRTAPNHFRPASCVIEADIDAEDPPVGLAPQKGQ* |
Ga0164303_101297591 | 3300012957 | Soil | KGSWKTAPNHSRPATCIVDADIDAEDQPEREPQKGH* |
Ga0164299_109606861 | 3300012958 | Soil | MEVERLSLVELCEQDVWQTAPNHSRPATCVVKADINAEDYPERDPQNGQ* |
Ga0164301_103972381 | 3300012960 | Soil | LLDGSWRSAPNHSRPASCVIEADIDAEDQPDSVPQKGQ* |
Ga0126369_123415842 | 3300012971 | Tropical Forest Soil | VALEKLRRVELLEGSWRTAPNHSRPASCVIDADIDAEDQPEQTPHKGQ* |
Ga0164307_114884101 | 3300012987 | Soil | ENWRCVVFEKLRRVELLNDVWRTAPNHSRPATCIVDADIDAEDQPERDPQKGH* |
Ga0175859_10678142 | 3300013314 | Moss Associated | MALEKLSRVKLMGGAWRTAPNHSRPTSCVAEADIDAEDHPERDPQNGH* |
Ga0120127_101584261 | 3300013503 | Permafrost | ALEELSKLKLLRGPWRTAPNHSRPTHCIVDVDIDADDQPDRDPQNGQ* |
Ga0181521_100230058 | 3300014158 | Bog | LLDGAWQTAPNHSRPASCIVEADVDAEDYPERDPQQGHRGSSPIR* |
Ga0182008_107057271 | 3300014497 | Rhizosphere | ALEKLSQVKLLEDAWHTAPNHSRPASCVVDAAMDAEDQAERDPQKGQ* |
Ga0181536_100364991 | 3300014638 | Bog | KLRSVELLDGAWQTAPNHSRPASCIVEADVDAEDYPERDPQQGHRGSSPIR* |
Ga0181522_105539871 | 3300014657 | Bog | MSLEKLSRVRVKEDVWYTAPNHSRPTSCVAEADIDAEDHPERDPQNGQ* |
Ga0157377_106048931 | 3300014745 | Miscanthus Rhizosphere | IFEKLRRVELVNDSWRTAPNHSRPTTCVIEVDIDAEDQPDRDPQ* |
Ga0137414_11882831 | 3300015051 | Vadose Zone Soil | GSPDNWRACIAVEKLSAVELLEGSWRTAPNHSRLASCIADADIDAEDYPERDPQKGH* |
Ga0182006_12274132 | 3300015261 | Rhizosphere | CVVFEKLRRVELLTGPWKTAPNHSRPATCVVDADIDAEDQPERDPQKGH* |
Ga0180121_103459471 | 3300017695 | Polar Desert Sand | NWRCIALEKLSKAKLLEDAWRTAPNHSRPASCVVDADIDAEDHVERDPQKGQ |
Ga0187807_12038301 | 3300017926 | Freshwater Sediment | WRCIALEKLRRVELVDGSWKTAPNHSRPAAGVVEADIDAEDQPERTPQKGQ |
Ga0187808_106113612 | 3300017942 | Freshwater Sediment | QRIDVASFWRKLRAVELLEGSWKTAPNHSRPATCVVEADIDAEDQPERDPQKGH |
Ga0184608_101543271 | 3300018028 | Groundwater Sediment | LSAVELLEGSWRTAPNHSRPASCIADADIDAEDYPERDPQKGQ |
Ga0184621_100954471 | 3300018054 | Groundwater Sediment | KLSAAELLKGSWHTAPNHSRPASCIVDADIDAEDYPERDPQNGH |
Ga0066655_103380642 | 3300018431 | Grasslands Soil | VKLLEDAWHTASNQSRPASCVIDADIDAEDQAERDPQKGQ |
Ga0066662_103942401 | 3300018468 | Grasslands Soil | VQLRQDAWRTAPNHSRPASCVIDADIDAEDQPGAVAPQKGH |
Ga0190270_130294952 | 3300018469 | Soil | KLLEDGWRTAPNHSRPASCVTEADIDAEDHPERDPQKGH |
Ga0137408_10179471 | 3300019789 | Vadose Zone Soil | EVLEGSWRTAPNHSRPASSASCIADADIDVEDYPERNPQKGH |
Ga0193729_12197802 | 3300019887 | Soil | LSAVELLEGSWRTAPNHSRPASCVVDADIDAEDYPERDPQKGH |
Ga0210407_104715202 | 3300020579 | Soil | LQGSWKTAPNHSRPATCVIQTDIDAEDQPERDPQKGQ |
Ga0210395_113416432 | 3300020582 | Soil | DGRWRTAPNHSRPASCIIDADVDAEDYPVRDPQQGQ |
Ga0210401_106212821 | 3300020583 | Soil | ALEKLTKVRLLEDRWRTAPNYSRPASCVVDADIDAEDQAERDPQRGQ |
Ga0210408_113045832 | 3300021178 | Soil | VELLDGSWRSAPNHSRPASCVIEADIDAEDQPDSVPQKGQ |
Ga0213882_102891722 | 3300021362 | Exposed Rock | KLSAVEPLEGPWHTAPNHSRPATCIVDPDIDAEDYADRDPQ |
Ga0213877_102792802 | 3300021372 | Bulk Soil | RVELLDGSWKTAPNHSRPATCVVDADIDAEDQPERDPQKGH |
Ga0210393_113125732 | 3300021401 | Soil | NRRCMALDKLRSVELLAGPWRTAPNHSRPASCVVDADVDAEDYPVRDPQQGQ |
Ga0210385_101598113 | 3300021402 | Soil | CTALEKFGQVKLREDAWRTAPNHSRPASCVIEADIDAEDQPDGLAPQKGQ |
Ga0210387_110018952 | 3300021405 | Soil | LDELRRVELLDGPWQTAPNHSRPAFCIVDVDVDAEDYPERDPQQGQ |
Ga0210383_104433001 | 3300021407 | Soil | SRVRLREDAWRTAPNHSRPASCVIDADIDAEDQPDGLVPQKGQ |
Ga0210384_102655151 | 3300021432 | Soil | AWRTAPNHSRPASCVIEADIDAEDQPVRLAPQKGQ |
Ga0213871_100324862 | 3300021441 | Rhizosphere | QVRPREDAWHTAPNHSRPASCVVDADIDAEDQPERDPQKGQ |
Ga0210398_115345852 | 3300021477 | Soil | LEKFSQVKLREDAWRTAPNHSRPASCVIEAEIDAEDQPDGLAPQKGQ |
Ga0213851_16881392 | 3300021860 | Watersheds | IALEELSKVKLLPGPWRTAPNHSRPAHCIVDVDIDADDQPPGDLQQGQ |
Ga0213853_107304612 | 3300021861 | Watersheds | VKLLRGPWQTAPNHSRPAHCIVDVDIDADDQPLSDPQQGQ |
Ga0247756_11035601 | 3300023078 | Plant Litter | RLLEGDWQTAPNHSRPTSCVVEADIDAEDQAERDPQNGQ |
Ga0228598_10619371 | 3300024227 | Rhizosphere | LLDGRWRTAPNHSRPASCIIDADVDAEDYPVRDPQRGQ |
Ga0247668_10600151 | 3300024331 | Soil | REDAWRTAPNHSRPASCVIDADIDAEDQPDGSAPQKGQ |
Ga0207710_105813411 | 3300025900 | Switchgrass Rhizosphere | RCVFEKLRCVELVNGSWKTAPNHSRPATCVVDADIDAEDQPERDPQQGH |
Ga0207684_114754042 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLLEGSWKTAPNHSRPASCVVDADIDAEDQPERDPQKGQ |
Ga0207652_105326901 | 3300025921 | Corn Rhizosphere | CVVFEKLRRVELVNGSWKTAPNHSRPATCVVDADIDAEDQPERDPQQGH |
Ga0207646_102581293 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LEKLSTVKLLEDTWRTAPNHSRPASCVIDADIDAEDHPERDPQKGQ |
Ga0207690_107435181 | 3300025932 | Corn Rhizosphere | LRRVELVNDSWRTAPNHSRPATCVVEVDIDAEDQPERDPQKGH |
Ga0207709_118245471 | 3300025935 | Miscanthus Rhizosphere | IVLEKLRAVKVLNDAWRTAPNHSRPASCVVDTDIDAEDQPEGEPQNGQ |
Ga0207648_100696041 | 3300026089 | Miscanthus Rhizosphere | KLRRVELVNDSWRTAPNHSRPATCVIEADIDAEDQPDREPQ |
Ga0207648_121311971 | 3300026089 | Miscanthus Rhizosphere | VVFEKLRQVELLSGSWKTAPNHSRPASCVVDADIDAEDQPERDPQNGH |
Ga0209880_10730931 | 3300026271 | Soil | LSVVKLLEGAWRTAPNHSRPASCVADADIDAEDHPERDPQNGH |
Ga0209471_12301311 | 3300026318 | Soil | VEKLSAVELLEGSWRTAPNHSRAASCIADADIDAEDYPERDPQKGH |
Ga0207775_1058492 | 3300026817 | Tropical Forest Soil | RVELVDGSWKTAPNHSRPATCVVEADIDADDQPERDPQKGH |
Ga0207582_10015912 | 3300026960 | Soil | VKLLLDDGWHTAPNHSRPASCIIKPDIDAEDYPERDPQKGH |
Ga0207722_10377462 | 3300027003 | Tropical Forest Soil | LSEVKLLEGPWQTSANHSRPSSCIVDPDIDAEDYPERDPQ |
Ga0208997_10142442 | 3300027181 | Forest Soil | CIAVEKLSAVELLEGSWRTAPNHSRPASCIADADIDAEDYPERDPQKGH |
Ga0256866_10365162 | 3300027650 | Soil | VALERLSKVKLVEGAWRTAPNHSRPASCVAETDIDAEDHPERDPQNGH |
Ga0209333_11295561 | 3300027676 | Forest Soil | LEKYSRGKLREDAWRTAPNHSRPASCVIEADIDAEDQPAGLAPQKGQ |
Ga0209178_12226772 | 3300027725 | Agricultural Soil | WRCTALEKFSRVKLLQDAWRTAPNHSRPASCVIDADIDAEDHPAGDPQKGQ |
Ga0209580_100623691 | 3300027842 | Surface Soil | DAWYTAPNHSRPASCVVEADIDAEDHPERDPQKGH |
Ga0209274_105559361 | 3300027853 | Soil | SGVRLAEGAWRTAPNHSRPGSCVADADIDAEDHPERDPQNGH |
Ga0209275_107728641 | 3300027884 | Soil | VEGAWRTAPNHSRPGSCVPDADIDAEDHPERDPQNGH |
Ga0209275_108989171 | 3300027884 | Soil | MEDAWRTAPNHSRPTSCVAEADIDAEDHQERDPQNGH |
Ga0137415_102398671 | 3300028536 | Vadose Zone Soil | NAVELLEGSWRTAPNHSRPAACIADADIDAEDYPERDPQKGH |
Ga0137415_114093992 | 3300028536 | Vadose Zone Soil | LESSWRTAPNHSRPASCIADADIDAEDYPERDPQKGH |
Ga0302224_100348753 | 3300028759 | Palsa | ALEKYSRGKLREDAWRTAPNHSRPASCVIEADIDAEDQPAGLAPQKGQ |
Ga0302303_100533632 | 3300028776 | Palsa | RLLEDVWRTAPNHLRPQACIAEADVDAEDQPDRDPQKGQ |
Ga0302223_101651032 | 3300028781 | Palsa | CTALEKYSRGKLREDAWRTAPNHSRPASCVIEADIDAEDQPAGLAPQKGQ |
Ga0311339_117746761 | 3300029999 | Palsa | VVLEKLSRVKLIEDVWRTAPNHSRPTSCVAEADIDAEDHPAGDPQNGQ |
Ga0299907_101289013 | 3300030006 | Soil | EGAWRTAPNHSRPASCVAETDIDAEDHPERDPQNGH |
Ga0299907_102784323 | 3300030006 | Soil | LSQVKFREDAWRTAPNHSRPASCVVDPDIDAEVYPEGDPQNGQ |
Ga0299907_112091471 | 3300030006 | Soil | LLDDGWHTAPNHSRPASCIIKPDIDAEDYPERDPQKGH |
Ga0302179_104849732 | 3300030058 | Palsa | AVEKLSRVKLMEGAWRTAPNHSRPTSCVAEADMDAEDHPGRDPQKGQ |
Ga0311370_109613271 | 3300030503 | Palsa | VRLVEGAWRTAPNHSRPGSCVADADIDAEDHPERDPQNGH |
Ga0075383_112633252 | 3300030966 | Soil | ALEKFSRVTLREDAWRTAPNHSRPASCVIEADIDAEDQPAGLAPQKGQ |
Ga0307502_100921012 | 3300031164 | Soil | KLQEGAWRTAPNHSRPASCVLDADIDAEDQSAGVAPQKGQ |
Ga0299913_108549322 | 3300031229 | Soil | REDAWRTAPNHSRPASCVVDPDIDAEDYPEGDPQNGQ |
Ga0302326_109489372 | 3300031525 | Palsa | RYRERCIVLEKLQAVDLLEGSWKTAPNHSRPATCVIEADIDAEDQSERNPQQGQ |
Ga0302326_125037541 | 3300031525 | Palsa | GAWRTGPNHSRPVSCIAGADIDADDYPERKPQKGH |
Ga0318528_103443911 | 3300031561 | Soil | TVLEKFSQVKLGEDLWRTAPNHSRPASCVIDADIDAEDHPARDPQKGH |
Ga0310886_106149661 | 3300031562 | Soil | CLVLEKLSKVKVLDDAWRTAPNHSRPASCVVDADIDAEVQPEGEPQNGQ |
Ga0318515_101803452 | 3300031572 | Soil | KFSQVNLSEDAWRTAPNHSRPASCVIDADIDAEDHPAREPQNGQ |
Ga0318561_100887842 | 3300031679 | Soil | ELLHGSWKTAPNHSRPATCIVDADIDAEDQPERDPQKGH |
Ga0310813_118463912 | 3300031716 | Soil | ALEKLRKVKLLHGSWQTAPNHSRPAHCIVQPDIDAEDQPERDPQKGH |
Ga0307474_103378311 | 3300031718 | Hardwood Forest Soil | IVLERLRAVELLEGSWKTAPNHSRPATCVVEADIDAEDQPERDPQKGQ |
Ga0307477_101525871 | 3300031753 | Hardwood Forest Soil | AVEPLDGSWQTAPNHSRPASCIVDPDIDAEDYPERDPQKGQRGSSPIR |
Ga0307475_111703031 | 3300031754 | Hardwood Forest Soil | AVELLEGSWKTAPNHSRPATCVIEADIDAEDQPERDPQCGQ |
Ga0307475_112557221 | 3300031754 | Hardwood Forest Soil | LRRVELLNDSWKTAPNHSRPATCVVEADIDAEDQPERDPQKGH |
Ga0318537_102570581 | 3300031763 | Soil | VILEKLRRVELLDAPWQTAPNHSRPATCVVDADIDVEDHPERDPQ |
Ga0318535_103301371 | 3300031764 | Soil | VALEKLSRVKLVEGVWRTAPNHSHPASCVTETDIDAEDHPERDPQKGH |
Ga0318548_104914351 | 3300031793 | Soil | VLEKFSRVRLREDAWRTAPNHSRPASCVIDADIDAEDQLPLTPQKGH |
Ga0318523_102403911 | 3300031798 | Soil | LVSGSWKTAPNHSRPATCIVDADIDAEDQPERDPQ |
Ga0307478_112019032 | 3300031823 | Hardwood Forest Soil | RVKLREDPWRTAPNHSRPASCVIEADIDAEDQPAGLDPQKGQ |
Ga0307478_112283901 | 3300031823 | Hardwood Forest Soil | IVLEKLRAVELLEGSWKTAPNHSRPATCVVEADIDAEDQPERDPQKGQ |
Ga0306925_103546981 | 3300031890 | Soil | RCVVLERLRAVELLEGSWKTAPNHSRPATCVVEADIDAEDQPERDPQKGQ |
Ga0310900_110464732 | 3300031908 | Soil | VLGGSWKTAPNHSRPATCVVDADIDAEDQPERDPQKGQ |
Ga0308174_100554861 | 3300031939 | Soil | EKLRRVELLNGPWKSAPNHSRPATCVVDADIDAEDHPERDPQQGH |
Ga0308174_101999891 | 3300031939 | Soil | EKLSRVKVLEASGIQPDHSRPGSCVAEPDIDAEDQPERDPQKGH |
Ga0308174_103659921 | 3300031939 | Soil | EKLRKVELLQDPWRTAPNHSRPATCVVNADIDAEDQPERDPQNGH |
Ga0310912_101643681 | 3300031941 | Soil | ANWRCTVLEKFSRVRLREDAWRTAPNHSRPASCVIDADIDAEDQLPLTPQKGH |
Ga0310916_103902791 | 3300031942 | Soil | CVALEKLSRVKLVEGVWRTAPNHSHPASCVTETDIDAEDHPERDPQKGH |
Ga0310910_113102271 | 3300031946 | Soil | EKLSRVKLVEGVWRTAPNHSHPASCVTETDIDAEDHPERDPQKGH |
Ga0308176_127620521 | 3300031996 | Soil | VIFEKLKRVELVNDSWRTAPNHSRPATCVVEADIDAEDQPDRDPQ |
Ga0310911_101061622 | 3300032035 | Soil | FFEKLRRVELVSGSWKTAPNHSRPATCIVDADIDAEDQPERDPQ |
Ga0318505_102581371 | 3300032060 | Soil | VELVSGSWKTAPNHSRPATCIVDADIDAEDQPERDPQ |
Ga0310890_102748101 | 3300032075 | Soil | SKVKVLDDAWRTAPNHSRPASCVVDADIDAEVQPEGEPQNGQ |
Ga0306924_112654482 | 3300032076 | Soil | KLSRVELLHGCWKTAPNHSRPATCIVDADIDAEDQPERDPQKGH |
Ga0318577_104370602 | 3300032091 | Soil | LLNGSWKTAPNHSRPATCVVEADIDAEDQPERDPQNGQLAIVPIR |
Ga0307471_1003390002 | 3300032180 | Hardwood Forest Soil | WRCTALEKFSRVKLLEDAWRTAPNHSRPASCVIEADIDAEDQPAGLAPQKGQ |
Ga0306920_1015265122 | 3300032261 | Soil | MALDKLSRVKLVEGAWRTAPNHSRPAFCVAEANIDAEDHPERDPQKGH |
Ga0335079_117784382 | 3300032783 | Soil | ELLGGSWKTAPNHSRPATCVVEADIDAEDQPARTPQKGQ |
Ga0335079_121356591 | 3300032783 | Soil | VKLVEDAWRTAPNHSRPASCVAEADIDAEDYPERDPQNGH |
Ga0335069_101990191 | 3300032893 | Soil | CTVVEKFSRVKLLEDVWRTAPNHSRPASCVIDADIDAEDHPAGAPQKGQ |
Ga0335072_115306801 | 3300032898 | Soil | WRCVVLEKLRKVELLDDPWQTAPNHSRPAACVVEADIDAEDHPERDPQKGQ |
Ga0335076_101827201 | 3300032955 | Soil | VALEKLSMVKLIEDGWRTAPNHSRPASCIAEADIDVEDHPERDPQKGH |
Ga0310810_101197803 | 3300033412 | Soil | QAVELLEGSWITAPNHSRPAHCIVDVDIDAEDQPERGPQNGQ |
Ga0310810_108051612 | 3300033412 | Soil | KLRKVKLLHGSWQTAPNHSRPAHCIVQADIDAEDQPERDPQKGH |
Ga0314867_122000_360_473 | 3300033808 | Peatland | VEDAWRTAPNHSRPAACVAEADIDAEDHPERVPQKGH |
Ga0364927_0195996_476_592 | 3300034148 | Sediment | LLDGSWKTAPNHSRPATCVVDADIDAEDQPERDPQKGH |
Ga0370506_014927_1467_1589 | 3300034157 | Untreated Peat Soil | VELVDGSWKTAPNHSRPATCIMEADIDAEDQPERDPQCGQ |
Ga0334913_024065_1_126 | 3300034172 | Sub-Biocrust Soil | VNLLLDDAWRTAPNHLRPASCIVKPDIDAEDYPERDPQKGH |
Ga0372943_0097582_1566_1721 | 3300034268 | Soil | WRCIAVEKLSSVELLEDLWRTAPNHSRPASCIVDADIDAEDYPERDPQKGH |
Ga0372943_0210302_29_178 | 3300034268 | Soil | MEVERLSVVELCEQDVWRTAPNHSCPATCVVKADIDAEDYPERDPQNGQ |
Ga0364943_0296430_4_150 | 3300034354 | Sediment | VVFEKLRRVELAKGSWKTAPNHSRPATCIVDADIDAEDQPESVPQKGQ |
⦗Top⦘ |