| Basic Information | |
|---|---|
| Family ID | F023316 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 210 |
| Average Sequence Length | 47 residues |
| Representative Sequence | CAMHLAALQAYRPRKVVVRKTADRPAATVCVGTTCSLPVATPEALRDLLR |
| Number of Associated Samples | 162 |
| Number of Associated Scaffolds | 210 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.67 % |
| % of genes near scaffold ends (potentially truncated) | 90.48 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.952 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.238 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.08% β-sheet: 20.51% Coil/Unstructured: 56.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 210 Family Scaffolds |
|---|---|---|
| PF00248 | Aldo_ket_red | 52.38 |
| PF00160 | Pro_isomerase | 37.62 |
| PF11138 | DUF2911 | 6.19 |
| PF13231 | PMT_2 | 1.43 |
| PF13537 | GATase_7 | 0.95 |
| PF07221 | GlcNAc_2-epim | 0.48 |
| PF12867 | DinB_2 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
|---|---|---|---|
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 37.62 |
| COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.29 % |
| Unclassified | root | N/A | 15.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001116|JGI12627J13344_103585 | All Organisms → cellular organisms → Archaea | 702 | Open in IMG/M |
| 3300002558|JGI25385J37094_10177958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
| 3300002560|JGI25383J37093_10004863 | All Organisms → cellular organisms → Bacteria | 4205 | Open in IMG/M |
| 3300002560|JGI25383J37093_10110420 | Not Available | 788 | Open in IMG/M |
| 3300002561|JGI25384J37096_10010884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3462 | Open in IMG/M |
| 3300002561|JGI25384J37096_10023667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2393 | Open in IMG/M |
| 3300002561|JGI25384J37096_10075521 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300002562|JGI25382J37095_10022531 | All Organisms → cellular organisms → Bacteria → FCB group | 2450 | Open in IMG/M |
| 3300002562|JGI25382J37095_10235932 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300002908|JGI25382J43887_10013281 | All Organisms → cellular organisms → Bacteria | 4258 | Open in IMG/M |
| 3300002908|JGI25382J43887_10081910 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300002911|JGI25390J43892_10070174 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300002912|JGI25386J43895_10025485 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1741 | Open in IMG/M |
| 3300002912|JGI25386J43895_10109966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
| 3300005172|Ga0066683_10201674 | All Organisms → cellular organisms → Archaea | 1228 | Open in IMG/M |
| 3300005172|Ga0066683_10220722 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300005174|Ga0066680_10008955 | All Organisms → cellular organisms → Bacteria | 5038 | Open in IMG/M |
| 3300005175|Ga0066673_10185849 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300005180|Ga0066685_10144597 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300005180|Ga0066685_10693570 | Not Available | 699 | Open in IMG/M |
| 3300005183|Ga0068993_10012950 | All Organisms → cellular organisms → Bacteria → FCB group | 1942 | Open in IMG/M |
| 3300005406|Ga0070703_10287854 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005436|Ga0070713_101835653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300005444|Ga0070694_101277657 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005447|Ga0066689_10426375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300005450|Ga0066682_10697364 | Not Available | 624 | Open in IMG/M |
| 3300005468|Ga0070707_101090309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 764 | Open in IMG/M |
| 3300005468|Ga0070707_101723971 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
| 3300005471|Ga0070698_100912133 | Not Available | 824 | Open in IMG/M |
| 3300005518|Ga0070699_100373001 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300005518|Ga0070699_101458542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 627 | Open in IMG/M |
| 3300005526|Ga0073909_10372987 | All Organisms → cellular organisms → Archaea | 666 | Open in IMG/M |
| 3300005536|Ga0070697_100425912 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005549|Ga0070704_100577341 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005556|Ga0066707_10883655 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005558|Ga0066698_10413524 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005558|Ga0066698_11088701 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005566|Ga0066693_10083136 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 1130 | Open in IMG/M |
| 3300005598|Ga0066706_11047740 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 626 | Open in IMG/M |
| 3300006032|Ga0066696_10440295 | Not Available | 853 | Open in IMG/M |
| 3300006034|Ga0066656_10077764 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300006034|Ga0066656_10456809 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006034|Ga0066656_10579785 | Not Available | 727 | Open in IMG/M |
| 3300006755|Ga0079222_10058027 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300006796|Ga0066665_10043876 | All Organisms → cellular organisms → Bacteria | 3035 | Open in IMG/M |
| 3300006796|Ga0066665_10127504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1905 | Open in IMG/M |
| 3300006797|Ga0066659_11244328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300006847|Ga0075431_101894590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300006852|Ga0075433_10281656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1473 | Open in IMG/M |
| 3300006852|Ga0075433_11509210 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006854|Ga0075425_100342041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1722 | Open in IMG/M |
| 3300006871|Ga0075434_100631422 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300006894|Ga0079215_11015615 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
| 3300006903|Ga0075426_10504016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 899 | Open in IMG/M |
| 3300006903|Ga0075426_10893858 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 670 | Open in IMG/M |
| 3300006904|Ga0075424_101742012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 659 | Open in IMG/M |
| 3300007004|Ga0079218_13397028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300009012|Ga0066710_100253138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2549 | Open in IMG/M |
| 3300009012|Ga0066710_101089824 | Not Available | 1235 | Open in IMG/M |
| 3300009012|Ga0066710_101097515 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300009012|Ga0066710_104351664 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_67_11 | 529 | Open in IMG/M |
| 3300009088|Ga0099830_10138706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1859 | Open in IMG/M |
| 3300009137|Ga0066709_100131007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3159 | Open in IMG/M |
| 3300009137|Ga0066709_104178775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300009137|Ga0066709_104225202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300009162|Ga0075423_10414993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1413 | Open in IMG/M |
| 3300009162|Ga0075423_12541654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
| 3300009610|Ga0105340_1089637 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300009802|Ga0105073_1036068 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
| 3300010047|Ga0126382_10167613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1525 | Open in IMG/M |
| 3300010134|Ga0127484_1073081 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300010301|Ga0134070_10416597 | Not Available | 532 | Open in IMG/M |
| 3300010303|Ga0134082_10365623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300010320|Ga0134109_10210578 | Not Available | 721 | Open in IMG/M |
| 3300010323|Ga0134086_10033934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1691 | Open in IMG/M |
| 3300010323|Ga0134086_10372437 | Not Available | 569 | Open in IMG/M |
| 3300010325|Ga0134064_10020653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1861 | Open in IMG/M |
| 3300010326|Ga0134065_10105831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 940 | Open in IMG/M |
| 3300010326|Ga0134065_10357137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 575 | Open in IMG/M |
| 3300010329|Ga0134111_10351666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
| 3300010335|Ga0134063_10339242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 728 | Open in IMG/M |
| 3300010336|Ga0134071_10031398 | All Organisms → cellular organisms → Bacteria → FCB group | 2321 | Open in IMG/M |
| 3300010403|Ga0134123_10642782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1027 | Open in IMG/M |
| 3300011271|Ga0137393_10156933 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1904 | Open in IMG/M |
| 3300011434|Ga0137464_1138861 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300011443|Ga0137457_1021715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1688 | Open in IMG/M |
| 3300012096|Ga0137389_10135730 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_67_11 | 1999 | Open in IMG/M |
| 3300012096|Ga0137389_11802874 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
| 3300012171|Ga0137342_1063571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 761 | Open in IMG/M |
| 3300012179|Ga0137334_1139336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 549 | Open in IMG/M |
| 3300012198|Ga0137364_10716840 | Not Available | 755 | Open in IMG/M |
| 3300012199|Ga0137383_10029335 | All Organisms → cellular organisms → Bacteria | 3854 | Open in IMG/M |
| 3300012199|Ga0137383_10331746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 1114 | Open in IMG/M |
| 3300012201|Ga0137365_10276680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1246 | Open in IMG/M |
| 3300012201|Ga0137365_10355691 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1082 | Open in IMG/M |
| 3300012201|Ga0137365_10416418 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 991 | Open in IMG/M |
| 3300012202|Ga0137363_10054360 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
| 3300012206|Ga0137380_11156906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 658 | Open in IMG/M |
| 3300012207|Ga0137381_11239078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 639 | Open in IMG/M |
| 3300012208|Ga0137376_10119932 | All Organisms → cellular organisms → Bacteria → FCB group | 2243 | Open in IMG/M |
| 3300012209|Ga0137379_10209550 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300012210|Ga0137378_10186461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1930 | Open in IMG/M |
| 3300012285|Ga0137370_10170305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1267 | Open in IMG/M |
| 3300012349|Ga0137387_10548673 | All Organisms → cellular organisms → Bacteria → FCB group | 838 | Open in IMG/M |
| 3300012349|Ga0137387_10667004 | Not Available | 753 | Open in IMG/M |
| 3300012349|Ga0137387_11092197 | Not Available | 568 | Open in IMG/M |
| 3300012351|Ga0137386_11106091 | Not Available | 559 | Open in IMG/M |
| 3300012353|Ga0137367_10043399 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3412 | Open in IMG/M |
| 3300012357|Ga0137384_10580345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 916 | Open in IMG/M |
| 3300012357|Ga0137384_10748703 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 792 | Open in IMG/M |
| 3300012358|Ga0137368_10322461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1037 | Open in IMG/M |
| 3300012360|Ga0137375_10100769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2942 | Open in IMG/M |
| 3300012361|Ga0137360_10781924 | Not Available | 821 | Open in IMG/M |
| 3300012363|Ga0137390_11007316 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 785 | Open in IMG/M |
| 3300012532|Ga0137373_10413241 | Not Available | 1045 | Open in IMG/M |
| 3300012685|Ga0137397_10197102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1497 | Open in IMG/M |
| 3300012922|Ga0137394_10641061 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 897 | Open in IMG/M |
| 3300012923|Ga0137359_11069088 | Not Available | 691 | Open in IMG/M |
| 3300012925|Ga0137419_11118821 | Not Available | 657 | Open in IMG/M |
| 3300012927|Ga0137416_10095289 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2225 | Open in IMG/M |
| 3300012927|Ga0137416_10529804 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1018 | Open in IMG/M |
| 3300012930|Ga0137407_10064762 | All Organisms → cellular organisms → Bacteria | 3021 | Open in IMG/M |
| 3300012948|Ga0126375_11788539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
| 3300012972|Ga0134077_10014732 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2612 | Open in IMG/M |
| 3300012972|Ga0134077_10053580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1493 | Open in IMG/M |
| 3300012972|Ga0134077_10098294 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1131 | Open in IMG/M |
| 3300012976|Ga0134076_10048410 | Not Available | 1598 | Open in IMG/M |
| 3300012976|Ga0134076_10467717 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300014157|Ga0134078_10659564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
| 3300014885|Ga0180063_1098224 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 892 | Open in IMG/M |
| 3300015052|Ga0137411_1326952 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5263 | Open in IMG/M |
| 3300015241|Ga0137418_10007551 | All Organisms → cellular organisms → Bacteria | 9993 | Open in IMG/M |
| 3300015241|Ga0137418_10432692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1066 | Open in IMG/M |
| 3300015245|Ga0137409_10223291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1686 | Open in IMG/M |
| 3300015256|Ga0180073_1084925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300015356|Ga0134073_10005254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2730 | Open in IMG/M |
| 3300015358|Ga0134089_10019297 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2310 | Open in IMG/M |
| 3300015358|Ga0134089_10078648 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1240 | Open in IMG/M |
| 3300015359|Ga0134085_10288266 | Not Available | 720 | Open in IMG/M |
| 3300015372|Ga0132256_100302458 | Not Available | 1684 | Open in IMG/M |
| 3300017654|Ga0134069_1026938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1750 | Open in IMG/M |
| 3300017654|Ga0134069_1105886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 919 | Open in IMG/M |
| 3300017654|Ga0134069_1179296 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 717 | Open in IMG/M |
| 3300017656|Ga0134112_10375168 | Not Available | 584 | Open in IMG/M |
| 3300017657|Ga0134074_1018853 | Not Available | 2266 | Open in IMG/M |
| 3300018028|Ga0184608_10253733 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 774 | Open in IMG/M |
| 3300018056|Ga0184623_10418430 | Not Available | 586 | Open in IMG/M |
| 3300018064|Ga0187773_10019272 | All Organisms → cellular organisms → Bacteria | 2911 | Open in IMG/M |
| 3300018071|Ga0184618_10327456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300018482|Ga0066669_10888838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 796 | Open in IMG/M |
| 3300020004|Ga0193755_1135337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 759 | Open in IMG/M |
| 3300021051|Ga0206224_1015636 | Not Available | 872 | Open in IMG/M |
| 3300021080|Ga0210382_10090031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1266 | Open in IMG/M |
| 3300021080|Ga0210382_10523045 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 525 | Open in IMG/M |
| 3300021510|Ga0222621_1099901 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 615 | Open in IMG/M |
| 3300022204|Ga0224496_10108871 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1203 | Open in IMG/M |
| 3300024317|Ga0247660_1001806 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2890 | Open in IMG/M |
| 3300024330|Ga0137417_1190028 | Not Available | 1108 | Open in IMG/M |
| 3300025165|Ga0209108_10217473 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 982 | Open in IMG/M |
| 3300025327|Ga0209751_10274893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1426 | Open in IMG/M |
| 3300025910|Ga0207684_11486699 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300025910|Ga0207684_11734207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300025917|Ga0207660_10079540 | All Organisms → cellular organisms → Bacteria | 2405 | Open in IMG/M |
| 3300026075|Ga0207708_10187993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1643 | Open in IMG/M |
| 3300026277|Ga0209350_1081152 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 871 | Open in IMG/M |
| 3300026295|Ga0209234_1204313 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
| 3300026295|Ga0209234_1228873 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300026296|Ga0209235_1018387 | All Organisms → cellular organisms → Bacteria | 3770 | Open in IMG/M |
| 3300026296|Ga0209235_1042882 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300026298|Ga0209236_1237941 | Not Available | 612 | Open in IMG/M |
| 3300026301|Ga0209238_1051030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1487 | Open in IMG/M |
| 3300026310|Ga0209239_1203247 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 710 | Open in IMG/M |
| 3300026313|Ga0209761_1134258 | All Organisms → cellular organisms → Bacteria → FCB group | 1186 | Open in IMG/M |
| 3300026314|Ga0209268_1042464 | All Organisms → cellular organisms → Bacteria → FCB group | 1487 | Open in IMG/M |
| 3300026314|Ga0209268_1184669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
| 3300026323|Ga0209472_1000575 | All Organisms → cellular organisms → Bacteria | 21685 | Open in IMG/M |
| 3300026325|Ga0209152_10226064 | Not Available | 699 | Open in IMG/M |
| 3300026327|Ga0209266_1130938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1050 | Open in IMG/M |
| 3300026327|Ga0209266_1241611 | Not Available | 589 | Open in IMG/M |
| 3300026328|Ga0209802_1052667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2004 | Open in IMG/M |
| 3300026329|Ga0209375_1296294 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300026330|Ga0209473_1023705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2841 | Open in IMG/M |
| 3300026333|Ga0209158_1316738 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
| 3300026523|Ga0209808_1081487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1395 | Open in IMG/M |
| 3300026527|Ga0209059_1259275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 584 | Open in IMG/M |
| 3300026532|Ga0209160_1188255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 836 | Open in IMG/M |
| 3300026536|Ga0209058_1066061 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300026536|Ga0209058_1112872 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300026538|Ga0209056_10059003 | All Organisms → cellular organisms → Bacteria | 3370 | Open in IMG/M |
| 3300026538|Ga0209056_10059505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3353 | Open in IMG/M |
| 3300026540|Ga0209376_1102902 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300026548|Ga0209161_10328580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 702 | Open in IMG/M |
| 3300026751|Ga0207594_103153 | Not Available | 678 | Open in IMG/M |
| 3300027655|Ga0209388_1090932 | Not Available | 877 | Open in IMG/M |
| 3300027725|Ga0209178_1000533 | All Organisms → cellular organisms → Bacteria | 11248 | Open in IMG/M |
| 3300027765|Ga0209073_10159203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 838 | Open in IMG/M |
| 3300027775|Ga0209177_10029428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1431 | Open in IMG/M |
| 3300027775|Ga0209177_10169730 | Not Available | 755 | Open in IMG/M |
| 3300027787|Ga0209074_10126907 | All Organisms → cellular organisms → Bacteria → FCB group | 893 | Open in IMG/M |
| 3300027846|Ga0209180_10110953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1568 | Open in IMG/M |
| 3300027875|Ga0209283_10681912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 644 | Open in IMG/M |
| 3300027886|Ga0209486_10316373 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 923 | Open in IMG/M |
| 3300028814|Ga0307302_10082118 | Not Available | 1527 | Open in IMG/M |
| 3300028884|Ga0307308_10027999 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
| 3300031962|Ga0307479_10592477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1091 | Open in IMG/M |
| 3300032179|Ga0310889_10528154 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 601 | Open in IMG/M |
| 3300032180|Ga0307471_102156934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 701 | Open in IMG/M |
| 3300032782|Ga0335082_10317239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1430 | Open in IMG/M |
| 3300033814|Ga0364930_0302988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
| 3300033815|Ga0364946_102334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 637 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.29% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.95% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.48% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.48% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.48% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.48% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.48% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001116 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026751 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J13344_1035853 | 3300001116 | Forest Soil | RKVVVRKTAEAPAATVCVGTTCSLPVATPEKLAALLHS* |
| JGI25385J37094_101779582 | 3300002558 | Grasslands Soil | GPACDMHLEALRTYRPRKVVVRRVAERPAATVCVGTTCSLPVAERDALAKLLR* |
| JGI25383J37093_100048636 | 3300002560 | Grasslands Soil | GPACAMHLLALQTYRPRTVIIRKITAAPNATVCVGTSCSLPVSTPEKLAELLEQ* |
| JGI25383J37093_101104202 | 3300002560 | Grasslands Soil | DGPACAMHLLALQTYRPRKIVVRKIDARPAATVCVGTSCSMPVATREQLAGLLEA* |
| JGI25384J37096_100108845 | 3300002561 | Grasslands Soil | PRGQGPACDMHLLALQTYRPRKVVXRKTAERPAAPXATVCVGTTCSLPVATPEALGDLLR |
| JGI25384J37096_100236671 | 3300002561 | Grasslands Soil | CDMHLVALQTYRPRKVVVRRIAERSAATVCVGTTCSLPVATPEELRGLLP* |
| JGI25384J37096_100755214 | 3300002561 | Grasslands Soil | LALQTYRPRKIVVRKVAERPAATVCVGTTCSLPVATPEQLTGLLVA* |
| JGI25382J37095_100225311 | 3300002562 | Grasslands Soil | ACDMHLLALQTYRPRKLVVRKTAERPSATVCVGTACSLPVTTREALGDLLR* |
| JGI25382J37095_102359321 | 3300002562 | Grasslands Soil | MHLVALQTYRPRKVVVRRIAERSAATVCVGTTCSLPVATPEELRGLLP* |
| JGI25382J43887_100132817 | 3300002908 | Grasslands Soil | YRPRTVIIRKITAAPNATVCVGTSCSLPVSTPEKLAELLEQ* |
| JGI25382J43887_100819104 | 3300002908 | Grasslands Soil | YRPRKVVVRRIAARPAATVCVGTTCSLPVASPAELRELLR* |
| JGI25390J43892_100701742 | 3300002911 | Grasslands Soil | GAGAACAMHLAALEAYRPRKVVVRKTADRPAATVCVGTTCSLPIATPEALRDLLR* |
| JGI25386J43895_100254854 | 3300002912 | Grasslands Soil | CAMHLAALQAYRPRKVVVRKTADRPAATVCVGTTCSLPVATPEALRDLLR* |
| JGI25386J43895_101099661 | 3300002912 | Grasslands Soil | GEGAACAMHLVALQAYRPRAVVVRKTADRPAATVCVGTTCSLPVATPEALRDLLR* |
| Ga0066683_102016741 | 3300005172 | Soil | YRPRTVVLRKTADRPTATVCVGTTCSLPVATPEALRDLLR* |
| Ga0066683_102207221 | 3300005172 | Soil | PACDMHLLALRTYRPRKVVVRRPGERPAATVCVGTTCSLPVAAPAALAELLR* |
| Ga0066680_100089556 | 3300005174 | Soil | AACTMHLVGLQAYRPRTVVLRKTADRPTATVCVGTTCSLPVATPEALRDLLR* |
| Ga0066673_101858493 | 3300005175 | Soil | GPACAMHLLALQRYRPRKVVIRKLADRPAATVCIGTSCSLPVTTREALARLLER* |
| Ga0066685_101445971 | 3300005180 | Soil | ACDMHLLALETYRPRKVVIRKTAETPAATVCVGTTCALPVTAPDALRALLG* |
| Ga0066685_106935703 | 3300005180 | Soil | RPRKVVIRKTAERPAATVCVGTTCSLPVATTADLKPLLT* |
| Ga0068993_100129501 | 3300005183 | Natural And Restored Wetlands | AMHLLALQTLRPRTVVVRTTADAPAATVCIGTTCSLPVGTRDALAELLA* |
| Ga0070703_102878542 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LLALQRYRPRKIVIRKTADGPAATVCVGTTCSLPVATPEALGTLLS* |
| Ga0070713_1018356532 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LALQRYRPRKIVIRKTADGPAATVCVGTTCSLPVATPEALGTLLS* |
| Ga0070694_1012776572 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ACAMHLLALQAYRPRKVVVRKTATAPSATVCVGTSCSLPVAAPDRLTELLA* |
| Ga0066689_104263751 | 3300005447 | Soil | GAACAMHLVALQAYRPRAVVVRKTADRPAATVCVGTTCSLPVATPEALRDLLR* |
| Ga0066682_106973641 | 3300005450 | Soil | HLLALQAYRPRKVVIRKTAQRPAATLCVGTTCSLPVATTADLKPLLT* |
| Ga0070707_1010903092 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RGEGAACDMHLLALQSYRPRKLVVRKTAERPAATVCIGTTCSLPVTTPEALGDLLR* |
| Ga0070707_1017239712 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AACDMHLLALQTYRPRKLVVRKTAERPSATVCVGTACSLPVTTREALGDLLR* |
| Ga0070698_1009121332 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VALQAYRPRKIVIRKTADQPAATVCVGTTCSLPVATPEALANLLR* |
| Ga0070699_1003730011 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LQTYRPRKLVVRKTAERPSATVCVGTTCSLPVTTREALGDLLR* |
| Ga0070699_1014585421 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SALQAYRPRKVVVRKTAEQPAATVCVGTTCSLPVRSPEALGDLLR* |
| Ga0073909_103729872 | 3300005526 | Surface Soil | LQEYRPRKAVVRSTADTPAATVCVGTSCSLPVATPEKLKELLHS* |
| Ga0070697_1004259122 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | CDMHLLALQTYRPRRLVIRRTAERPAATVCVGTTCSLPVPTPEALRALLG* |
| Ga0070704_1005773412 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RKAVVRNIVPGEANAIVCVGTSCSLPVATPEKFAELLEA* |
| Ga0066707_108836552 | 3300005556 | Soil | PRGAGAACAMHLAALQAYRPRKVVVRKTADRPAATVCVGTTCSLPIATPEALRDLLR* |
| Ga0066698_104135241 | 3300005558 | Soil | QTYRPRKVVIRKTAETPAATVCVGTTCALPVTAPDALRALLG* |
| Ga0066698_110887012 | 3300005558 | Soil | MHLLALQTYRPRKVVVRKTAARPAATVCIGTTCSLPVTTPEALGDLLR* |
| Ga0066693_100831363 | 3300005566 | Soil | YRPRKVVIRKTAERHAATVCVGTTCSLPVATAAALKPLVS* |
| Ga0066706_110477402 | 3300005598 | Soil | YRPRTVIIRKIGAAPSATVCVGTSCSLPVPTPEKLAELLEQ* |
| Ga0066696_104402951 | 3300006032 | Soil | VALQAYRPRKIVIRRSADQPAATVCVGTTCALPVATPEALTNLLR* |
| Ga0066656_100777641 | 3300006034 | Soil | MHLVGLQAYRPRTVVLRKTADRPTATVCVGTTCSLPVATPEALRDLLR* |
| Ga0066656_104568091 | 3300006034 | Soil | CDMHLLALQTYRPRKVVVRKTAERPAAPSAIVCVGTTCSLPVTTPEALGDLLR* |
| Ga0066656_105797853 | 3300006034 | Soil | LALQTYRPRKVVVRKLAERPAATVCVGTSCSLPVSTPEQLATLLEA* |
| Ga0079222_100580271 | 3300006755 | Agricultural Soil | MHLRALQTYRPRRVVIRTIAPQPAATVCVGTTCSLPVSTPTALAELLR* |
| Ga0066665_100438761 | 3300006796 | Soil | IRKITAAPNATVYVGTACSLPVSTPEKLAALLEQ* |
| Ga0066665_101275044 | 3300006796 | Soil | GGAGCDMHLVALQTYRPRKVVVRRIAERSAATVCVGTTCSLPVATPEELRGLLP* |
| Ga0066659_112443281 | 3300006797 | Soil | LQTYRPRKLVVRRTAERPAATVCVGTTCSVPVTTPEALGDLLR* |
| Ga0075431_1018945902 | 3300006847 | Populus Rhizosphere | QAYRPRTIVVRTIADRPAATVCVGTTCSLPVDTPEKLAGLLE* |
| Ga0075433_102816561 | 3300006852 | Populus Rhizosphere | YRPRKVVVRKIATAPAATVCVGTTCSLPVPTPDALAQLLA* |
| Ga0075433_115092102 | 3300006852 | Populus Rhizosphere | LQVYRPRKVVVRTIAERPSATVCVGTTCSLPVTTPDALRALLG* |
| Ga0075425_1003420411 | 3300006854 | Populus Rhizosphere | CAMHLLTLQRFRPRKVVVRRIADAPQATVCVGTTCSLPVDRPEQLEALLA* |
| Ga0075434_1006314223 | 3300006871 | Populus Rhizosphere | TYRPRKAVVRNIVPGDAEAIVCVGTSCSLPVATPEKFTELLEA* |
| Ga0079215_110156151 | 3300006894 | Agricultural Soil | RGEGPACAMHLVALQAYRPRRVVVRKTADKPAATVCVGTSCSLPVATPEKLGELLA* |
| Ga0075426_105040162 | 3300006903 | Populus Rhizosphere | LRALQAYRPRKVVVRKTAEQPAGTVCVGTTCSLPVKTPEALGDLLR* |
| Ga0075426_108938581 | 3300006903 | Populus Rhizosphere | ALQTYRPRRVVIRTIAPAPQATVCVGTTCSLPVAEPAALAALLT* |
| Ga0075424_1017420121 | 3300006904 | Populus Rhizosphere | ALQTYRPRKVVVRKIAVAPAATVCVGTSCSLPVSTPDALALLLA* |
| Ga0079218_133970281 | 3300007004 | Agricultural Soil | KVVLRKIADRPAATVCVGTTCSLPVETPEKLAALLAQ* |
| Ga0066710_1002531381 | 3300009012 | Grasslands Soil | CAMHLLALQTYRPRKVVIRRVAEAPAATVCVGTACSLPVASPERLAELLA |
| Ga0066710_1010898241 | 3300009012 | Grasslands Soil | LLALQTYRPRKIVIRKTADQPAATVCVGTTCSLPVATPEGLAHLLG |
| Ga0066710_1010975153 | 3300009012 | Grasslands Soil | YRPRTVVLRKTADRPTATVCVGTTCSLPVATPEALRDLLR |
| Ga0066710_1043516641 | 3300009012 | Grasslands Soil | TYRPRKIVVRKVAERPAATVCVGTSCSLPVSTAEQLAGLLEG |
| Ga0099830_101387064 | 3300009088 | Vadose Zone Soil | LRALQAYRPRKVVVRKTAEQPAATVCLGTTCSLPVSTAGALRDLLR* |
| Ga0066709_1001310071 | 3300009137 | Grasslands Soil | MHLLALQTYRPRKVVIRRVAEAPAATVCVGTACSLPVASPERLAELLA* |
| Ga0066709_1041787751 | 3300009137 | Grasslands Soil | AACAMHMLALQTYRPRKIVIRKTADQPAATVCVGTTCSLPVATPEGLAHLLG* |
| Ga0066709_1042252021 | 3300009137 | Grasslands Soil | PACDMHFRALQAYRPRKLVVRKTAERPAATVCVGTACSLPVTTPEALRDLLQ* |
| Ga0075423_104149933 | 3300009162 | Populus Rhizosphere | GPTGEGPACAMHLLALQTYRPRKVVVRKIADRPAATVCVGTTCSLPVATAEELAKLLEP* |
| Ga0075423_125416541 | 3300009162 | Populus Rhizosphere | RVVIRTIAPQPAATVCVGTTCSLPVAEPAQLAELLK* |
| Ga0105340_10896371 | 3300009610 | Soil | GPACDMHLLALQTYRPRKVVVRKEAAQPAAVVCVGTTCSLPVTTPAALSEMMR* |
| Ga0105073_10360681 | 3300009802 | Groundwater Sand | MHLLALQAYRPRKVVVRKTAERPTATVCVGTTCSLPVTTPEALGDLVR* |
| Ga0126382_101676131 | 3300010047 | Tropical Forest Soil | MQHLRPRKVVVRRIADTPQATVCVGTTCSLPVSLPEQLEALFNSNVET* |
| Ga0127484_10730812 | 3300010134 | Grasslands Soil | VFRPRKVVVRKVADRPAATVCVGTTCSLPVTTPDALRELLT* |
| Ga0134070_104165972 | 3300010301 | Grasslands Soil | VVVRKIAERPAATVCIGTSCSLPVTTPEQLATLLEA* |
| Ga0134082_103656231 | 3300010303 | Grasslands Soil | MHLRALQAYRPRKVVVRKTAQQPAATVCVGTTCSLPVRTPEALGDLLR* |
| Ga0134109_102105781 | 3300010320 | Grasslands Soil | PRKVVIRKTAAQPAATVCVGTTCALPVAAPDDLRKLLI* |
| Ga0134086_100339343 | 3300010323 | Grasslands Soil | MHLLALRTYRPRKVVVRRPGERPAATVCVGTTCSLPVAAPAALAELLR* |
| Ga0134086_103724371 | 3300010323 | Grasslands Soil | LQTYRPRKVVVREIAEQPAAVVCVGTTCSLPVATAAALADLLR* |
| Ga0134064_100206531 | 3300010325 | Grasslands Soil | GPRGTGGRAACDMHLLALQTYRPRKLVVRKTAERPAATVCVGTTCSLPVTTPESLRALLG |
| Ga0134065_101058313 | 3300010326 | Grasslands Soil | PRGEGPACAMHLLALQTYRPRKVVIRKTAERPAATVCVGTTCSLPVAIAAELRTLLT* |
| Ga0134065_103571372 | 3300010326 | Grasslands Soil | VVRKIADRPAATVCVGTSCSLPVATPGELAKLVEA* |
| Ga0134111_103516662 | 3300010329 | Grasslands Soil | MHLLALQAYRPRKVVLRKTADQAASTVCVGTTCSLPVATPAALGELLK* |
| Ga0134063_103392422 | 3300010335 | Grasslands Soil | MHLLALQTYRPRKLVVRRSAERPAATVCVGTTCSVPVTTPEALGDLLR* |
| Ga0134071_100313985 | 3300010336 | Grasslands Soil | GPRGEGGGAACAMHLAALQAYRPRKIVIRRSVDQPAATVCVGTTCSLPVATPEALANLLR |
| Ga0134123_106427822 | 3300010403 | Terrestrial Soil | GEGPACAMHLLALQTSRPRKVVVRKVADAPAATVCVGTTCSLPVNAPDALATLLA* |
| Ga0137393_101569331 | 3300011271 | Vadose Zone Soil | GGEGPACAMHLRALQAYRPRKVVVRALGERATATVCVGPTCALPVSTPEALGDLLR* |
| Ga0137464_11388611 | 3300011434 | Soil | KVVIRKIADAPAATVCVDTTCSLPVATPEQLAALLAQ* |
| Ga0137457_10217154 | 3300011443 | Soil | CDMHLLAHQTYRPRKEVVRKEAAQPAAVVCVGTTCSLPVTTPAALSEMMR* |
| Ga0137389_101357304 | 3300012096 | Vadose Zone Soil | RGDGPACAMHLLALQTYRPRKIVVRKVAERPAATVCVGTSCSLPVSTAEQLAGLLEG* |
| Ga0137389_118028741 | 3300012096 | Vadose Zone Soil | RRVVIRTIAPQPAATVCVGTTCSLPVSGPAALAELLR* |
| Ga0137342_10635711 | 3300012171 | Soil | RPRQVVVRTRAAAPAATVCVGTTCSLPVAAPSELADLLA* |
| Ga0137334_11393361 | 3300012179 | Soil | LQTYRPRKVVIRKIADAPAATVCVDTTCSLPVATPEQLAALLAQ* |
| Ga0137364_107168402 | 3300012198 | Vadose Zone Soil | MHLLALQTYRPRKVVVRAIAAAPAATVCVGTTCSMPVSTREQLARLLEA* |
| Ga0137383_100293351 | 3300012199 | Vadose Zone Soil | PGAACDMHLLALQAYRPRKIVIRATADRPGATVCVGTTCSLPVATPDALRALLS* |
| Ga0137383_103317461 | 3300012199 | Vadose Zone Soil | CAMHLVALQAYRPRKIVIRRSADQPAATVCVGTTCSLPVATPEALANLLR* |
| Ga0137365_102766801 | 3300012201 | Vadose Zone Soil | LLALQTYRPRKVVIRRLAEAPAATVCVGTVCSLPVVSPERLADLLA* |
| Ga0137365_103556911 | 3300012201 | Vadose Zone Soil | RALQAYRPRKVVVRKTAQQPAATVCVGTTCSLPVTTPEALGDLLR* |
| Ga0137365_104164182 | 3300012201 | Vadose Zone Soil | PRKLVVRKTAEQPAATVCVGTTCSLPVTTPESLRAQLG* |
| Ga0137363_100543602 | 3300012202 | Vadose Zone Soil | MHLLALQTYRPRKAVVRTIVPGGLEAIVCTGTTCSLPVATPEKLAELLEA* |
| Ga0137380_111569062 | 3300012206 | Vadose Zone Soil | MHLLALQTYRPRKVVVRETAERPAAPAATVCVGTTCSLPVATPEALGDLLR* |
| Ga0137381_112390782 | 3300012207 | Vadose Zone Soil | GPAGPGPACDMHLLALRAYRPRKVVVRRPGDRPAAIVCVGTTCSLPVAAPAALAELLR* |
| Ga0137376_101199321 | 3300012208 | Vadose Zone Soil | MHLLALQAYRPRKIVIRATADRPGATVCVGTTCSLPVATPDALRALLS* |
| Ga0137379_102095504 | 3300012209 | Vadose Zone Soil | GEGAACDMHLLALQVFRPRKVVVRKGADRPAATVCVGTTCSLPVTTPDALRELLT* |
| Ga0137378_101864614 | 3300012210 | Vadose Zone Soil | QTYRPRRVVIRTIAPQPAATVCVGTTCSLPVSEPAGLAELLR* |
| Ga0137370_101703053 | 3300012285 | Vadose Zone Soil | LLALQTYRPRKVVVRRIADRPAATVCVGTTCSLPVATRDALAELLR* |
| Ga0137387_105486733 | 3300012349 | Vadose Zone Soil | VARQAYRPRKVVIRKTAQRPAATPCVGTTCSLPVATTADLKPLLT* |
| Ga0137387_106670041 | 3300012349 | Vadose Zone Soil | DGPACAMHLLALQTYRPRKVVVRAIAAAPAATVCVGTTCSMPVSTREQLARLLEA* |
| Ga0137387_110921972 | 3300012349 | Vadose Zone Soil | MHLLALQTYRPRKVVVRTIAERPAATVCVGPTCSMPVSAPEQLAGLLEA* |
| Ga0137386_111060911 | 3300012351 | Vadose Zone Soil | AMHLLALQTYRPRKVVVRTIAERPAATVCVGPTCSMPVSAPEQLAGLLEA* |
| Ga0137367_100433995 | 3300012353 | Vadose Zone Soil | YRPRRVVVRKVADRPAATVCVGTTCSLPVATPEALAELLR* |
| Ga0137384_105803451 | 3300012357 | Vadose Zone Soil | EMHLLALQTFRPRKVVVRKTADDPAATVCLGTTCSLPVSTPDALTDLLR* |
| Ga0137384_107487031 | 3300012357 | Vadose Zone Soil | PRRIVIRRTASVPAATVCVGTTCSLPVASTAALGTLLA* |
| Ga0137368_103224612 | 3300012358 | Vadose Zone Soil | QAYRPRKVVVRTVAEAPAATVCVGTTCSLPVASPERLAQLLS* |
| Ga0137375_101007691 | 3300012360 | Vadose Zone Soil | KVVVRRIATAPAATVCVGTTCSLPVDAPARLAELLA* |
| Ga0137360_107819241 | 3300012361 | Vadose Zone Soil | PRKVVVRKVAERPATTVCVGTSCSMPVSTPEQLAGLLEA* |
| Ga0137390_110073161 | 3300012363 | Vadose Zone Soil | MHLLALQTYRPRTVVVRKIAAQPAATVCVGTTCSLPVAAPEALAELLA* |
| Ga0137373_104132411 | 3300012532 | Vadose Zone Soil | MHLLALQTYRPRKVVVRAIAAAPAATVCVGTTCSMPVSTPEQLARLLEA* |
| Ga0137397_101971023 | 3300012685 | Vadose Zone Soil | RKVVIRSIANTPAATVCVGTTCSLPVHAPDDLAALLA* |
| Ga0137394_106410612 | 3300012922 | Vadose Zone Soil | PRKVVVRTIAAAPAATVCVGTTCSLPVASPERLAELLA* |
| Ga0137359_110690881 | 3300012923 | Vadose Zone Soil | QTYRPRKVVIRRVAERPATTVCVGISCSVPVSTPEQLAGLLEA* |
| Ga0137419_111188211 | 3300012925 | Vadose Zone Soil | PRKVVVRTITERPAATICVGTTCSMPVSTPEQLAGLLEA* |
| Ga0137416_100952895 | 3300012927 | Vadose Zone Soil | PRKVVVRRIEERPAATVCVGTTCSLPVTTRDALAALLR* |
| Ga0137416_105298042 | 3300012927 | Vadose Zone Soil | QGPACEMHLRALQAYRPRKLVVRKTAERPAATVCIGTTCSLPVTTPEALADLLR* |
| Ga0137407_100647621 | 3300012930 | Vadose Zone Soil | GPGPACEMHLRALQAYWPRKVVVRKTAQRPAATVCVGTTCSLPVTTPEALGDLLR* |
| Ga0126375_117885391 | 3300012948 | Tropical Forest Soil | GPACALHLAALQEYRPRKAVIRSTGGAATPAVTVCIGTTCSLPVATTEKLKELLHS* |
| Ga0134077_100147325 | 3300012972 | Grasslands Soil | VGLQAYRPRTVVLRKTADRPTATVCVGTTCSLPVATPEALRDLLR* |
| Ga0134077_100535801 | 3300012972 | Grasslands Soil | RPRKVVVRTLAERPAATVCVGTSCSLPVSTPEQLATLLEA* |
| Ga0134077_100982943 | 3300012972 | Grasslands Soil | MHLLALQTYRPRKVVIRKTAAQPAATVCVGTTCSLPVATADDLRKLLI* |
| Ga0134076_100484103 | 3300012976 | Grasslands Soil | GPACAMHLLALQRYRPRTVIIRKITAAPSATVCVGASCSLPVSTPEKLAELLEQ* |
| Ga0134076_104677172 | 3300012976 | Grasslands Soil | QGAACDMHLLALQTYKPRKVVVRKTAEQPAATVCVGTTCSLPVTTPEALGDLLR* |
| Ga0134078_106595642 | 3300014157 | Grasslands Soil | GAACDMHLLALQTYRPRKLVVRKTAERPAATVCVGTTCSLPVTTPESLRALLG* |
| Ga0180063_10982241 | 3300014885 | Soil | RKVVLRHVADLPTATVCVGTTCSLPVTTRDALRELLA* |
| Ga0137411_13269522 | 3300015052 | Vadose Zone Soil | MHLLALQTYRPRKVVVRKIADRPAATVCVGTTCSLPVSTPEQLAKLLES* |
| Ga0137418_1000755112 | 3300015241 | Vadose Zone Soil | ALQTYRPRKVVVRRVAERPATTVCVGTSCSMPVSTPEQLAGLLEA* |
| Ga0137418_104326922 | 3300015241 | Vadose Zone Soil | RGEGAACDMHLLALQTYRPRKLVVRKTAERPSATVCVGTTCSLPVTTREALGDLLR* |
| Ga0137409_102232912 | 3300015245 | Vadose Zone Soil | MHLRALQTYRPRRVVIRTIAAQPAATVCVGTTCSLPVTEPAQLAELLK* |
| Ga0180073_10849251 | 3300015256 | Soil | QAYRPRKVVVRHPADRPAATVCVGTTCSLPVATPDTLRELLA* |
| Ga0134073_100052544 | 3300015356 | Grasslands Soil | AACDMHLLALQTYRPRKLVVRKTAERPRATVCVGTTCSLPVTTPEALRDLLR* |
| Ga0134089_100192971 | 3300015358 | Grasslands Soil | MHLAALQAYRPRKVVVRKMADRPAAIVCVGTTCSLPVATPEALRDLLR* |
| Ga0134089_100786483 | 3300015358 | Grasslands Soil | DGPACAMHLLALQTYRPRKVVVRTLAERPAATVCVGTSCSLPVSTPEQLATLLEA* |
| Ga0134085_102882661 | 3300015359 | Grasslands Soil | TYRPRKVVVRKIADRPAATVCVGTTCSLPVSTPEQLAGLLEA* |
| Ga0132256_1003024581 | 3300015372 | Arabidopsis Rhizosphere | KGDGPACAMHLLALQTYRPRKVVIRKVAPAPEATVCVGTSCSLPVATPEKLDALLLS* |
| Ga0134069_10269383 | 3300017654 | Grasslands Soil | RGEGPACAMHLLALQTYRPRKVVIRKTAAQPAATVCVGTTCSLPVATADDLRKLLI |
| Ga0134069_11058861 | 3300017654 | Grasslands Soil | ACAMHLVALQEYRPRKAVIRSTAATPAATVCVGTTCSLPVATTEKVKELLHS |
| Ga0134069_11792961 | 3300017654 | Grasslands Soil | DMHLLALRSYRPRKVVVRRPGERPAATVCVGTTCSLPVAAPAALAELLR |
| Ga0134112_103751682 | 3300017656 | Grasslands Soil | PRKTVVRTIAEQPAATVCVGTTCSMPVSAPEQLAGLLEA |
| Ga0134074_10188531 | 3300017657 | Grasslands Soil | GEGPACAMHLLALQTYRPRKVVVRKIADRPAATVCVGTTCSLPVSTPEQLAGLLEA |
| Ga0184608_102537331 | 3300018028 | Groundwater Sediment | EGPACAMHLLALQTYRPRKVVVRKIADRPAATVCVGTTCSLPVSTPEQLAKLLES |
| Ga0184623_104184302 | 3300018056 | Groundwater Sediment | YRPRTVVVRKIAERPAATVCVGTSCSLPVATPEKLTELLEA |
| Ga0187773_100192721 | 3300018064 | Tropical Peatland | AGEGPACAMHLRALQTYRPRKVVVRKIAAAPAATVCLGTACSLPVTTPEALANLL |
| Ga0184618_103274562 | 3300018071 | Groundwater Sediment | GPACDMHLLALQAYRPRKVVVRKTAERPAATVCVGTTCSLPVATPGALGDLLR |
| Ga0066669_108888382 | 3300018482 | Grasslands Soil | ACDMHLLALQTYRPRKLVVRKTAERPTATVCVGTTCSLPVATPEALGDLLR |
| Ga0193755_11353372 | 3300020004 | Soil | CAMHLLALQVYRPRKVVVRKQAAEAATVVCVGTACSLPVTTPAALGEILR |
| Ga0206224_10156361 | 3300021051 | Deep Subsurface Sediment | VVVRKVAASPAATVCVGTSCSLPVATPERLAELLGGVGA |
| Ga0210382_100900311 | 3300021080 | Groundwater Sediment | GEGPACAMHLLALQTYRPRKVVVRKIAAAPAPPAATVCVGTTCSLPVDAPARLAELLA |
| Ga0210382_105230452 | 3300021080 | Groundwater Sediment | MHLRALQAYRPRKLVVRKTAERPAATVCIGTTCSLPVTTPEALGDLLR |
| Ga0222621_10999011 | 3300021510 | Groundwater Sediment | YRPRKVVVRKTAPAPAATVCVGTTCSLPVSAPNALAQLLA |
| Ga0224496_101088711 | 3300022204 | Sediment | AMHLLALQAYRPRRAVVRTAAEDPAATVCVDVTCSLPVATREALAPLLT |
| Ga0247660_10018061 | 3300024317 | Soil | LLALQRFRPRKVVVRRIADAPQATVCVGTTCSLPVDRPEQLETLLA |
| Ga0137417_11900281 | 3300024330 | Vadose Zone Soil | TVVRTIADRPAAATVCLGTTCSMPVSAPEQLAGLLEA |
| Ga0209108_102174732 | 3300025165 | Soil | ACAMHLVALQAYRPRKVVIRQVGGAPAATVCVGTTCSLPVATPAGLTELLA |
| Ga0209751_102748931 | 3300025327 | Soil | PRKVVIRKVGGAPAATVCVGTTCSLPVEAPNELAKLLA |
| Ga0207684_114866992 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RKIVVRKVAERPAATVCVGTACSLPVATPDKLAELLQS |
| Ga0207684_117342071 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RPRKVVVRTIAERPSATVCVGTTCSLPVTTPDALRALLG |
| Ga0207660_100795401 | 3300025917 | Corn Rhizosphere | RPRRVVVRTTADAPAATVCVGTTCSLPVATPEKLAELLT |
| Ga0207708_101879933 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ACTMHLLALQAYRPRKVVVRRISTDVRATVCVGTTCSLPVATPDALGPLLA |
| Ga0209350_10811522 | 3300026277 | Grasslands Soil | AMHRVALQSYRPRAAVVRKTADRPAATVCVGTTCSLPVATPEALRDLLR |
| Ga0209234_12043131 | 3300026295 | Grasslands Soil | ALQTYRPRKLVVRKTAERPAATVCLGTTCSLPVTTPEALRALLG |
| Ga0209234_12288731 | 3300026295 | Grasslands Soil | RKVVIRKTAERPAATVCVGTTCSLPVATAADLKPLLT |
| Ga0209235_10183876 | 3300026296 | Grasslands Soil | GPACAMHLLALQTYRPRTVIIRKITAAPNATVCVGTSCSLPVSTPEKLAELLEQ |
| Ga0209235_10428824 | 3300026296 | Grasslands Soil | TYRPRKVVVREIAEQPAAVVCVGTTCSLPVATAAALAKLLG |
| Ga0209236_12379411 | 3300026298 | Grasslands Soil | RPRKVVIRKTAERPAATVCVGTTCSLPVAIAAELRTLLT |
| Ga0209238_10510303 | 3300026301 | Grasslands Soil | EALRTYRPRKVVVRRVAERPAATVCVGTTCSLPVAERDALAKLLR |
| Ga0209239_12032472 | 3300026310 | Grasslands Soil | RVALQAYRPRAAVVRKTADRPAATVCVGTTCSLPVATPEALRDLLR |
| Ga0209761_11342581 | 3300026313 | Grasslands Soil | LALQAYRPRKVVIRKTAQRPAATLCVGTTCSLPVATTADLKPLLT |
| Ga0209268_10424641 | 3300026314 | Soil | KVVVRKVADRPAATVCVGTTCSLPVTTPDALRELLT |
| Ga0209268_11846692 | 3300026314 | Soil | MHLLALQAYRPRKVVLRKTADQAASTVCVGTTCSLPVATPAALGELLK |
| Ga0209472_10005751 | 3300026323 | Soil | AMHLLALQTYRPRKVVIRKTAERPAATVCVGTTCSLPVAIAAELRTLLT |
| Ga0209152_102260642 | 3300026325 | Soil | MHLLALQTYQPRKIVVRKIEARPAATVCVGTTCSMPVSAPEQLAGLLEA |
| Ga0209266_11309382 | 3300026327 | Soil | HLRALQAYRPRKVVVRKAAQQPAATVCVGTTCSLPVTTLEALGDLLR |
| Ga0209266_12416111 | 3300026327 | Soil | RPRKVVLRKTTEQPAATVCVGTTCSLPVATPDDVKNLLT |
| Ga0209802_10526671 | 3300026328 | Soil | MHLVALQTYRPRKVVVRRIAERSAATVCVGTTCSLPVATPEELRGLLP |
| Ga0209375_12962942 | 3300026329 | Soil | GPGAACDMHLLALETYRPRKVVIRKTAETPAATVCVGTTCALPVTAPDALRALLG |
| Ga0209473_10237051 | 3300026330 | Soil | RPRKVVIRKTAERPAATVCVGTTCSLPVATAADLKPLLT |
| Ga0209158_13167381 | 3300026333 | Soil | AMHLLALQTYRPRKIVVRKIEARPAATVCVGTTCSMPVSTPEQLVGLLEA |
| Ga0209808_10814871 | 3300026523 | Soil | ALQTYRPRKAVVRKVAAPSAEPAATVCVGTSCSLPVTAPEQLAELLA |
| Ga0209059_12592751 | 3300026527 | Soil | RKVVVRKTAPRPAATVCVGTTCSLPVTTLEALGDLLR |
| Ga0209160_11882552 | 3300026532 | Soil | YRPRTVVVRKVAAQPAATVCVGTTCSLPVARPEALAELLA |
| Ga0209058_10660611 | 3300026536 | Soil | LQTYRPRKVVVRTLAERPAATVCVGTSCSLPVSTPEQLATLLEA |
| Ga0209058_11128721 | 3300026536 | Soil | MHLLALQTYRPRKVVVRKTAARPAATVCIGTTCSLPVTTPEALGDLLR |
| Ga0209056_100590036 | 3300026538 | Soil | CAMHLLALQRYRPRTVIIRKITAAPSATVCVGASCSLPVSTPEKLAELLEQ |
| Ga0209056_100595055 | 3300026538 | Soil | GCDMHLVALQTYRPRKVVVRRIAERSAATVCVGTTCSLPVATPEELRGLLP |
| Ga0209376_11029023 | 3300026540 | Soil | RKVVLRKTADQAASTVCVGTTCSLPVATPAALGELLK |
| Ga0209161_103285803 | 3300026548 | Soil | VVIRKTAAQPAATVCVGTTCSLPVATADDLRKLLI |
| Ga0207594_1031531 | 3300026751 | Soil | KVVIRKIAPAPAATVCVGTSCSLPVATSEKLAALLLS |
| Ga0209388_10909322 | 3300027655 | Vadose Zone Soil | AMHLLALQTYRPRKAVVRTIAEQPAATVCVGTTCSMPVSVPEQLTGLLEA |
| Ga0209178_10005331 | 3300027725 | Agricultural Soil | LGPGEACAMHLAALQTWRPRRVVIRSAAARPQATVCVGTTCSLPVATRTAFAELVR |
| Ga0209073_101592032 | 3300027765 | Agricultural Soil | PGEACGMHLAALQAWRPRRVVIRRSGDHPQATVCVGTTCSLPVATRAALSELLA |
| Ga0209177_100294283 | 3300027775 | Agricultural Soil | GPGAACDMHLLALQRYRPRTIVIRKTADHPAATVCVGTTCSLPVATPEALGTLLS |
| Ga0209177_101697301 | 3300027775 | Agricultural Soil | HLLALQTYRPRKVVVRTIAATPAATVCVGTTCSIPVSTPEQLAGLLEA |
| Ga0209074_101269073 | 3300027787 | Agricultural Soil | KIVVRKIATAPTATVCVGTSCSLPVVTPAALADLLSQEP |
| Ga0209180_101109533 | 3300027846 | Vadose Zone Soil | HLLALQTYRPRKVVVRRIAERPAATVCVGTACSLPVATPPELRELLR |
| Ga0209283_106819122 | 3300027875 | Vadose Zone Soil | RRVVVRLPAERASATVCVGTTCSLPATSPEALAELLR |
| Ga0209486_103163731 | 3300027886 | Agricultural Soil | RVVVRKTADKPAATVCVGTSCSLPVATPEKLGELLA |
| Ga0307302_100821181 | 3300028814 | Soil | LRALQTYRPRKAVVRNIAPGDAEAIVCVGTSCSLPVATPEKFAELLEA |
| Ga0307308_100279994 | 3300028884 | Soil | CTMHLRALQTYRPRKAVVRNIAPGDAEAIVCVGTSCSLPVATPEKFAELLEA |
| Ga0307479_105924772 | 3300031962 | Hardwood Forest Soil | GEGAACDMHLVALQTYRPRRLVIRRTAERPAATVCVGTTCSLPVPTPEALRTLLG |
| Ga0310889_105281541 | 3300032179 | Soil | ALQTYRPRKVVIRKVAPAPEATVCVGTSCSLPVATPEKLDALLLS |
| Ga0307471_1021569341 | 3300032180 | Hardwood Forest Soil | GPAGDGPACAMHLRALQTYRPRRVVIRTIAPQPAATVCVGTTCSLPVAEPAALAELLK |
| Ga0335082_103172393 | 3300032782 | Soil | HLLALRTYRPRRIVIRTSGESPRGTVCVGTTCSLPVATGADLAGLLR |
| Ga0364930_0302988_287_433 | 3300033814 | Sediment | MHLLALQAYRPRKVVIRKIAGAPAATVCVGTTCSLPVAAPAGLAELLA |
| Ga0364946_102334_497_637 | 3300033815 | Sediment | LLALQTYRPRKVVVRKIAAAPAATVCVGTTCSLPVDAPARLAELLA |
| ⦗Top⦘ |