| Basic Information | |
|---|---|
| Family ID | F023297 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 210 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VDVFGSFALVLAFVCAVYAFGGGIAAIITRHPLLIKSTRQAG |
| Number of Associated Samples | 175 |
| Number of Associated Scaffolds | 210 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.52 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.81 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.381 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.810 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 210 Family Scaffolds |
|---|---|---|
| PF03100 | CcmE | 96.19 |
| PF01346 | FKBP_N | 0.48 |
| PF00557 | Peptidase_M24 | 0.48 |
| PF10431 | ClpB_D2-small | 0.48 |
| PF03255 | ACCA | 0.48 |
| PF14579 | HHH_6 | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
|---|---|---|---|
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 96.19 |
| COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002914|JGI25617J43924_10183319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10287885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Liptonbacteria → Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_52_25 | 668 | Open in IMG/M |
| 3300004091|Ga0062387_101474338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 545 | Open in IMG/M |
| 3300004119|Ga0058887_1371639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300004120|Ga0058901_1561540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300004479|Ga0062595_102054389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300004631|Ga0058899_12084609 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300004631|Ga0058899_12101709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300004803|Ga0058862_11335850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300005174|Ga0066680_10277379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300005176|Ga0066679_10048063 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300005179|Ga0066684_10292130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
| 3300005332|Ga0066388_102650856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 914 | Open in IMG/M |
| 3300005332|Ga0066388_105053028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300005451|Ga0066681_10510344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300005451|Ga0066681_10572868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300005451|Ga0066681_10689428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300005554|Ga0066661_10165886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300005557|Ga0066704_10730001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300005566|Ga0066693_10139425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300005566|Ga0066693_10269951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300005591|Ga0070761_10028847 | All Organisms → cellular organisms → Bacteria | 3094 | Open in IMG/M |
| 3300005610|Ga0070763_10962956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300005921|Ga0070766_10770467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300006050|Ga0075028_100338721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300006050|Ga0075028_100966924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300006057|Ga0075026_100798837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300006796|Ga0066665_11075476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300006797|Ga0066659_10679674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300006797|Ga0066659_11235690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300006804|Ga0079221_10582593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300006881|Ga0068865_100900767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300009038|Ga0099829_10386624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300009038|Ga0099829_10567199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300009088|Ga0099830_10344051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300009088|Ga0099830_11094336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300009137|Ga0066709_100746898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1412 | Open in IMG/M |
| 3300009137|Ga0066709_103092079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300010048|Ga0126373_10913591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300010108|Ga0127474_1093699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300010134|Ga0127484_1156991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300010320|Ga0134109_10047508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
| 3300010322|Ga0134084_10136700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300010322|Ga0134084_10160063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300010341|Ga0074045_10163337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
| 3300010358|Ga0126370_10022365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3662 | Open in IMG/M |
| 3300010364|Ga0134066_10026587 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300010379|Ga0136449_103794556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300010403|Ga0134123_12120537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300011064|Ga0138525_1007484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300011120|Ga0150983_12624208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300011120|Ga0150983_14109498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300011120|Ga0150983_14121455 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Liptonbacteria → Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_52_25 | 538 | Open in IMG/M |
| 3300011120|Ga0150983_14383859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300011120|Ga0150983_16276379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300011269|Ga0137392_11197468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300011270|Ga0137391_11461040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300011271|Ga0137393_11183602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300012189|Ga0137388_10880712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300012199|Ga0137383_10358982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300012201|Ga0137365_10454362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300012202|Ga0137363_11304700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012207|Ga0137381_10068581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2962 | Open in IMG/M |
| 3300012357|Ga0137384_10151039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1944 | Open in IMG/M |
| 3300012357|Ga0137384_11133793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300012357|Ga0137384_11190597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300012357|Ga0137384_11535172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012362|Ga0137361_10328363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
| 3300012362|Ga0137361_10780778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300012363|Ga0137390_11591719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300012377|Ga0134029_1171563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300012378|Ga0134025_1088284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300012918|Ga0137396_10107446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1999 | Open in IMG/M |
| 3300012927|Ga0137416_11203196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300012930|Ga0137407_11773274 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012944|Ga0137410_10984470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300012971|Ga0126369_11624979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300014151|Ga0181539_1045951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2094 | Open in IMG/M |
| 3300015051|Ga0137414_1212628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300015054|Ga0137420_1042051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300015241|Ga0137418_11078596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300015242|Ga0137412_10455622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300016387|Ga0182040_11286239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300016422|Ga0182039_11346169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300017822|Ga0187802_10179709 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300017927|Ga0187824_10181910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300017934|Ga0187803_10227451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300017955|Ga0187817_10150868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1478 | Open in IMG/M |
| 3300017961|Ga0187778_11055350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300017993|Ga0187823_10363118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Liptonbacteria → Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_52_25 | 518 | Open in IMG/M |
| 3300018006|Ga0187804_10597526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300018030|Ga0187869_10293647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300018062|Ga0187784_10793388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300018482|Ga0066669_10843365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300019264|Ga0187796_1048914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300020580|Ga0210403_10757939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300020581|Ga0210399_11013108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300020583|Ga0210401_10231579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1706 | Open in IMG/M |
| 3300020583|Ga0210401_11226467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300020583|Ga0210401_11259103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300021086|Ga0179596_10140741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300021315|Ga0179958_1011333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300021405|Ga0210387_11256672 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300021406|Ga0210386_11099600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021475|Ga0210392_11189455 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300021476|Ga0187846_10144683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300021477|Ga0210398_10137142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1989 | Open in IMG/M |
| 3300021479|Ga0210410_11326397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300021559|Ga0210409_10859035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300021559|Ga0210409_11108520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021560|Ga0126371_12592470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300022504|Ga0242642_1065236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300022507|Ga0222729_1045632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300022523|Ga0242663_1083122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300022531|Ga0242660_1135618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300022532|Ga0242655_10137653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300022533|Ga0242662_10189308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300022533|Ga0242662_10204659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300022533|Ga0242662_10224429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300022712|Ga0242653_1116539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300022720|Ga0242672_1061857 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300022724|Ga0242665_10070269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300022726|Ga0242654_10139158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300022726|Ga0242654_10235782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300024288|Ga0179589_10442982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300025324|Ga0209640_10778434 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300025480|Ga0208688_1017746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1885 | Open in IMG/M |
| 3300025498|Ga0208819_1015324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2263 | Open in IMG/M |
| 3300025913|Ga0207695_10307592 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Liptonbacteria → Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_52_25 | 1475 | Open in IMG/M |
| 3300026297|Ga0209237_1171677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300026305|Ga0209688_1084380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300026317|Ga0209154_1047250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1928 | Open in IMG/M |
| 3300026334|Ga0209377_1169425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300026359|Ga0257163_1022655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300026374|Ga0257146_1002109 | All Organisms → cellular organisms → Bacteria | 3390 | Open in IMG/M |
| 3300026490|Ga0257153_1001379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4469 | Open in IMG/M |
| 3300026497|Ga0257164_1065586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300027019|Ga0207857_1021773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300027071|Ga0209214_1040077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300027575|Ga0209525_1069838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300027629|Ga0209422_1056881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300027698|Ga0209446_1185895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300027748|Ga0209689_1059599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2097 | Open in IMG/M |
| 3300027812|Ga0209656_10137003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300027824|Ga0209040_10246888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300027846|Ga0209180_10566402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300027862|Ga0209701_10031274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3457 | Open in IMG/M |
| 3300027875|Ga0209283_10896628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300027882|Ga0209590_10751257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300027889|Ga0209380_10244465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300027889|Ga0209380_10606549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300027903|Ga0209488_10228177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
| 3300027905|Ga0209415_10235125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Liptonbacteria → Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_52_25 | 1672 | Open in IMG/M |
| 3300027905|Ga0209415_10733650 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Liptonbacteria → Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_52_25 | 701 | Open in IMG/M |
| 3300027910|Ga0209583_10655769 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027911|Ga0209698_11433863 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300028536|Ga0137415_10758415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300028781|Ga0302223_10286096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300030529|Ga0210284_1881074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300030602|Ga0210254_11372992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300030707|Ga0310038_10202983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300030743|Ga0265461_12432106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300030937|Ga0138302_1721414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300030950|Ga0074034_10972859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300030975|Ga0099845_1487668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300031015|Ga0138298_1379227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300031057|Ga0170834_108021895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300031057|Ga0170834_110688412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300031231|Ga0170824_128821009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1755 | Open in IMG/M |
| 3300031344|Ga0265316_10993355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300031469|Ga0170819_12507518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300031474|Ga0170818_115512895 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031573|Ga0310915_10027937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3495 | Open in IMG/M |
| 3300031708|Ga0310686_100107196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300031720|Ga0307469_11029528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300031753|Ga0307477_10074431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2349 | Open in IMG/M |
| 3300031754|Ga0307475_10630657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300031754|Ga0307475_10880794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031754|Ga0307475_10944777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031819|Ga0318568_10376635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300031890|Ga0306925_10056082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4117 | Open in IMG/M |
| 3300031890|Ga0306925_10954597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300031894|Ga0318522_10086151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300031910|Ga0306923_10385175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
| 3300031941|Ga0310912_10409872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300031942|Ga0310916_11466823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300031945|Ga0310913_10215980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300031945|Ga0310913_10822242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031962|Ga0307479_10780270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300032008|Ga0318562_10723270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300032051|Ga0318532_10056263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1355 | Open in IMG/M |
| 3300032059|Ga0318533_10358470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300032065|Ga0318513_10631908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300032076|Ga0306924_12296422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300032119|Ga0316051_1022049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Liptonbacteria → Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_52_25 | 589 | Open in IMG/M |
| 3300032174|Ga0307470_10389562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300032180|Ga0307471_102540821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300032261|Ga0306920_101562803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300032261|Ga0306920_102204942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300032515|Ga0348332_14094073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300032515|Ga0348332_14148426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Liptonbacteria → Candidatus Liptonbacteria bacterium RIFCSPLOWO2_01_FULL_52_25 | 598 | Open in IMG/M |
| 3300032770|Ga0335085_11578623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300032782|Ga0335082_10379371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1279 | Open in IMG/M |
| 3300032892|Ga0335081_12697581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300032955|Ga0335076_11226173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300032955|Ga0335076_11383168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300033004|Ga0335084_10577706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300033289|Ga0310914_11714329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300033977|Ga0314861_0341010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300034070|Ga0334822_087427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.48% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.48% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.48% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.48% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.48% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027019 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 22 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030529 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030950 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_101833192 | 3300002914 | Grasslands Soil | VDVFGSFALILAFVCAAYAVVVGIAAILTRHPLLIKSARQA |
| JGIcombinedJ51221_102878852 | 3300003505 | Forest Soil | LDIFGSYALLLAFAFAVYAIVGGIAAIITRHPLLIKSARNAG |
| Ga0062387_1014743381 | 3300004091 | Bog Forest Soil | MDVFGSFSLLLAYVCAIYALVGGIAAIVTRHPLLIKSARQAGIATC |
| Ga0058887_13716391 | 3300004119 | Forest Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQ |
| Ga0058901_15615401 | 3300004120 | Forest Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMATCALIF |
| Ga0062595_1020543892 | 3300004479 | Soil | MDVFGSFALILALVCAVYAFVGGIAAIITRHPLLIKSARQAGIA |
| Ga0058899_120846091 | 3300004631 | Forest Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQ |
| Ga0058899_121017092 | 3300004631 | Forest Soil | MDVFGSFTLLLAFVCAVYALAGGIAAIITRHPLLVKSTRQ |
| Ga0058862_113358502 | 3300004803 | Host-Associated | VDVFGSFALILAFICAVYAFGGGIAAILTRHPLLVKSTRQAGIATC |
| Ga0066680_102773791 | 3300005174 | Soil | VDLVGSFALLVAFVSAVYAIGTGIAAILSRRPLLNKSARQ |
| Ga0066679_100480631 | 3300005176 | Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIITRHPLLIKSTRQ |
| Ga0066684_102921301 | 3300005179 | Soil | MDVFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMATCGLIF |
| Ga0066388_1026508562 | 3300005332 | Tropical Forest Soil | MDVFGSFSLLLAFVCAVYAFVGGIFAIKTRHPLLVKSTRQSGMAACV |
| Ga0066388_1050530282 | 3300005332 | Tropical Forest Soil | VDVFGSFSLLLAFVCALYALVGGIAAIATRHPLLIKSARQA |
| Ga0066681_105103441 | 3300005451 | Soil | MDVFGSFALILAFVCALYAFVGGIAAIITRHPLLIKSARQAGIA |
| Ga0066681_105728682 | 3300005451 | Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGM |
| Ga0066681_106894282 | 3300005451 | Soil | MDVFGSFALILAFVCAVYAFVGGIAAIITRHPLLIKSARQAGIAVCAL |
| Ga0066661_101658863 | 3300005554 | Soil | LPVDVFGSFALVLAFVCAVYAFGGGIAAIITRHPL |
| Ga0066704_107300012 | 3300005557 | Soil | VDVFGSFALILAFVCAVYAFAGGIGAIVTRHPLLVKS |
| Ga0066693_101394253 | 3300005566 | Soil | MDVFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIK |
| Ga0066693_102699512 | 3300005566 | Soil | VDVFGSFALILAFVCAVYAFAGGIAAIVTRHPLLVKSAR |
| Ga0070761_100288475 | 3300005591 | Soil | VDVFGSFALILAFVCAVYAFGGGIAAIITRHPLLVKSTRQAGIATC |
| Ga0070763_109629561 | 3300005610 | Soil | VDVFGSFALILAFICAVYAFGGGIAAILTRHPLLVKSTRQAGIATCC |
| Ga0070766_107704672 | 3300005921 | Soil | VDVFGSFALILAFVCAVYAFVGGIAAILTRHPLLVKSTRQAGIATCALIF |
| Ga0075028_1003387211 | 3300006050 | Watersheds | VDVFGSFALVLAFVCAVYAFAGGIAAIVTRHPLLIKSTRQAGMATCG |
| Ga0075028_1009669242 | 3300006050 | Watersheds | VDVFGSFALVLAFVCAVYAFAGGIAAIVTRHPLLIKSTRQAGIATC |
| Ga0075026_1007988372 | 3300006057 | Watersheds | VDVFGSFALVLALICAVYAFGGGIAAITTRHPLLVKSTRQSGMA |
| Ga0066665_110754762 | 3300006796 | Soil | LPVDVFGSFALVLAFVCAVYAFGGGIAAIITRHPLLI |
| Ga0066659_106796741 | 3300006797 | Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMATC |
| Ga0066659_112356902 | 3300006797 | Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMAT |
| Ga0079221_105825933 | 3300006804 | Agricultural Soil | VDVFGSFALILAFICAVYAFAGGIAAIITRHPLLVKSTR |
| Ga0068865_1009007671 | 3300006881 | Miscanthus Rhizosphere | MDVFGSFALVLAFVCALYAFGGGIAAIITRHPLLIKS |
| Ga0099829_103866243 | 3300009038 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTRQ |
| Ga0099829_105671991 | 3300009038 | Vadose Zone Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLVKITRQAGMATCALIFL |
| Ga0099830_103440513 | 3300009088 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTRQAGM |
| Ga0099830_110943362 | 3300009088 | Vadose Zone Soil | VDVFGSFALILAFVCAAYAVVVGIAAILTRHPLLIKSARQ |
| Ga0066709_1007468981 | 3300009137 | Grasslands Soil | VDVFGSFALLLAFVCALYALVGGIAAILTRHALLI |
| Ga0066709_1030920792 | 3300009137 | Grasslands Soil | MDIFGSFALVLAFVCAVYAFGCGIAAIFTCHPLLFYSTRQD |
| Ga0126373_109135912 | 3300010048 | Tropical Forest Soil | MDVFGSFSLLLAFVCAVYAFVGGIAAIQTRHPLLIKSTRQAGM |
| Ga0127474_10936991 | 3300010108 | Grasslands Soil | VDVFGSFALLVAFVCAVYAVVGGIAAIITRHPLLVKS |
| Ga0127484_11569912 | 3300010134 | Grasslands Soil | VDVFGSFALLVAFVCAVYAVVGGIAAIITRHPLLVK |
| Ga0134109_100475081 | 3300010320 | Grasslands Soil | LPVDVFGSFALVLAFVCAVYAFGGGIAAIITRHPLLIKSTRQAGMATCCLI |
| Ga0134084_101367001 | 3300010322 | Grasslands Soil | MDVFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMAT |
| Ga0134084_101600632 | 3300010322 | Grasslands Soil | VDVFGSFALLVAFVCAVYAVVGGIAAIITRHPLLVKSAR |
| Ga0074045_101633373 | 3300010341 | Bog Forest Soil | MDVFGSFTLLLAFVCAVYAFVGGIAAIITRHPLLVKSTRQAGI |
| Ga0126370_100223657 | 3300010358 | Tropical Forest Soil | MDVFGSFSLLLAFVCAVYAFVGGIAAIKTRHPLLIKSTRQAGMA |
| Ga0134066_100265871 | 3300010364 | Grasslands Soil | MDVFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGM |
| Ga0136449_1037945561 | 3300010379 | Peatlands Soil | VDVFGSFALVLAFICAVYAFGGGIAAIVTRHPLLVKSTRQSGMAAC |
| Ga0134123_121205371 | 3300010403 | Terrestrial Soil | MDVFGSFALILALVCALYAFGGGIAAIITRHPLLIKSARQSGMA |
| Ga0138525_10074842 | 3300011064 | Peatlands Soil | MDVFGSFTLLLAFVCAVYAFVGGIAAIITRHPLLVKST |
| Ga0150983_126242082 | 3300011120 | Forest Soil | LDLFGSYALLLAFALAIYAIVGGIAAIITRHPLLIKSARNAGFA |
| Ga0150983_141094982 | 3300011120 | Forest Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKS |
| Ga0150983_141214552 | 3300011120 | Forest Soil | LDLFGSYALLLAFLCGVYAFGAGIAAIITRKPLLIK |
| Ga0150983_143838592 | 3300011120 | Forest Soil | LDIFGSFALVLALVAATYAVGAGAVAIITRRPLLIKSA |
| Ga0150983_162763792 | 3300011120 | Forest Soil | VDVFGSFALILAFVCAVYAFGGGIAAIITRHPLLVKSTRQAG |
| Ga0137392_111974681 | 3300011269 | Vadose Zone Soil | VDAFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTRQ |
| Ga0137391_114610402 | 3300011270 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTRQAGMATCC |
| Ga0137393_111836021 | 3300011271 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTR |
| Ga0137388_108807121 | 3300012189 | Vadose Zone Soil | VDAFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTR |
| Ga0137383_103589821 | 3300012199 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIVTRHPLLIKSAR |
| Ga0137365_104543621 | 3300012201 | Vadose Zone Soil | VDVFGSFALVLAFVCGVYAFVGGIAAIVTRHPLLVKSTRQA |
| Ga0137363_113047002 | 3300012202 | Vadose Zone Soil | VDVFGSFALILAFVCAVYAFAGGIGAIVTRHQLLVKSTRQAG |
| Ga0137381_100685815 | 3300012207 | Vadose Zone Soil | VDVFGSFALILAFVCAVYAFGGGIAAIVTRHPLLVKSTRQAGMAT |
| Ga0137384_101510391 | 3300012357 | Vadose Zone Soil | VDVFGSFALLVAFVCAVYAVVGGIAAIITRHPLLVKSARQAGMATCGLI |
| Ga0137384_111337932 | 3300012357 | Vadose Zone Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIVTRHPLLIKSARQAGMATC |
| Ga0137384_111905972 | 3300012357 | Vadose Zone Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIVTRHPLLIKSAR |
| Ga0137384_115351721 | 3300012357 | Vadose Zone Soil | MDVFGSFALILAFVCAVYAFVGGIAAIITRHPLLIKSARQAGIAV |
| Ga0137361_103283631 | 3300012362 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLVKS |
| Ga0137361_107807781 | 3300012362 | Vadose Zone Soil | VDVCGSFALVLAFICAVYAFGGGIAAIITRHPLLVKST |
| Ga0137390_115917192 | 3300012363 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTRQAGMATCCLIFL |
| Ga0134029_11715631 | 3300012377 | Grasslands Soil | MDVFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMATC |
| Ga0134025_10882842 | 3300012378 | Grasslands Soil | VDVFGSFALLVAFVCAVYAVVGGIAAIITRHPLLVKSARQAGMATCGLIFL |
| Ga0137396_101074464 | 3300012918 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFAGGIAAIITRHPLLIKSTRQAG |
| Ga0137416_112031962 | 3300012927 | Vadose Zone Soil | VDVFGSFALILAFVCAAYAVVVGIAAILTRHPLLIKSARQAGLA |
| Ga0137407_117732742 | 3300012930 | Vadose Zone Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIMTRHPLLVKSTRQAGIATCV |
| Ga0137410_109844702 | 3300012944 | Vadose Zone Soil | VDVFGSFALILAFVCAVYAFAGGIGAILTRHPLLVKSTRQAG |
| Ga0126369_116249792 | 3300012971 | Tropical Forest Soil | MDVFGSFALILAFVCAAYAFVGGIAAILTRHPLLIKSARQAGMAACCL |
| Ga0181539_10459514 | 3300014151 | Bog | MDVFGSFTLLLAFVCAVYAFVGGIAAIITRHPLLVKSTRQAGIATCVLIFI |
| Ga0137414_12126281 | 3300015051 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTRQAGMATCCLIF |
| Ga0137420_10420512 | 3300015054 | Vadose Zone Soil | VDVFGSFALVLAFVCAIYAFGGGIAAIITRHPLLIKS |
| Ga0137418_110785961 | 3300015241 | Vadose Zone Soil | VDLFGSFALVLAFVCAVYAFVGGIAAILTRHPLLVKSTRQAGMAT |
| Ga0137412_104556223 | 3300015242 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTRQAGMAT |
| Ga0182040_112862392 | 3300016387 | Soil | MDVFGSFSLLLAFLCAVYAFIGGMFAIRTRHPLLVKS |
| Ga0182039_113461692 | 3300016422 | Soil | MDVFGSFSLLLAFVCAVYAFVTGIAAIKTRHPLLIKSAR |
| Ga0187802_101797092 | 3300017822 | Freshwater Sediment | MDVFGSFTLLLAFVCAAYAFVGGLAAIITRHPLLVKS |
| Ga0187824_101819101 | 3300017927 | Freshwater Sediment | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAGIATC |
| Ga0187803_102274512 | 3300017934 | Freshwater Sediment | MEVFGSFTLLLAFVCAVYAFVGGIAAIITRHPLLVKSTRQAGIATCVLIF |
| Ga0187817_101508683 | 3300017955 | Freshwater Sediment | MDVFGSFSLLLAFVCAVYAFIGGIVAIKTRHPLLI |
| Ga0187778_110553501 | 3300017961 | Tropical Peatland | MDVFGSFSLLLAFVCAVYAFVGGIFAIQTRHPLLIKSTRQS |
| Ga0187823_103631181 | 3300017993 | Freshwater Sediment | LDLFGSYALLLAFLCCLYAFGGGIAAIITRKPLLIKSARNAG |
| Ga0187804_105975262 | 3300018006 | Freshwater Sediment | VDVFGSFALILAFVCAAYAVAVGIAAILTRHPLLIKSARQAGLA |
| Ga0187869_102936472 | 3300018030 | Peatland | MDVFGSFTLLLAFVCAIYAFVGGIAAIITRHPLLVKSTRQA |
| Ga0187784_107933882 | 3300018062 | Tropical Peatland | MDVFGSFSLLLAFVCAVYAFVGGIIAIRTRHPLLVKSTRQAGIVTCVL |
| Ga0066669_108433652 | 3300018482 | Grasslands Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMA |
| Ga0187796_10489141 | 3300019264 | Peatland | VDVFGSFALILAFVCAAYAFAGGIAAIVTRHPLLIKSSRQA |
| Ga0210403_107579392 | 3300020580 | Soil | LDIFGSYALLLAFAFASYAIIGGIAAIITRHPLLIKSARNAG |
| Ga0210399_110131082 | 3300020581 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQAGMTTRV |
| Ga0210401_102315791 | 3300020583 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQAGMATCVLIF |
| Ga0210401_112264671 | 3300020583 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVK |
| Ga0210401_112591032 | 3300020583 | Soil | VDVFGSFALVLAFICAAYAFVGGIAAILTRHPLLIKSTRQAGIATCCLIFL |
| Ga0179596_101407413 | 3300021086 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKS |
| Ga0179958_10113332 | 3300021315 | Vadose Zone Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLI |
| Ga0210387_112566721 | 3300021405 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKST |
| Ga0210386_110996001 | 3300021406 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQAGMATC |
| Ga0210392_111894552 | 3300021475 | Soil | MDVFGSFSLLLAFVCALYAFIGGIAAIYTRHPLLIKSTR |
| Ga0187846_101446832 | 3300021476 | Biofilm | MDVFGSFSLLLAFVCAVYAFVGGIAAIKTRHPLLVKSTRQAGMAACALIF |
| Ga0210398_101371424 | 3300021477 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLV |
| Ga0210410_113263971 | 3300021479 | Soil | VDVFGSFALVLAFICAVYAFGGGIVAIITRHPLLVKSTRQAGMA |
| Ga0210409_108590351 | 3300021559 | Soil | LDVFGSFALLLAFVCATYALIGGIFAIRTRHPLLV |
| Ga0210409_111085202 | 3300021559 | Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIVTRHPLLIK |
| Ga0126371_125924701 | 3300021560 | Tropical Forest Soil | MDVFGSFSLLLAFVCAVYAFIGGMFAIRTRHPLLVKSTRQAGIV |
| Ga0242642_10652361 | 3300022504 | Soil | VDVFGSFALVLAFLCAVYAFVGGIAAILTRHPLLIKSA |
| Ga0222729_10456322 | 3300022507 | Soil | VDVFGSFALILAFICAVYAFGGGITAIITRHPLLVK |
| Ga0242663_10831221 | 3300022523 | Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQA |
| Ga0242660_11356181 | 3300022531 | Soil | VDVFGSFALILAFVCAVYAFVGGIAAILTRHPLLVKSTRQAGIATC |
| Ga0242655_101376531 | 3300022532 | Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIK |
| Ga0242662_101893081 | 3300022533 | Soil | MDVFGSFSLLLAFVCALYAFIGGIAAIYTRHPLLIKSTRQAGIVTCVLI |
| Ga0242662_102046592 | 3300022533 | Soil | MDVFGSFTLLLAFVCAVYALFGGIGAIFTRHPLLVKST |
| Ga0242662_102244291 | 3300022533 | Soil | VDVFGSFALILAFVCAVYAFVGGIAAILTRHPLLVK |
| Ga0242653_11165391 | 3300022712 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQAGMAT |
| Ga0242672_10618572 | 3300022720 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIMTRHPLLVKSTRQAGM |
| Ga0242665_100702691 | 3300022724 | Soil | MDIFGSFALALAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMAT |
| Ga0242654_101391581 | 3300022726 | Soil | MDVFGTFALILAFVCAVYAFGGGIAAIITRHPLLIKSTRQAGMATCCLIF |
| Ga0242654_102357822 | 3300022726 | Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAGIATCCLIFI |
| Ga0179589_104429822 | 3300024288 | Vadose Zone Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTR |
| Ga0209640_107784341 | 3300025324 | Soil | LDGFGSFALILAFVCAVYAVAAGIAGIAKRHALLVKSARQAVLAVSILVTLAT |
| Ga0208688_10177464 | 3300025480 | Peatland | MDVFGSFTLLLAFVCAIYAFVGGIAAIITRHPLLVKSTR |
| Ga0208819_10153245 | 3300025498 | Peatland | MDVFGSFTLLLAFVCAIYAFVGGIAAIITRHPLLVKS |
| Ga0207695_103075921 | 3300025913 | Corn Rhizosphere | LDLFGSYALLLAFALAIYAIVGGIAAIITRHPLLIKSARNAGFAVCVLIWM |
| Ga0209237_11716772 | 3300026297 | Grasslands Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIVTRHPLLIKSSRQ |
| Ga0209688_10843802 | 3300026305 | Soil | VDVFGSFALLVAFVCAVYAVVGGIAAIITRHPLLVKSARQAGMATCG |
| Ga0209154_10472504 | 3300026317 | Soil | MDVFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKST |
| Ga0209377_11694253 | 3300026334 | Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIITRHPLLIKSTRQAG |
| Ga0257163_10226553 | 3300026359 | Soil | MDVFGTFALILAFVCAVYAFGGGIAAIITRHPLLIKSTRQAGMATC |
| Ga0257146_10021091 | 3300026374 | Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIMTRHPLLV |
| Ga0257153_10013791 | 3300026490 | Soil | MDVFGSFALILAFVCAVYAFVGGIAAIITRHPLLIKSARQAGIAVCGLI |
| Ga0257164_10655861 | 3300026497 | Soil | VDLFGSFALLLAFVCAVYAIGVGIAAILSHRPLLNKSAR |
| Ga0207857_10217733 | 3300027019 | Tropical Forest Soil | MDVFGSFSLLLAFVCAVYAFVGGIAAIKTRHPLLIKSTRQAGMAACVLIF |
| Ga0209214_10400771 | 3300027071 | Forest Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIVTRHPLLI |
| Ga0209525_10698381 | 3300027575 | Forest Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAGIATCCLI |
| Ga0209422_10568811 | 3300027629 | Forest Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQA |
| Ga0209446_11858952 | 3300027698 | Bog Forest Soil | MDVFGSFSLLLAFVCALYAFVGGIAAIQTRHPLLVKSTRQSGIAAC |
| Ga0209689_10595991 | 3300027748 | Soil | VDVFGSFALLVAFVCAVYAVVGGIAAIITRHPLLVKSARQ |
| Ga0209656_101370031 | 3300027812 | Bog Forest Soil | MDVFGSFSLLLAFVCAVYAFVGGIFAIKTRHPLLIKSTRQAGMATCVLI |
| Ga0209040_102468881 | 3300027824 | Bog Forest Soil | MDVFGSFSLLLAFVCAVYAFVGGIFAIKTRHPLLIKSTRQAGMATCV |
| Ga0209180_105664022 | 3300027846 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFGGGIAAIITRHPLLIKSTRQA |
| Ga0209701_100312741 | 3300027862 | Vadose Zone Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIVTRHPLLIKSTRQA |
| Ga0209283_108966281 | 3300027875 | Vadose Zone Soil | VDVFGSFALVLAFICAVYAFAGGIAAIITRHPLLIKSTR |
| Ga0209590_107512571 | 3300027882 | Vadose Zone Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAGMATCALI |
| Ga0209380_102444653 | 3300027889 | Soil | MDVFGSFSLLLAFVCALYAFIGGIAAIYTRHPLLIKSTRQAGIVTCVLIFC |
| Ga0209380_106065492 | 3300027889 | Soil | VDVFGSFALILAFVCAVYAFVGGIAAILTRHPLLVKSTRQAGI |
| Ga0209488_102281773 | 3300027903 | Vadose Zone Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRQ |
| Ga0209415_102351251 | 3300027905 | Peatlands Soil | LDLFGSYALLLAFAFAVYAIFGGIAAIITRHPLLIKS |
| Ga0209415_107336503 | 3300027905 | Peatlands Soil | LDLFGSYALLLAFLCGLYAFGGGIAAIITRKPLLI |
| Ga0209583_106557692 | 3300027910 | Watersheds | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQAGIATCVLIFI |
| Ga0209698_114338631 | 3300027911 | Watersheds | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQAG |
| Ga0137415_107584153 | 3300028536 | Vadose Zone Soil | VDVFGSFALVLAFVCAVYAFGGGIAAIVTRHPLLIKSTRQAGMATCC |
| Ga0302223_102860961 | 3300028781 | Palsa | VDLFGSFALILAFICAVYAFIGGIFAIRTRHPLLVKSTRQAGIA |
| Ga0210284_18810742 | 3300030529 | Soil | VDVFGSFALVLAFICAAYAFVGGIAAIVTRHPLLVKSARQSGIATCC |
| Ga0210254_113729922 | 3300030602 | Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAG |
| Ga0310038_102029833 | 3300030707 | Peatlands Soil | MDVFGSFTLLLAFACAVYAFVGGIGAIITRHPLLVKSTRQ |
| Ga0265461_124321061 | 3300030743 | Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAGIATCCL |
| Ga0138302_17214141 | 3300030937 | Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAGIATCVL |
| Ga0074034_109728591 | 3300030950 | Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAGIA |
| Ga0099845_14876681 | 3300030975 | Boreal Forest Soil | MDIFGSFALALAFVCAVYAFGGGIAAIFTRHPLLIKSTRQAG |
| Ga0138298_13792271 | 3300031015 | Soil | MDIFGSFALVLAFVCAVYAFGGGIAAIFTRHPLLIKSTRARRKEYR |
| Ga0170834_1080218952 | 3300031057 | Forest Soil | VDVFGSFALILAFVCAVYAFGGGIAAILTRHPLLVK |
| Ga0170834_1106884121 | 3300031057 | Forest Soil | MDVFGSFALILAFVCAVYAFAGGIAAIITRHPLLIKSARQA |
| Ga0170824_1288210091 | 3300031231 | Forest Soil | MDVFGSFTLLLAFVCAVYALIGGIGAIITRHPLLV |
| Ga0265316_109933551 | 3300031344 | Rhizosphere | MDVFGSFSLLLAFVCAVYAFVAGIAAIKTRHPLLIKSARQAGIATCAL |
| Ga0170819_125075181 | 3300031469 | Forest Soil | MDVFGSFALILAFVCAVYAFVGGIAAIITRHPLLIKSARQAGTAVCVLI |
| Ga0170818_1155128952 | 3300031474 | Forest Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQAGM |
| Ga0310915_100279377 | 3300031573 | Soil | MDVFGSFSLLLAFVCDCYAVVGGIFAIRTRHPMLVKS |
| Ga0310686_1001071961 | 3300031708 | Soil | MDVFGSFSLLLAFVCAVYAFIGGIFAIKTRHPLLIKSTRQAGIATCVLI |
| Ga0307469_110295281 | 3300031720 | Hardwood Forest Soil | VDVFGSFALILAFVCAVYAFAGGIGAIVTRHPLLVKSTRQAGIATCC |
| Ga0307477_100744311 | 3300031753 | Hardwood Forest Soil | VDVFGSFALVLAFVCAVYAFAGGIAAIVTRHPLLVKSTRQAGIATCC |
| Ga0307475_106306573 | 3300031754 | Hardwood Forest Soil | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAGI |
| Ga0307475_108807942 | 3300031754 | Hardwood Forest Soil | VDVFGSFALVLAFICAVYAFGGGIAAILTRHPLLIKSTRQA |
| Ga0307475_109447771 | 3300031754 | Hardwood Forest Soil | VDVFGSFALVLAFVCAVYAFGGGIAAITTRHPLLIKSTRQA |
| Ga0318568_103766351 | 3300031819 | Soil | MDVFGSFSLLLAFVCDCYAVVGGIFAIRTRHPMLVK |
| Ga0306925_100560826 | 3300031890 | Soil | MDVFGTFSLLLAFVCAVYAFVGGIFAIKTRHPLLVKSTR |
| Ga0306925_109545971 | 3300031890 | Soil | MDVFGSFALILAFVCALYAVCGGIAAILTRHPLLI |
| Ga0318522_100861513 | 3300031894 | Soil | MDVFGSFSLLLAFVCAVYAFVGGIAAIKTRHPLLIKSTRQAGMTACVL |
| Ga0306923_103851753 | 3300031910 | Soil | MDVFGSFSLLLAFVCAVYAFVGGIAAIKTRHPLLIKSTRQAGMAA |
| Ga0310912_104098721 | 3300031941 | Soil | MDVFGSFSLLLAFVCAVYAFVGGIFAIGTGHPLLIKSARQSG |
| Ga0310916_114668231 | 3300031942 | Soil | MDVFGSFALILAFVSALYAFGGGIAAILTRHPLLI |
| Ga0310913_102159801 | 3300031945 | Soil | MDVFGSFSLLLAFVCAVYAFVGGIFAIKTRHPLLIKSTRQSGM |
| Ga0310913_108222421 | 3300031945 | Soil | MDVFGSFALILAFVSALYAFGGGIAAILTRHPLLIKSARQAGMATCGLIW |
| Ga0307479_107802701 | 3300031962 | Hardwood Forest Soil | VDVFGSFALVLAFICAVYAFGGGIAAIMTRHPLLIKSTRQAG |
| Ga0318562_107232701 | 3300032008 | Soil | MDVFGSFSLLLAFVCACYAVVGGIFAIRTRHPLLVKSTRQAGIATCALIF |
| Ga0318532_100562631 | 3300032051 | Soil | MDVFGSFSLLLAFVCACYAVVGGIFAIRTRHPLLVKSTRQAGIAT |
| Ga0318533_103584703 | 3300032059 | Soil | MDVFGSFSLLLAFVCAVYAFVGGIFAIKTRHPLLIK |
| Ga0318513_106319082 | 3300032065 | Soil | MDVFGSFSLLLAFVCACYAVVGGIFAIRTRHPLLVKSTRQAGIATCALI |
| Ga0306924_122964221 | 3300032076 | Soil | MDVFGSFTLLLAFVCAAYAFVGGIAAIITRHPLLVKSTRQAGMATC |
| Ga0316051_10220491 | 3300032119 | Soil | LDLFGSYALLLAFLCDLYAFFGGIAAIITRKPLLIK |
| Ga0307470_103895621 | 3300032174 | Hardwood Forest Soil | MDVFGSFALILAFVCAVYAFVGGIAAVITRHPLLIKSARQAGIAV |
| Ga0307471_1025408211 | 3300032180 | Hardwood Forest Soil | MDVFGSFTLLLAFVCAVYALVGGIAAIITRHPLLVKSTRQAGMA |
| Ga0306920_1015628033 | 3300032261 | Soil | VDVFGSFAILLAFICAAYAFVGGIAAIRTRHPLLIKSA |
| Ga0306920_1022049421 | 3300032261 | Soil | MDVFGSFALILAYVCALYAFGGGIAAILTRHPLLIKSAR |
| Ga0348332_140940732 | 3300032515 | Plant Litter | VDVFGSFALILAFICAVYAFGGGIAAIITRHPLLVKSTRQAGIATCCLIF |
| Ga0348332_141484262 | 3300032515 | Plant Litter | LDLFGSYALLLAFLCGLYAFFGGIAAIITRKPLLIKSARN |
| Ga0335085_115786232 | 3300032770 | Soil | VDVFGSFALLLAFVCALYALAGGVAAIFTRHPLLIK |
| Ga0335082_103793713 | 3300032782 | Soil | MDVFGSFSLLLAFVCAVYAFVGGIFAIKTRHPLLVKS |
| Ga0335081_126975811 | 3300032892 | Soil | MDVFGSFSLLLAFVCAVYAFIGGIFAIKTRHPLLVKS |
| Ga0335076_112261732 | 3300032955 | Soil | MDVFGSFSLLLAFVCAVYAFVGGIFAIKTRHPLLVKSARQA |
| Ga0335076_113831682 | 3300032955 | Soil | MDVFGSFSLLLAFVCAVYAFIGGIFAIRTRHPLLVKSTR |
| Ga0335084_105777061 | 3300033004 | Soil | MDVFGSFTLLLAFVCAVYAFAGGIAAIKTRHPLLVKSTHQAGI |
| Ga0310914_117143292 | 3300033289 | Soil | MDVFGSFALILAFVCAAYAFAGGIAAIITRHPLLIK |
| Ga0314861_0341010_530_667 | 3300033977 | Peatland | MDVFGNFSLLLAFVCAMYAFVGGIAAIWTRHPLLIKSTRQSGMAAC |
| Ga0334822_087427_3_110 | 3300034070 | Soil | MDVFGSFTLLLAFVCAVYAFVGGIAAIITRHPLLVK |
| ⦗Top⦘ |