| Basic Information | |
|---|---|
| Family ID | F023278 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 210 |
| Average Sequence Length | 46 residues |
| Representative Sequence | YSALKTYLLFLSCMPERVRGIKGHDIISSDIPVDMKIAEILRTK |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 210 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.48 % |
| % of genes near scaffold ends (potentially truncated) | 95.24 % |
| % of genes from short scaffolds (< 2000 bps) | 90.95 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.714 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.762 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 8.33% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 210 Family Scaffolds |
|---|---|---|
| PF07691 | PA14 | 13.33 |
| PF13385 | Laminin_G_3 | 11.43 |
| PF01391 | Collagen | 3.33 |
| PF10528 | GLEYA | 3.33 |
| PF00629 | MAM | 2.38 |
| PF00182 | Glyco_hydro_19 | 1.43 |
| PF01541 | GIY-YIG | 0.48 |
| PF12810 | Gly_rich | 0.48 |
| PF02511 | Thy1 | 0.48 |
| PF02867 | Ribonuc_red_lgC | 0.48 |
| PF00147 | Fibrinogen_C | 0.48 |
| PF00085 | Thioredoxin | 0.48 |
| PF00565 | SNase | 0.48 |
| PF11351 | GTA_holin_3TM | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 1.43 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 1.43 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.48 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.29 % |
| Unclassified | root | N/A | 45.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001849|RCM26_1031027 | Not Available | 1537 | Open in IMG/M |
| 3300001850|RCM37_1163648 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300002144|M2t2BS2_10175318 | Not Available | 918 | Open in IMG/M |
| 3300002408|B570J29032_108987956 | Not Available | 559 | Open in IMG/M |
| 3300003393|JGI25909J50240_1088390 | Not Available | 618 | Open in IMG/M |
| 3300003411|JGI25911J50253_10108527 | Not Available | 837 | Open in IMG/M |
| 3300004096|Ga0066177_10140740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300005527|Ga0068876_10136570 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1447 | Open in IMG/M |
| 3300005527|Ga0068876_10391808 | Not Available | 776 | Open in IMG/M |
| 3300005527|Ga0068876_10407368 | Not Available | 757 | Open in IMG/M |
| 3300005581|Ga0049081_10114290 | Not Available | 1001 | Open in IMG/M |
| 3300005581|Ga0049081_10122552 | Not Available | 961 | Open in IMG/M |
| 3300005581|Ga0049081_10169663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
| 3300005581|Ga0049081_10296757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300005582|Ga0049080_10260806 | Not Available | 564 | Open in IMG/M |
| 3300005582|Ga0049080_10277259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300005584|Ga0049082_10142924 | Not Available | 831 | Open in IMG/M |
| 3300005662|Ga0078894_11754068 | Not Available | 508 | Open in IMG/M |
| 3300006030|Ga0075470_10103533 | Not Available | 850 | Open in IMG/M |
| 3300007538|Ga0099851_1176764 | Not Available | 785 | Open in IMG/M |
| 3300007539|Ga0099849_1024899 | Not Available | 2588 | Open in IMG/M |
| 3300007539|Ga0099849_1061701 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
| 3300007622|Ga0102863_1075366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 989 | Open in IMG/M |
| 3300007992|Ga0105748_10288005 | Not Available | 695 | Open in IMG/M |
| 3300007992|Ga0105748_10530871 | Not Available | 516 | Open in IMG/M |
| 3300008107|Ga0114340_1040820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2076 | Open in IMG/M |
| 3300008107|Ga0114340_1136937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300008110|Ga0114343_1119336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300008113|Ga0114346_1316540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300008116|Ga0114350_1179611 | Not Available | 545 | Open in IMG/M |
| 3300008120|Ga0114355_1035524 | All Organisms → Viruses → Predicted Viral | 2423 | Open in IMG/M |
| 3300008266|Ga0114363_1076818 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1255 | Open in IMG/M |
| 3300008267|Ga0114364_1003893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9745 | Open in IMG/M |
| 3300008267|Ga0114364_1080541 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300008448|Ga0114876_1086666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1285 | Open in IMG/M |
| 3300008448|Ga0114876_1088214 | Not Available | 1268 | Open in IMG/M |
| 3300008448|Ga0114876_1264043 | Not Available | 522 | Open in IMG/M |
| 3300008450|Ga0114880_1098371 | Not Available | 1136 | Open in IMG/M |
| 3300008450|Ga0114880_1258474 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009026|Ga0102829_1090152 | Not Available | 949 | Open in IMG/M |
| 3300009056|Ga0102860_1138733 | Not Available | 685 | Open in IMG/M |
| 3300009068|Ga0114973_10045361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2610 | Open in IMG/M |
| 3300009068|Ga0114973_10411925 | Not Available | 707 | Open in IMG/M |
| 3300009131|Ga0115027_11567139 | Not Available | 543 | Open in IMG/M |
| 3300009152|Ga0114980_10621135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300009152|Ga0114980_10746966 | Not Available | 546 | Open in IMG/M |
| 3300009154|Ga0114963_10425936 | Not Available | 716 | Open in IMG/M |
| 3300009158|Ga0114977_10095806 | Not Available | 1804 | Open in IMG/M |
| 3300009159|Ga0114978_10046835 | All Organisms → Viruses → Predicted Viral | 3004 | Open in IMG/M |
| 3300009159|Ga0114978_10317228 | Not Available | 950 | Open in IMG/M |
| 3300009161|Ga0114966_10015480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5908 | Open in IMG/M |
| 3300009163|Ga0114970_10118981 | Not Available | 1617 | Open in IMG/M |
| 3300009163|Ga0114970_10763531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300009180|Ga0114979_10042221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2872 | Open in IMG/M |
| 3300009181|Ga0114969_10294730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300009182|Ga0114959_10258790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300009183|Ga0114974_10145465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1486 | Open in IMG/M |
| 3300009185|Ga0114971_10306849 | Not Available | 916 | Open in IMG/M |
| 3300009185|Ga0114971_10525305 | Not Available | 660 | Open in IMG/M |
| 3300009185|Ga0114971_10574593 | Not Available | 625 | Open in IMG/M |
| 3300009230|Ga0103855_10040237 | All Organisms → Viruses | 835 | Open in IMG/M |
| 3300010157|Ga0114964_10167422 | Not Available | 1064 | Open in IMG/M |
| 3300010160|Ga0114967_10423650 | Not Available | 660 | Open in IMG/M |
| 3300010293|Ga0116204_1281122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 520 | Open in IMG/M |
| 3300011010|Ga0139557_1019136 | Not Available | 1265 | Open in IMG/M |
| 3300011010|Ga0139557_1022238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1154 | Open in IMG/M |
| 3300011011|Ga0139556_1066006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300011116|Ga0151516_11196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10822 | Open in IMG/M |
| 3300012667|Ga0157208_10048225 | Not Available | 579 | Open in IMG/M |
| 3300012968|Ga0129337_1048132 | Not Available | 618 | Open in IMG/M |
| 3300013006|Ga0164294_10593809 | Not Available | 751 | Open in IMG/M |
| 3300013094|Ga0164297_10087579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1350 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10703585 | Not Available | 638 | Open in IMG/M |
| 3300017701|Ga0181364_1022652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1032 | Open in IMG/M |
| 3300017722|Ga0181347_1099575 | Not Available | 830 | Open in IMG/M |
| 3300017722|Ga0181347_1156900 | Not Available | 619 | Open in IMG/M |
| 3300017736|Ga0181365_1041204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1160 | Open in IMG/M |
| 3300017736|Ga0181365_1066339 | Not Available | 893 | Open in IMG/M |
| 3300017761|Ga0181356_1047287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1493 | Open in IMG/M |
| 3300017761|Ga0181356_1139200 | Not Available | 760 | Open in IMG/M |
| 3300017761|Ga0181356_1207221 | All Organisms → Viruses | 577 | Open in IMG/M |
| 3300017774|Ga0181358_1115711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 947 | Open in IMG/M |
| 3300017774|Ga0181358_1233174 | All Organisms → Viruses | 586 | Open in IMG/M |
| 3300017774|Ga0181358_1276087 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300017774|Ga0181358_1290769 | Not Available | 501 | Open in IMG/M |
| 3300017777|Ga0181357_1082727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1227 | Open in IMG/M |
| 3300017777|Ga0181357_1108314 | Not Available | 1049 | Open in IMG/M |
| 3300017777|Ga0181357_1181839 | Not Available | 760 | Open in IMG/M |
| 3300017777|Ga0181357_1276681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300017777|Ga0181357_1301126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300017777|Ga0181357_1340312 | Not Available | 500 | Open in IMG/M |
| 3300017778|Ga0181349_1036089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1975 | Open in IMG/M |
| 3300017778|Ga0181349_1095035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| 3300017778|Ga0181349_1111073 | Not Available | 1018 | Open in IMG/M |
| 3300017778|Ga0181349_1279322 | Not Available | 547 | Open in IMG/M |
| 3300017780|Ga0181346_1146402 | Not Available | 887 | Open in IMG/M |
| 3300017780|Ga0181346_1313688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 529 | Open in IMG/M |
| 3300017784|Ga0181348_1073485 | Not Available | 1365 | Open in IMG/M |
| 3300017784|Ga0181348_1108862 | All Organisms → Viruses | 1075 | Open in IMG/M |
| 3300017785|Ga0181355_1199108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300017785|Ga0181355_1362681 | Not Available | 531 | Open in IMG/M |
| 3300018420|Ga0181563_10746509 | Not Available | 538 | Open in IMG/M |
| 3300018428|Ga0181568_11295677 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 544 | Open in IMG/M |
| 3300019784|Ga0181359_1019382 | All Organisms → Viruses → Predicted Viral | 2562 | Open in IMG/M |
| 3300019784|Ga0181359_1022805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWF2_44_8 | 2381 | Open in IMG/M |
| 3300020048|Ga0207193_1545835 | Not Available | 770 | Open in IMG/M |
| 3300020074|Ga0194113_10422933 | Not Available | 973 | Open in IMG/M |
| 3300020159|Ga0211734_10517341 | Not Available | 526 | Open in IMG/M |
| 3300020160|Ga0211733_10370847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1173 | Open in IMG/M |
| 3300020161|Ga0211726_10115435 | Not Available | 814 | Open in IMG/M |
| 3300020161|Ga0211726_10200659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1667 | Open in IMG/M |
| 3300020161|Ga0211726_10609261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 940 | Open in IMG/M |
| 3300020161|Ga0211726_10888453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 974 | Open in IMG/M |
| 3300020172|Ga0211729_10526194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1181 | Open in IMG/M |
| 3300020172|Ga0211729_11213592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
| 3300020179|Ga0194134_10122896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1225 | Open in IMG/M |
| 3300020183|Ga0194115_10117914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
| 3300020198|Ga0194120_10437803 | Not Available | 606 | Open in IMG/M |
| 3300020221|Ga0194127_10234690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
| 3300020553|Ga0208855_1037463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300020554|Ga0208599_1033612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300021141|Ga0214163_1130218 | Not Available | 558 | Open in IMG/M |
| 3300021519|Ga0194048_10292946 | Not Available | 587 | Open in IMG/M |
| 3300021961|Ga0222714_10061651 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2532 | Open in IMG/M |
| 3300021961|Ga0222714_10595888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300021962|Ga0222713_10196431 | Not Available | 1354 | Open in IMG/M |
| 3300021963|Ga0222712_10015390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6627 | Open in IMG/M |
| 3300021963|Ga0222712_10219393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1234 | Open in IMG/M |
| 3300021963|Ga0222712_10565116 | Not Available | 662 | Open in IMG/M |
| 3300022190|Ga0181354_1249641 | Not Available | 506 | Open in IMG/M |
| 3300022198|Ga0196905_1014122 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2586 | Open in IMG/M |
| 3300022407|Ga0181351_1039755 | All Organisms → Viruses → Predicted Viral | 1987 | Open in IMG/M |
| 3300022407|Ga0181351_1073799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1375 | Open in IMG/M |
| 3300022752|Ga0214917_10384749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300023174|Ga0214921_10329821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300023184|Ga0214919_10507500 | Not Available | 741 | Open in IMG/M |
| 3300024346|Ga0244775_10513899 | Not Available | 977 | Open in IMG/M |
| 3300024552|Ga0256345_1011294 | All Organisms → Viruses → Predicted Viral | 1756 | Open in IMG/M |
| 3300025674|Ga0208162_1079649 | Not Available | 1017 | Open in IMG/M |
| 3300025687|Ga0208019_1119405 | Not Available | 783 | Open in IMG/M |
| 3300025687|Ga0208019_1203512 | Not Available | 516 | Open in IMG/M |
| 3300025889|Ga0208644_1316438 | Not Available | 612 | Open in IMG/M |
| 3300026562|Ga0255285_1052077 | Not Available | 813 | Open in IMG/M |
| 3300027213|Ga0208555_1065515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 555 | Open in IMG/M |
| 3300027586|Ga0208966_1084382 | Not Available | 881 | Open in IMG/M |
| 3300027621|Ga0208951_1079747 | Not Available | 914 | Open in IMG/M |
| 3300027631|Ga0208133_1127652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300027659|Ga0208975_1152220 | Not Available | 644 | Open in IMG/M |
| 3300027732|Ga0209442_1163588 | Not Available | 848 | Open in IMG/M |
| 3300027733|Ga0209297_1295550 | Not Available | 606 | Open in IMG/M |
| 3300027736|Ga0209190_1133542 | Not Available | 1097 | Open in IMG/M |
| 3300027736|Ga0209190_1134341 | Not Available | 1092 | Open in IMG/M |
| 3300027736|Ga0209190_1391603 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 502 | Open in IMG/M |
| 3300027754|Ga0209596_1141910 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300027754|Ga0209596_1237761 | Not Available | 755 | Open in IMG/M |
| 3300027759|Ga0209296_1239019 | Not Available | 754 | Open in IMG/M |
| 3300027770|Ga0209086_10266233 | Not Available | 749 | Open in IMG/M |
| 3300027772|Ga0209768_10055788 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
| 3300027772|Ga0209768_10257514 | Not Available | 753 | Open in IMG/M |
| 3300027793|Ga0209972_10203430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 916 | Open in IMG/M |
| 3300027798|Ga0209353_10085498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300027798|Ga0209353_10276847 | Not Available | 716 | Open in IMG/M |
| 3300027798|Ga0209353_10373960 | All Organisms → Viruses | 590 | Open in IMG/M |
| 3300027808|Ga0209354_10389442 | Not Available | 543 | Open in IMG/M |
| 3300027816|Ga0209990_10001731 | All Organisms → Viruses | 18122 | Open in IMG/M |
| 3300027816|Ga0209990_10094116 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1460 | Open in IMG/M |
| 3300027816|Ga0209990_10160712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
| 3300027892|Ga0209550_10243146 | All Organisms → Viruses | 1194 | Open in IMG/M |
| 3300028394|Ga0304730_1093117 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300031758|Ga0315907_10421727 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300031758|Ga0315907_10730343 | Not Available | 749 | Open in IMG/M |
| 3300031784|Ga0315899_10290074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1621 | Open in IMG/M |
| 3300031787|Ga0315900_10205388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1738 | Open in IMG/M |
| 3300031787|Ga0315900_10821183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300031857|Ga0315909_10120856 | Not Available | 2215 | Open in IMG/M |
| 3300031857|Ga0315909_10282178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1253 | Open in IMG/M |
| 3300031857|Ga0315909_10320779 | Not Available | 1147 | Open in IMG/M |
| 3300031857|Ga0315909_10340674 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
| 3300031857|Ga0315909_10363898 | Not Available | 1052 | Open in IMG/M |
| 3300031857|Ga0315909_10605854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300031857|Ga0315909_10726854 | Not Available | 640 | Open in IMG/M |
| 3300031857|Ga0315909_10890452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300031951|Ga0315904_10259474 | Not Available | 1658 | Open in IMG/M |
| 3300031951|Ga0315904_10361683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300031963|Ga0315901_10230832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1578 | Open in IMG/M |
| 3300031963|Ga0315901_10530819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 909 | Open in IMG/M |
| 3300031963|Ga0315901_10682482 | Not Available | 765 | Open in IMG/M |
| 3300031963|Ga0315901_10963902 | Not Available | 600 | Open in IMG/M |
| 3300032050|Ga0315906_10515242 | All Organisms → Viruses | 1008 | Open in IMG/M |
| 3300032093|Ga0315902_10457613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
| 3300032093|Ga0315902_10775069 | Not Available | 763 | Open in IMG/M |
| 3300032116|Ga0315903_10232776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
| 3300032116|Ga0315903_10236957 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1588 | Open in IMG/M |
| 3300032116|Ga0315903_10318696 | Not Available | 1304 | Open in IMG/M |
| 3300032116|Ga0315903_10348430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1228 | Open in IMG/M |
| 3300032116|Ga0315903_10657575 | Not Available | 792 | Open in IMG/M |
| 3300032116|Ga0315903_10981862 | Not Available | 593 | Open in IMG/M |
| 3300033981|Ga0334982_0425312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300034018|Ga0334985_0081488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2326 | Open in IMG/M |
| 3300034019|Ga0334998_0205873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1220 | Open in IMG/M |
| 3300034062|Ga0334995_0285105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1091 | Open in IMG/M |
| 3300034072|Ga0310127_126019 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300034073|Ga0310130_0198482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 624 | Open in IMG/M |
| 3300034082|Ga0335020_0160712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → unclassified Chromatiaceae → Chromatiaceae bacterium | 1131 | Open in IMG/M |
| 3300034082|Ga0335020_0345356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300034082|Ga0335020_0464798 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter cryophilus | 604 | Open in IMG/M |
| 3300034101|Ga0335027_0529821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300034103|Ga0335030_0651260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300034111|Ga0335063_0079964 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2011 | Open in IMG/M |
| 3300034116|Ga0335068_0521106 | All Organisms → Viruses | 547 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 13.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.10% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.76% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.29% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.86% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.95% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.95% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.95% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.95% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.95% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.95% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.48% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.48% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.48% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.48% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.48% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009230 | Microbial communities of water from Amazon river, Brazil - RCM8 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM26_10310275 | 3300001849 | Marine Plankton | YNVFGIEPTTRMLFYKVVEDDYPALKTYLLFLNNMPGVVKGIKGKDIISSNIEVDLKIAEILRQIK* |
| RCM37_11636481 | 3300001850 | Marine Plankton | CNVFSPEIAARLLFFKVAKEDYSALKTYLLFLSVMPEKIRGIKGQDIQSSEIPVDLKIAEVLRNIK* |
| M2t2BS2_101753182 | 3300002144 | Marine | IFLSCMPERVIGIRGHDILSSTIPVDMQIAQTLRTIK* |
| B570J29032_1089879561 | 3300002408 | Freshwater | HTNKDDYSILKTYLLFLNLMPEKVRGINNTDILSSDISVDMKVAEVLRNLK* |
| JGI25909J50240_10883901 | 3300003393 | Freshwater Lake | FKVAKDDYSALKTYLLFLSCMPERVKGIKGHDIVSSDIPVDMKIAEILRTK* |
| JGI25911J50253_101085271 | 3300003411 | Freshwater Lake | KTYLLFLSCMPERVRGIKGHDIISSEIPVDMTIANILRTK* |
| Ga0066177_101407401 | 3300004096 | Freshwater Lake | VEVATRMLFFKVAKDDYAVLKTYLLFLNYMPQVIRGIKGQDLLSSDIAVDMRIAEVLRNIK* |
| Ga0068876_101365701 | 3300005527 | Freshwater Lake | NKDDYSILKTYLLFLNLMPEKVRGINNTDIISSEIPVDMNVAEVLRNLK* |
| Ga0068876_103918082 | 3300005527 | Freshwater Lake | LKTYLLFLSYMPERVRGIKGQDIHSSDVPVDMTIADTLRKIK* |
| Ga0068876_104073682 | 3300005527 | Freshwater Lake | NKDDYSILKTYLLFLNLMPEKVRGINNTDIISSEIPVDMSVAEVLRNLK* |
| Ga0049081_101142903 | 3300005581 | Freshwater Lentic | FKMSKDDYSALKTYLLFLSCMPEKVRGIKGQDLISSEIPVDMTIADILRTK* |
| Ga0049081_101225521 | 3300005581 | Freshwater Lentic | YLLFLSIMPEKIRGIKGHDIISSDIPVDKRIADILREIK* |
| Ga0049081_101696633 | 3300005581 | Freshwater Lentic | AKDDYAVLKTYLLFLNYMPQVIRGIKGQDLLSSDIAVDMRIAEVLRNIK* |
| Ga0049081_102967572 | 3300005581 | Freshwater Lentic | SCMPDVVRGIKGQDILSSEISVDMGIAETLREIK* |
| Ga0049080_102608063 | 3300005582 | Freshwater Lentic | FKISKSDWSALKTYLLFLSYMPMTVKGIKGIDVNSSDIPVDMTIAEVLRTIK* |
| Ga0049080_102772592 | 3300005582 | Freshwater Lentic | YNVFGAEVVARLLFFKVAKDDYSTLKTYLLFLSCMPERVRGIKGHDIISSEIPVDMKIAEILRTK* |
| Ga0049082_101429241 | 3300005584 | Freshwater Lentic | LFLSCMPDVVRGIKGQDIISSEISVDMNVAEILRTIK* |
| Ga0078894_117540681 | 3300005662 | Freshwater Lake | LKTYLLFLNLMPEKVIGIKGKDIVSSDILVDMDIAETLREIK* |
| Ga0075470_101035332 | 3300006030 | Aqueous | STSDYSQLKTYLLFLSCMPDVIVGIKGKNILSSSIEVDMKIANVLRTLK* |
| Ga0099851_11767641 | 3300007538 | Aqueous | LIFLSCMPDRVNGIRGHDILSSTIPVDMQIAQTLRTIK* |
| Ga0099849_10248991 | 3300007539 | Aqueous | KTYLIFLSCMPDRVNGIRGHDILSSTIPVDMQIAQTLRTIK* |
| Ga0099849_10617011 | 3300007539 | Aqueous | TRLLFLKMSKDDYSALKTYLIFLSCMPERVIGIKGHDILSSEIPVDMTIAESLRKIK* |
| Ga0102863_10753663 | 3300007622 | Estuarine | YSALKTYLLFLSCMPERVRGIKGHDIISSDIPVDMKIAEILRTK* |
| Ga0105748_102880051 | 3300007992 | Estuary Water | KTYLLFLSCMPDVVYGIKGHDVRSSDISIDVVIADALRKIK* |
| Ga0105748_105308712 | 3300007992 | Estuary Water | FFKMPKDDYPALKTYLLFLSIMPEKIRGIKGHDITSSDIPVDNRIADILREIK* |
| Ga0114340_10408201 | 3300008107 | Freshwater, Plankton | DYSTLKTYLLFLSYMPERVRGIKGQDIISSDVPVDMVVAKTLRDLK* |
| Ga0114340_11369372 | 3300008107 | Freshwater, Plankton | MLFLSYMPERVRGIKGQDIISSDVPVDMVVAQTLRDLK* |
| Ga0114343_11193363 | 3300008110 | Freshwater, Plankton | DYSTLKTYLLFLSYMPERVRGIKGQDIISSDVPVDMVVAQILRDLK* |
| Ga0114346_13165401 | 3300008113 | Freshwater, Plankton | KTYLLFLSCMPERVRGIKGHDIISSEIPVDMKIAEILRTK* |
| Ga0114350_11796111 | 3300008116 | Freshwater, Plankton | LFLNLMPEKVRGINNTDIISSEIPVDMNVAEVLRNLK* |
| Ga0114355_10355241 | 3300008120 | Freshwater, Plankton | SYMPERVRGIKGQDIISSDVPVDMVVAQTLRNLK* |
| Ga0114363_10768181 | 3300008266 | Freshwater, Plankton | DDYSILKTYLLFLNLMPEKVRGINNTDIISSEIPVDMNVAEVLRNLK* |
| Ga0114364_100389317 | 3300008267 | Freshwater, Plankton | KMAKEDYSAIKTYLLFLSHMPDIVRGIRGQNLLSSDIPVDMNIANTLRKIK* |
| Ga0114364_10805414 | 3300008267 | Freshwater, Plankton | LKTYLLFLSCMPERVRGIKGHDIISSEIPVDMKIADILRTK* |
| Ga0114876_10866661 | 3300008448 | Freshwater Lake | KTYLLFLSYMPERVRGIKGQDIISSDVPVDMVVAQTLRNLK* |
| Ga0114876_10882144 | 3300008448 | Freshwater Lake | AIKTYLLFLSHMPDIVRGIRGQNLLSSDIPVDMNIANTLRRIK* |
| Ga0114876_12640431 | 3300008448 | Freshwater Lake | ALKTYLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK* |
| Ga0114880_10983713 | 3300008450 | Freshwater Lake | KMAKEDYSAIKTYLLFLSHMPDIVRGIRGQNLLSSDIPVDMNIANTLRRIK* |
| Ga0114880_12584742 | 3300008450 | Freshwater Lake | LKTYLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK* |
| Ga0102829_10901521 | 3300009026 | Estuarine | KLLFFQMSKDDYSALKTYLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK* |
| Ga0102860_11387332 | 3300009056 | Estuarine | REDYSAIKTYLLFLSHMPDVVLGIRGQNLLSSDIPVDMNIANTLRKIK* |
| Ga0114973_100453611 | 3300009068 | Freshwater Lake | TRMLFFKISKSDWSALKTYLLFLSYMPMTVKGIKGVDINSSDIPVDMNIAEVLRTIK* |
| Ga0114973_104119251 | 3300009068 | Freshwater Lake | IAKEDYPALKTYLVFLSCMPERVKGIRGQDILSSDIAVDTKVANTLREFK* |
| Ga0115027_115671391 | 3300009131 | Wetland | KTYLLFLSCMPDVVRGINGKDIISSNIEVDLEIANVLRTIK* |
| Ga0114980_106211351 | 3300009152 | Freshwater Lake | DDYSALKTYLLFLSCMPEKVKGIKGQDLISSDIPVDMTIADILRTK* |
| Ga0114980_107469661 | 3300009152 | Freshwater Lake | PALKTYLVFLSCMPERVKGIKGQDILSSDIAVDTKVANTLREFK* |
| Ga0114963_104259362 | 3300009154 | Freshwater Lake | LSCMPEKVRGIKGHDIISSEIPVDMTIADILRTK* |
| Ga0114977_100958061 | 3300009158 | Freshwater Lake | YKIAKEDYPALKTYLVFLSCMPERVKGIKGQDILSSDIPVDSKVANTLREIK* |
| Ga0114978_100468359 | 3300009159 | Freshwater Lake | LNYMPAVVHGIKGQDIISSEIPVDMKIAEVLREIK* |
| Ga0114978_103172281 | 3300009159 | Freshwater Lake | PEAATRLLFYKMAKDDFPALKTYLLFLSVMPERIKGIKGVDIVSSDIPVDMKIADTLRDIK* |
| Ga0114966_1001548014 | 3300009161 | Freshwater Lake | FLSCMPDVVRGIKGQDIISSEISVDTGVAEILREIK* |
| Ga0114970_101189811 | 3300009163 | Freshwater Lake | RLLFYKIAKEDYPALKTYLVFLSCMPERVKGIKGQDILSSDIPVDTKVANTLREFK* |
| Ga0114970_107635312 | 3300009163 | Freshwater Lake | YLLFLNYMPAVVHGIKGQDIVSSEIPVDMKIAEVLREIK* |
| Ga0114979_100422219 | 3300009180 | Freshwater Lake | ALKTYLLFLSCMPERGKGIKGHDIISSDIPVDMKIAEILRTK* |
| Ga0114969_102947303 | 3300009181 | Freshwater Lake | LLFLSCMPDRIKGIKGQDIISSEISVDMKIAEILRTK* |
| Ga0114959_102587901 | 3300009182 | Freshwater Lake | FLSCMPDVVRGIKGQDIISSEISVDMGVAEILRTIK* |
| Ga0114974_101454655 | 3300009183 | Freshwater Lake | FKVAKDDYSALKTYLLFLSCMPERVKGIKGHDIISSDIPVDMKIAEILRTK* |
| Ga0114971_103068492 | 3300009185 | Freshwater Lake | LSCMPERVKGIKGHDIISSDIPVDMKIAEILRTK* |
| Ga0114971_105253051 | 3300009185 | Freshwater Lake | FLSCMPDVVRGIKGQDIPSSEISVDMNIAEILRTIK* |
| Ga0114971_105745931 | 3300009185 | Freshwater Lake | YLLFLSCMPDVVRGIKGQDIPSSEISVDMNIAEILRTIK* |
| Ga0103855_100402371 | 3300009230 | River Water | MLFYQLDKDSYSALKTFLIFLNYMPNVVRGIDGIDIISSDILIDMKIAEVLREIK* |
| Ga0114964_101674223 | 3300010157 | Freshwater Lake | LLYLNLMPEKVIGIKGKNIESSLIPVQLDVAEILRKI* |
| Ga0114967_104236501 | 3300010160 | Freshwater Lake | NVFGVEVAIRLLFYRMLKDDYSALKTYLLFLNLMPEKVIGIKGKDIVSSDILVDMDIADTLREIK* |
| Ga0116204_12811221 | 3300010293 | Anoxic Lake Water | SKDDYSALKTYLMFINCMPEKIRGVKGQDIISSDIPVDMKIADVLRQIK* |
| Ga0139557_10191361 | 3300011010 | Freshwater | AEVVARLLFFKVAKDDYSALKTYLLFLSCMPERVKGIKGHDIVSSDIPVDMKIAEILRTK |
| Ga0139557_10222383 | 3300011010 | Freshwater | DDYSALKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIADILRTK* |
| Ga0139556_10660063 | 3300011011 | Freshwater | FLSIMPEKIRGIKGHDIISSDIPVDKRIADILREIK* |
| Ga0151516_1119617 | 3300011116 | Freshwater | ALKTYLLFLSCMPEKVKGIKGHDIISSEISVDMTIAHALRQIK* |
| Ga0157208_100482251 | 3300012667 | Freshwater | YNVFGVETATRVLFFRVLKDDYSALKTYLTFLNYMPEKVRGIKGHDIISSDIPVDLVIAQKLREIK* |
| Ga0129337_10481321 | 3300012968 | Aqueous | TFLLFLNIMPNRVKGIRGKDIVSSNILIDMKIAEELRKLK* |
| Ga0164294_105938093 | 3300013006 | Freshwater | ALKTYLLFLSFMPEKIKSIKGHDILSSDIPVDMRIADTLRTK* |
| Ga0164297_100875794 | 3300013094 | Freshwater | LKTFLLYLNLMPEKIIGIKGKDIESALIPVQLDVAEILRKI* |
| (restricted) Ga0172372_107035851 | 3300013132 | Freshwater | DYSALKTYLIFLNWMPNVVKGIKGQDIRSSDIEVDMTIAEALRKIK* |
| Ga0181364_10226521 | 3300017701 | Freshwater Lake | LFLSIMPEKIRGIKGHDIISSDIPVDKRIADILREIK |
| Ga0181347_10995752 | 3300017722 | Freshwater Lake | SALKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0181347_11569002 | 3300017722 | Freshwater Lake | NVFGVEVAIRLLFYRMLKDDYSALKTYLLFLNLMPEKVIGIKGKDIVSSDILVDMDIAETLREIK |
| Ga0181365_10412041 | 3300017736 | Freshwater Lake | KVSKDDFPVLNTYLLFLSFMSDVVKGIKGHDILSSEISIDTRIAEVLRQK |
| Ga0181365_10663391 | 3300017736 | Freshwater Lake | RRIERKFKILKDDFSALKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0181356_10472875 | 3300017761 | Freshwater Lake | FYKIEKEDHTVLKTYLIFLNYMPEKVVGIKGKDILSSNISLNMKIAEVLREIK |
| Ga0181356_11392001 | 3300017761 | Freshwater Lake | KDDYSALKTYLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0181356_12072211 | 3300017761 | Freshwater Lake | DYPALKTYLLFLSIMPEKIRGIKGHDIISSDIPVDKRIADILREIK |
| Ga0181358_11157112 | 3300017774 | Freshwater Lake | YLLFLSCMPDVVRGIKGQDIISSEISVDTGVAETLREIK |
| Ga0181358_12331742 | 3300017774 | Freshwater Lake | TRLLFFKLAKEDYSTLKTYLTFLSCMPERIKGIKGNDILSSDISIDMKIADILREIK |
| Ga0181358_12760872 | 3300017774 | Freshwater Lake | KTYLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0181358_12907691 | 3300017774 | Freshwater Lake | ILKDDFSALKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0181357_10827273 | 3300017777 | Freshwater Lake | FFKILKDDFSALKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0181357_11083143 | 3300017777 | Freshwater Lake | RLLFYKMAKDDYPALKTYLMFLSVMPDRVRGIKGQDIISSDIPVDMKIADMLRDIK |
| Ga0181357_11818392 | 3300017777 | Freshwater Lake | YLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0181357_12766812 | 3300017777 | Freshwater Lake | RLLFYKMAKDDYPALKTYLTFLSVMPDRVRGIKGQDIISSDIPVDMKIADMLRDIK |
| Ga0181357_13011261 | 3300017777 | Freshwater Lake | DDYPALKTYLMFLSVMPDRVRGIKGQDIISSDIPVDMKIADMLRDIK |
| Ga0181357_13403121 | 3300017777 | Freshwater Lake | ILKDDFSALKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0181349_10360891 | 3300017778 | Freshwater Lake | TYLVFLSCMPERIKSIKGHDIVSSDIPVDMKIADILREIK |
| Ga0181349_10950355 | 3300017778 | Freshwater Lake | SKDDFSALKTYLLFLSCMPERVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0181349_11110731 | 3300017778 | Freshwater Lake | YKMAKDDYPALKTYLMFLSVMPDRVRGIKGQDIISSDIPVDMKIADMLRDIK |
| Ga0181349_12793222 | 3300017778 | Freshwater Lake | SALKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0181346_11464021 | 3300017780 | Freshwater Lake | YLMFLSVMPDRVRGIKGQDIISSDIPVDMKIADMLRDIK |
| Ga0181346_13136882 | 3300017780 | Freshwater Lake | LFLSCMPDVVRGIKGQDIISSEISVDTGVAEILREIK |
| Ga0181348_10734855 | 3300017784 | Freshwater Lake | KTYLLFFSCMPERVKGIRGHDIISSEIPVDMAIANILRTK |
| Ga0181348_11088623 | 3300017784 | Freshwater Lake | PALKTYLMFLSVMPDRVRGIKGQDIISSDIPVDMKIADMLRDIK |
| Ga0181355_11991081 | 3300017785 | Freshwater Lake | KTYLLFLSCMPERVRGIKGHDIISSDIPVDMTIAEILRTK |
| Ga0181355_13626811 | 3300017785 | Freshwater Lake | YLLFLSCMPERVKGIKGHDIVSSDIPVDMKIADILRTK |
| Ga0181563_107465091 | 3300018420 | Salt Marsh | FLSYMPDVIKGIKGQDIISSEISVDMSIAEILRTIK |
| Ga0181568_112956773 | 3300018428 | Salt Marsh | EYYSALKTYLMSVNIMQDIVTGIKGEDIISSEIQVDMKIAEGLRKILKHE |
| Ga0181359_10193826 | 3300019784 | Freshwater Lake | YLLFLSCMPDVVRGIRGQDIISSEISVDMNIAEILREIK |
| Ga0181359_10228054 | 3300019784 | Freshwater Lake | LKTYLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0207193_15458352 | 3300020048 | Freshwater Lake Sediment | MSKEDYSSLKTYLLFLSCMPEVVRGIKGSDIMSSEIEIDSDIAHGLRKIK |
| Ga0194113_104229334 | 3300020074 | Freshwater Lake | SKDDYSTLKTYLLFLNYMPERIKGIRGHDILSSDINVDMKIANTLRKIK |
| Ga0211734_105173412 | 3300020159 | Freshwater | LLFLSCMPERVRGIKGHDIISSEIPVDMTVANSLRQIK |
| Ga0211733_103708473 | 3300020160 | Freshwater | KTYLLFLSCMPEKVKGIKGHDIISSEIPVDMAIAHTLREIK |
| Ga0211726_101154352 | 3300020161 | Freshwater | DYSALKTYLLFLSCMPEKVKGIKGHDIISSEISVDMTIAHALRQIK |
| Ga0211726_102006591 | 3300020161 | Freshwater | DYSALKTYLLFLSCMPEKVKGIKGHDIISSEISVDMTIAHALRQIQ |
| Ga0211726_106092613 | 3300020161 | Freshwater | SKDDYSALKTYLLFLSCMPEKVKGIKGHDIISSEISVDMTIAHALRQIK |
| Ga0211726_108884531 | 3300020161 | Freshwater | KDDYSALKTYLLFLSCMPEKVKGIKGHDIISSEISVDMTIAHALRQIK |
| Ga0211729_105261941 | 3300020172 | Freshwater | QMSKDDYSALKTYLLFLSCMPEKVKGIKGHDIISSEISVDMTIAHALRQIK |
| Ga0211729_112135921 | 3300020172 | Freshwater | MAKDDYSALKTYLLFLSCMPERVKGIKGHDIISSEIPVDMIIADILRTK |
| Ga0194134_101228964 | 3300020179 | Freshwater Lake | LKTYLLFLSCMPDRVRGIKGHDIISSEIPVDMTIAQTLRNLK |
| Ga0194115_101179141 | 3300020183 | Freshwater Lake | KDDYSTLKTYLLFLNYMPERIKGIRGHDILSSDINVDMKIANTLRKIK |
| Ga0194120_104378031 | 3300020198 | Freshwater Lake | AARALFFKLSKDDYSALKTYLMFINCMPEKIRGVKGQDIISSDIPVDMKIADVLRQIK |
| Ga0194127_102346901 | 3300020221 | Freshwater Lake | DYSTLKTYLLFLNYMPERIKGIRGHDILSSDINVDMKIANTLRKIK |
| Ga0208855_10374632 | 3300020553 | Freshwater | FFKVAKDDYAVLKTYLLFLNYMPQVIRGIKGQDLLSSDIAVDMRIAEVLRNIK |
| Ga0208599_10336123 | 3300020554 | Freshwater | RMLFFKVAKDDYAVLKTYLLFLNYMPQVIRGIKGQDLLSSDIAVDMRIAEVLRNIK |
| Ga0214163_11302182 | 3300021141 | Freshwater | VEVATRMLFYKMSKDDYSALKTYLIFLNYMPTVVHGIKGQNIISSEIPVDMKIAEVLREI |
| Ga0194048_102929461 | 3300021519 | Anoxic Zone Freshwater | LLFYKMARDDYPALKTYLVFLSVMPERIKGIKGVDIVSSDIPVDMKIADILREIK |
| Ga0222714_100616518 | 3300021961 | Estuarine Water | VFGPEAATRLLFYKMSKDDYSALKTYLVFLSVMPERVRGIKGQDVISSEIPVDFKIADVLRDIK |
| Ga0222714_105958882 | 3300021961 | Estuarine Water | LKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIADILRTK |
| Ga0222713_101964314 | 3300021962 | Estuarine Water | KMAKDDYSALKTYLLFLSCMPEVVRSIKGQDILSSDIPVDMIVAQALRKIK |
| Ga0222712_100153901 | 3300021963 | Estuarine Water | FKVAKDDYAVLKTYLLFLNYMPQVIRGIKGQDLLSSDIAVDMRIAEVLRNIK |
| Ga0222712_102193933 | 3300021963 | Estuarine Water | DYSALKTYLLFLSCMPEIVRGIKGHDIVSSDIPVDMNIAEILRTIK |
| Ga0222712_105651161 | 3300021963 | Estuarine Water | LFYMMAKDDHSALKTYLLFLSTMPEKIRGIRGNDILSSDIPVDMTIADELRKIK |
| Ga0181354_12496411 | 3300022190 | Freshwater Lake | KTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIADILRTK |
| Ga0196905_10141228 | 3300022198 | Aqueous | FVPLKTYLTFLNVMPEKVRGIKGKDIISSDIPLDNTLIKVLREIQ |
| Ga0181351_10397551 | 3300022407 | Freshwater Lake | DDFSALKTYLLFLSCMPERVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0181351_10737994 | 3300022407 | Freshwater Lake | LLFYKIAKEDYSALKTYLVFLSCMPERVKGIKGHDIVSSDIPVDMKIADILREIK |
| Ga0214917_103847491 | 3300022752 | Freshwater | KTYLVFLSCMPERVKGIKGHDIVSSDIPVDMKIADILREIK |
| Ga0214921_103298213 | 3300023174 | Freshwater | KTYLVFLSCMPERVKGIKGHDIVSSDIPVDMKIADILREIKXELVQV |
| Ga0214919_105075002 | 3300023184 | Freshwater | LKTYLLFLSCMPERVRGIKGHDIISSEIPVDMTIADVLRTK |
| Ga0244775_105138991 | 3300024346 | Estuarine | TYLLFLSCMPDVVKGIKGHDILSSEISIDTRIAEVLRQK |
| Ga0256345_10112941 | 3300024552 | Freshwater | FGPEIMTRLLFFEMSESDYPQLKTYLLFLSCMPEVVRGINGKDIISSNIEVDMEIANVLRTIK |
| Ga0208162_10796491 | 3300025674 | Aqueous | KTYLIFLSCMPDRVNGIRGHDILSSTIPVDMQIAQTLRTIK |
| Ga0208019_11194051 | 3300025687 | Aqueous | FKMSKDDYSALKTYLIFLSCMPDRVNGIRGHDILSSTIPVDMQIAQTLRTIK |
| Ga0208019_12035122 | 3300025687 | Aqueous | KEDYSALKTYLIFLSWMPERIKGIRGQDIHSSEISVDMTIADSLRKIK |
| Ga0208644_13164381 | 3300025889 | Aqueous | FKMAKEDYSAIKTYLLFLSHMPDIVRGIRGQNLLSSDIPVDMNIANTLRRIK |
| Ga0255285_10520771 | 3300026562 | Freshwater | QLKTYLLFLSCMPEVVRGINGKDIISSNIEVDMEIANVLRTIK |
| Ga0208555_10655152 | 3300027213 | Estuarine | KTYLLFLSCMPDVVRGIKGQDIPSSEIPVDMNIAEILRTIK |
| Ga0208966_10843821 | 3300027586 | Freshwater Lentic | LKTYLLFLSCMPEKVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0208951_10797471 | 3300027621 | Freshwater Lentic | ILFFKISKDDFSALKTYLLFLSCMPERVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0208133_11276521 | 3300027631 | Estuarine | YNVFGAEVVARLLFFKVAKDDYSALKSYLLFLSCMPERVKGIKGNDIVSSDIPVDMKIAEILRTK |
| Ga0208975_11522202 | 3300027659 | Freshwater Lentic | DDYPALKTYLLFLSIMPEKIRGIKGNDIISSDIPVDKRIADILREIK |
| Ga0209442_11635881 | 3300027732 | Freshwater Lake | YLLFLSCMPEKVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0209297_12955501 | 3300027733 | Freshwater Lake | LNYMPTVVHGIKGQDIISSEIPVDMKIAEVLREIK |
| Ga0209190_11335423 | 3300027736 | Freshwater Lake | MSKDDYSALKTYLLFLSCMPEKVKGIKGQDLISSDIPVDMTIADILRTK |
| Ga0209190_11343411 | 3300027736 | Freshwater Lake | AKEDYPALKTYLVFLSCMPERVKGIRGQDILSSDIPVDTKVANTLREIK |
| Ga0209190_13916031 | 3300027736 | Freshwater Lake | ALKTYLLFLSCMPERVKGIKGHDIISSDIPVDMKIAEILRTK |
| Ga0209596_11419101 | 3300027754 | Freshwater Lake | ITMKTYLLFLSCMPDRIKGIKGQDIISSEISVDMKIAEILRTK |
| Ga0209596_12377613 | 3300027754 | Freshwater Lake | KTYLLFLNLMPEKVIGIKGKDIVSSDILVDMDIAETLREIK |
| Ga0209296_12390193 | 3300027759 | Freshwater Lake | TYLVFLSCMPERVKGIRGQDILSSDIPVDTKVANTLREIK |
| Ga0209086_102662332 | 3300027770 | Freshwater Lake | KTYLLFLSCMPDVVKGIKGHDILSSEISIDTRIAEVLRQK |
| Ga0209768_100557881 | 3300027772 | Freshwater Lake | KTYLLFLSCMPERVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0209768_102575141 | 3300027772 | Freshwater Lake | LFLSCMPDVVRGIKGQDIISSEISVDMNVAEILRTIK |
| Ga0209972_102034301 | 3300027793 | Freshwater Lake | HTNKDDYSILKTYLLFLNLMPEKVRGINNTDIISSEIPVDMSVAEVLRNLK |
| Ga0209353_100854981 | 3300027798 | Freshwater Lake | ISKDDFSALKTYLLFLSCMPERVRGIKGHDIISSEIPVDMTIANILRTK |
| Ga0209353_102768472 | 3300027798 | Freshwater Lake | DYSALKTYLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0209353_103739601 | 3300027798 | Freshwater Lake | MAKDDYSALKTYLLFLSCMPEKVRGIKGQDLISSEIPVDMTIADILRTK |
| Ga0209354_103894421 | 3300027808 | Freshwater Lake | MSKDDYSALKTYLLFLSCMPERVKSIKGHDIISSEIPVDMIIADILRTK |
| Ga0209990_100017311 | 3300027816 | Freshwater Lake | YLLFLNLMPEKVRGINNTDIISSEIPVDMNVAEVLRNLK |
| Ga0209990_100941164 | 3300027816 | Freshwater Lake | HTNKDDYSILKTYLLFLNLMPEKVRGINNTDIISSEIPVDMNVAEVLRNLK |
| Ga0209990_101607124 | 3300027816 | Freshwater Lake | SALKTYLLFLSFMPEKIKSIKGHDIFSSDIPVDMRIADILRTK |
| Ga0209550_102431461 | 3300027892 | Freshwater Lake | PKDDYPALKTYLLFLSIMPEKIRGIKGHDIISSDIPVDKRIADILREIK |
| Ga0304730_10931174 | 3300028394 | Freshwater Lake | ATRLLFYKMAKDDFPALKTYLLFLSVMPERIKGIKGVDIVSSDIPVDMKIADILREIK |
| Ga0315907_104217273 | 3300031758 | Freshwater | DYSILKTYLLFLNLMPEKVRGINNTDIISSEIPVDMSVAEVLRNLK |
| Ga0315907_107303431 | 3300031758 | Freshwater | KIAKEDYSALKTYLVFLSCMPERVKGIKGHDILSSDIPVDMKIADILREIK |
| Ga0315899_102900745 | 3300031784 | Freshwater | KTYLIFLNYMPTVVHGIKGQDIISSEIPVDMKIAEVLREIK |
| Ga0315900_102053884 | 3300031787 | Freshwater | KTYLLFLSYMPERVRGIKGQDIISSDVPVDMVVAQTLRDLK |
| Ga0315900_108211832 | 3300031787 | Freshwater | VATRMLFFKVAKDDYAVLKTYLLFLNYMPQVIRGIKGQDLLSSDIAVDMRIAEVLRNIK |
| Ga0315909_101208567 | 3300031857 | Freshwater | KDDYSALKTYLLFLSFMPEKIKSIKGHDIFSSDIPVDMRIAEILRTK |
| Ga0315909_102821781 | 3300031857 | Freshwater | LLFLSYMPERVRGIKGQDIISSDVPVDMVVAQTLRNLK |
| Ga0315909_103207793 | 3300031857 | Freshwater | EDYSAIKTYLLFLSHMPDIVRGIRGQNLLSSDIPVDMNIANTLRRIK |
| Ga0315909_103406744 | 3300031857 | Freshwater | TYLVFLSCMPERVKGIKGHDIVSSDIPVDMKIADILREIK |
| Ga0315909_103638981 | 3300031857 | Freshwater | YLLFLSCMPEKVKGIKGHDIISSEISVDMTIAEILRSK |
| Ga0315909_106058542 | 3300031857 | Freshwater | YSTLKTYLLFLSCMPERVRGIKGHDIISSEIPVDMKIADILRTK |
| Ga0315909_107268542 | 3300031857 | Freshwater | LFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0315909_108904522 | 3300031857 | Freshwater | LLFLSYMPERVRGIKGQDIISSDVPVDMVVAQILRDLK |
| Ga0315904_102594741 | 3300031951 | Freshwater | MSKDDYSALKTYLLFLSFMPEKIKSIKGHDIFSSDIPVDMRIAEILRTK |
| Ga0315904_103616833 | 3300031951 | Freshwater | YSTLKTYLLFLSYMPERVRGIKGQDIISSDVPVDMVVAQTLRDLK |
| Ga0315901_102308324 | 3300031963 | Freshwater | TLKTYLLFLSYMPERVRGIKGQDIISSDVPVDMVVAKTLRDLK |
| Ga0315901_105308192 | 3300031963 | Freshwater | TNKDDYSILKTYLLFLNLMPEKVRGINNTDIISSEIPVDMSVAEVLRNLK |
| Ga0315901_106824821 | 3300031963 | Freshwater | LFLSCMPEKVRGIKGHDIISSEIPVDMTIADILRTK |
| Ga0315901_109639022 | 3300031963 | Freshwater | LKTYLVFLSCMPERVKGIKGHDIVSSDISVDMKIADILREIK |
| Ga0315906_105152421 | 3300032050 | Freshwater | YLVFLSCMPERIKSIKGHDIVSSDIPVDMKIADILREIK |
| Ga0315902_104576133 | 3300032093 | Freshwater | VVLSCMPERIKSIKGHDIVSSDIPVDMKIADILREIK |
| Ga0315902_107750691 | 3300032093 | Freshwater | ILKTYLLFLNLMPEKVRGINNTDIISSEIPVDMSVAEVLRNLK |
| Ga0315903_102327761 | 3300032116 | Freshwater | KDDYSALKTYLLFLSCMPEKVRGIKGQDLISSEIPVDMTIAEILRTK |
| Ga0315903_102369574 | 3300032116 | Freshwater | KTYLLFLNLMPEKVRGINNTDIISSEIPVDMNVAEVLRNLK |
| Ga0315903_103186963 | 3300032116 | Freshwater | VATRLLFFQMSKDDYSALKTYLLFLSCMPEKVKGIKGHDIISSEISVDMTIAEILRSK |
| Ga0315903_103484301 | 3300032116 | Freshwater | YSILKTYLLFLNLMPERVRGINGTDIISSDIPIDMNVAEVLRNLQ |
| Ga0315903_106575751 | 3300032116 | Freshwater | SALKTYLVFLSCMPERVKGIKGHDIVSSDIPVDMKIADILREIK |
| Ga0315903_109818621 | 3300032116 | Freshwater | FKISKSDWSALKTYLLFLSYMPMTVKGIKGVDINSSDIPVDMTIAEVLRTIK |
| Ga0334982_0425312_445_597 | 3300033981 | Freshwater | MSKDDYPALKTYLLFLSIMPDKIRGIKGHDITSSDIPVDNRIADILREIK |
| Ga0334985_0081488_2160_2324 | 3300034018 | Freshwater | LFFKVAKDDYAVLKTYLLFLNYMPQVIRGIKGQDLLSSDIAVDMRIAEVLRNIK |
| Ga0334998_0205873_51_200 | 3300034019 | Freshwater | MSKDDYSALKTYLLFLSCMPEKVKGIKGHDIISSEIPVDMTIAEILRTK |
| Ga0334995_0285105_932_1081 | 3300034062 | Freshwater | MSKDDYSALKTYLLFLSCMPERVKGIKGHDIISSEIPVDMAIADILRTK |
| Ga0310127_126019_68_220 | 3300034072 | Fracking Water | MSKEDYSALKTYLMFINCMPEKIRGVKGQDIVSSDIPVDMKIAEVLRQIK |
| Ga0310130_0198482_484_624 | 3300034073 | Fracking Water | DYPALKTYLLFLSCMPDKVIGIKGHDIISSEISVDMKIANILRSIN |
| Ga0335020_0160712_996_1130 | 3300034082 | Freshwater | HTLKTYLLFLNYMPEVVRGIRGQDILSNDIPVDMTVANALRQIK |
| Ga0335020_0345356_60_212 | 3300034082 | Freshwater | MSKDDYPALKTYLLFLSIMPEKIRGIKGHDITSSDIPVDNRIADILREIK |
| Ga0335020_0464798_404_556 | 3300034082 | Freshwater | MLKDDYSALKTYLLFLNLMPEKVIGIKGKDIVSSDILVDMDIAETLREIK |
| Ga0335027_0529821_558_731 | 3300034101 | Freshwater | TRLLFYKIAKEDYSALKTYLVFLSCMPERVKGIKGHDIVSSDIPVDMKIADILREIK |
| Ga0335030_0651260_1_150 | 3300034103 | Freshwater | SKDDYSTLKTYLLFLSYMPERVRGIKGQDIISSDVPVDMVVAQILRDLK |
| Ga0335063_0079964_1848_2000 | 3300034111 | Freshwater | MAKEDYPALKTYLLFLSYMPDTVKCIKGQDIISSDIPLDMDVVFALRKIK |
| Ga0335068_0521106_374_526 | 3300034116 | Freshwater | MLKEDYSALKTYLLFLNLMPEKVIGIKGKDIVSSDILVDMSIAETLREIK |
| ⦗Top⦘ |