| Basic Information | |
|---|---|
| Family ID | F023194 |
| Family Type | Metagenome |
| Number of Sequences | 211 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MFDNFPLWPARASTAAGNVDALFIFLLIVSGLMTLLI |
| Number of Associated Samples | 184 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.92 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 85.31 % |
| Associated GOLD sequencing projects | 172 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.526 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.270 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.118 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.028 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 211 Family Scaffolds |
|---|---|---|
| PF02630 | SCO1-SenC | 15.17 |
| PF13442 | Cytochrome_CBB3 | 3.32 |
| PF01523 | PmbA_TldD | 0.95 |
| PF11821 | ActD | 0.95 |
| PF00115 | COX1 | 0.95 |
| PF03916 | NrfD | 0.47 |
| PF01474 | DAHP_synth_2 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 211 Family Scaffolds |
|---|---|---|---|
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 15.17 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 15.17 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.95 |
| COG3200 | 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase, class II | Amino acid transport and metabolism [E] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.53 % |
| Unclassified | root | N/A | 0.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1021381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300001593|JGI12635J15846_10844276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 524 | Open in IMG/M |
| 3300001686|C688J18823_10681212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300004082|Ga0062384_100004516 | All Organisms → cellular organisms → Bacteria | 4736 | Open in IMG/M |
| 3300004091|Ga0062387_101344863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300004092|Ga0062389_100015205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5204 | Open in IMG/M |
| 3300004152|Ga0062386_100105515 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300005186|Ga0066676_10780534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300005329|Ga0070683_100657341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300005332|Ga0066388_107608665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 543 | Open in IMG/M |
| 3300005367|Ga0070667_100617684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 999 | Open in IMG/M |
| 3300005367|Ga0070667_100835639 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005434|Ga0070709_11284126 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005435|Ga0070714_100795663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300005436|Ga0070713_100926259 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005437|Ga0070710_11397254 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005438|Ga0070701_11314344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300005447|Ga0066689_11044457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005529|Ga0070741_11557871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300005538|Ga0070731_10866140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300005542|Ga0070732_10471320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300005542|Ga0070732_10837080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300005557|Ga0066704_10002206 | All Organisms → cellular organisms → Bacteria | 8937 | Open in IMG/M |
| 3300005568|Ga0066703_10488575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300005577|Ga0068857_100577352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300005602|Ga0070762_10228279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300005602|Ga0070762_10316713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300005764|Ga0066903_101305517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
| 3300006052|Ga0075029_100247718 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300006057|Ga0075026_100375393 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300006059|Ga0075017_100154166 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300006162|Ga0075030_101274175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 577 | Open in IMG/M |
| 3300006172|Ga0075018_10686579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 552 | Open in IMG/M |
| 3300006174|Ga0075014_100335655 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300006176|Ga0070765_101475124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300006893|Ga0073928_11132226 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006903|Ga0075426_11350654 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009094|Ga0111539_10928408 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300009522|Ga0116218_1247296 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300009523|Ga0116221_1064031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300009525|Ga0116220_10455413 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300009551|Ga0105238_13001244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300009616|Ga0116111_1055718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300009641|Ga0116120_1145991 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009645|Ga0116106_1229786 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009672|Ga0116215_1216720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300009672|Ga0116215_1464541 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009698|Ga0116216_10416910 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300009700|Ga0116217_10984974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300009792|Ga0126374_10473922 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300010043|Ga0126380_12025559 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010046|Ga0126384_10447234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300010371|Ga0134125_11222263 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300010379|Ga0136449_100656866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
| 3300010396|Ga0134126_10148764 | All Organisms → cellular organisms → Bacteria | 2838 | Open in IMG/M |
| 3300012199|Ga0137383_10694855 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012202|Ga0137363_11769898 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012203|Ga0137399_10413102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300012212|Ga0150985_101560032 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012349|Ga0137387_10890928 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012361|Ga0137360_11061393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 699 | Open in IMG/M |
| 3300012582|Ga0137358_10704138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012923|Ga0137359_11457054 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012948|Ga0126375_10468988 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300013297|Ga0157378_10645373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300014168|Ga0181534_10789776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300014200|Ga0181526_10823310 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300014489|Ga0182018_10755634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300014492|Ga0182013_10343680 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300014501|Ga0182024_12742329 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300015264|Ga0137403_10448547 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300015374|Ga0132255_105468389 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300017654|Ga0134069_1045631 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300017656|Ga0134112_10313867 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300017659|Ga0134083_10008348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3401 | Open in IMG/M |
| 3300017822|Ga0187802_10453139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 509 | Open in IMG/M |
| 3300017932|Ga0187814_10457896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300017934|Ga0187803_10404847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300017937|Ga0187809_10077003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300017943|Ga0187819_10169484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300017955|Ga0187817_10352913 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300017955|Ga0187817_10880411 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300017961|Ga0187778_10951832 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300017970|Ga0187783_10759841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300017974|Ga0187777_11250764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300017975|Ga0187782_10147589 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300018006|Ga0187804_10207323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 838 | Open in IMG/M |
| 3300018007|Ga0187805_10026641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2550 | Open in IMG/M |
| 3300018047|Ga0187859_10085614 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300018058|Ga0187766_11304068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300018058|Ga0187766_11364005 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018085|Ga0187772_10973553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300018085|Ga0187772_11148944 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300018433|Ga0066667_12333104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300019786|Ga0182025_1212036 | All Organisms → cellular organisms → Bacteria | 2949 | Open in IMG/M |
| 3300019881|Ga0193707_1003438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5671 | Open in IMG/M |
| 3300020006|Ga0193735_1172798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300020022|Ga0193733_1130241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 691 | Open in IMG/M |
| 3300020580|Ga0210403_11240099 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300020582|Ga0210395_10402714 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300020583|Ga0210401_11586470 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021088|Ga0210404_10617353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300021170|Ga0210400_10099105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2306 | Open in IMG/M |
| 3300021180|Ga0210396_10954823 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300021181|Ga0210388_10862544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300021401|Ga0210393_10111158 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300021401|Ga0210393_10175983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
| 3300021401|Ga0210393_11046111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300021405|Ga0210387_10241338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1578 | Open in IMG/M |
| 3300021405|Ga0210387_10383132 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300021407|Ga0210383_10952521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300021420|Ga0210394_10466198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300021420|Ga0210394_11433544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 586 | Open in IMG/M |
| 3300021420|Ga0210394_11724516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300021433|Ga0210391_10645878 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300021445|Ga0182009_10010167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3235 | Open in IMG/M |
| 3300021474|Ga0210390_10569917 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300021477|Ga0210398_10724540 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300021478|Ga0210402_11404198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300021560|Ga0126371_13844418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300022557|Ga0212123_10643951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 661 | Open in IMG/M |
| 3300022557|Ga0212123_10755018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 591 | Open in IMG/M |
| 3300024225|Ga0224572_1043298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300025906|Ga0207699_10161218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1493 | Open in IMG/M |
| 3300025916|Ga0207663_10435881 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300025928|Ga0207700_10569045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300025932|Ga0207690_10058136 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
| 3300025938|Ga0207704_10623831 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300026334|Ga0209377_1087164 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300026371|Ga0257179_1023962 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300026376|Ga0257167_1063776 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026482|Ga0257172_1032881 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300026508|Ga0257161_1105656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 587 | Open in IMG/M |
| 3300026529|Ga0209806_1185045 | Not Available | 747 | Open in IMG/M |
| 3300026532|Ga0209160_1006275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9223 | Open in IMG/M |
| 3300026538|Ga0209056_10098811 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300026550|Ga0209474_10605868 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300026849|Ga0207804_126636 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027011|Ga0207740_1039321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300027045|Ga0207726_1041340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300027583|Ga0209527_1050713 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300027604|Ga0208324_1045106 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300027609|Ga0209221_1007756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2749 | Open in IMG/M |
| 3300027660|Ga0209736_1074495 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300027676|Ga0209333_1003248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6528 | Open in IMG/M |
| 3300027692|Ga0209530_1037743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1429 | Open in IMG/M |
| 3300027706|Ga0209581_1152460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 751 | Open in IMG/M |
| 3300027729|Ga0209248_10007267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3496 | Open in IMG/M |
| 3300027729|Ga0209248_10031894 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300027812|Ga0209656_10030554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3197 | Open in IMG/M |
| 3300027824|Ga0209040_10183566 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300027842|Ga0209580_10613477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300027855|Ga0209693_10322011 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300027869|Ga0209579_10078576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1745 | Open in IMG/M |
| 3300027869|Ga0209579_10125199 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300027869|Ga0209579_10281581 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300027869|Ga0209579_10587021 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300027903|Ga0209488_11001520 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027905|Ga0209415_10056353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4929 | Open in IMG/M |
| 3300027908|Ga0209006_11498940 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027911|Ga0209698_10516311 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300028047|Ga0209526_10991737 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300028666|Ga0265336_10073625 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300028748|Ga0302156_10500047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 518 | Open in IMG/M |
| 3300028800|Ga0265338_10691072 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300028906|Ga0308309_10091906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2325 | Open in IMG/M |
| 3300028906|Ga0308309_10412625 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300028906|Ga0308309_11680141 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300030503|Ga0311370_10994544 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300030617|Ga0311356_10682740 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300030687|Ga0302309_10338834 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300030707|Ga0310038_10055402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2214 | Open in IMG/M |
| 3300031057|Ga0170834_105387271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300031226|Ga0307497_10346539 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031231|Ga0170824_102608421 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300031235|Ga0265330_10113528 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300031546|Ga0318538_10494995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300031720|Ga0307469_11978726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300031720|Ga0307469_12373914 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031740|Ga0307468_100155854 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300031793|Ga0318548_10146319 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300031797|Ga0318550_10245408 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300031820|Ga0307473_11188216 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031823|Ga0307478_11036529 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031890|Ga0306925_11783184 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031912|Ga0306921_10199699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2343 | Open in IMG/M |
| 3300031938|Ga0308175_101723836 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300031938|Ga0308175_102142398 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031945|Ga0310913_10654856 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300031954|Ga0306926_12219580 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031962|Ga0307479_10146570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2314 | Open in IMG/M |
| 3300031962|Ga0307479_10539581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300032174|Ga0307470_11786066 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032180|Ga0307471_101136827 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300032205|Ga0307472_100464453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300032205|Ga0307472_101811115 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032261|Ga0306920_100230292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2765 | Open in IMG/M |
| 3300032770|Ga0335085_10236515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2207 | Open in IMG/M |
| 3300032770|Ga0335085_10337607 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300032782|Ga0335082_10144687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2307 | Open in IMG/M |
| 3300032783|Ga0335079_12037513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300032805|Ga0335078_10081984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4697 | Open in IMG/M |
| 3300032805|Ga0335078_10462288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300032829|Ga0335070_10142939 | All Organisms → cellular organisms → Bacteria | 2444 | Open in IMG/M |
| 3300032892|Ga0335081_10227677 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
| 3300032892|Ga0335081_10302996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2115 | Open in IMG/M |
| 3300032955|Ga0335076_10707782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300033004|Ga0335084_10453718 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300033158|Ga0335077_10392434 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300033158|Ga0335077_10503981 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300033808|Ga0314867_123824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.16% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.21% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.27% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.42% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.47% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.47% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.47% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.47% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10213811 | 3300001154 | Forest Soil | MFGHLPLWPENASTNAGNVDALYIFLLLVSGIMTVL |
| JGI12635J15846_108442761 | 3300001593 | Forest Soil | MFDTFPLWPARASTTAGSVDALFIFLVALSALMSAVIFVMIIVFA |
| C688J18823_106812122 | 3300001686 | Soil | MFNNFPLWPAGASTNAGDVDALFIFLLVVTGLVTIAIFFLIV |
| Ga0062384_1000045167 | 3300004082 | Bog Forest Soil | MFDNLPLWPERASSMAGQVDAIYIFLLVVCGMVALLVFTCLL |
| Ga0062387_1013448632 | 3300004091 | Bog Forest Soil | MFDTFPLWPARASTGAGNVDALYIFLLLLGGFVSVAIFTMIVV |
| Ga0062389_1000152057 | 3300004092 | Bog Forest Soil | MFDNLPLWPERASSMAGQVDAIYIFLLVVCGMVALLVFTCLLY |
| Ga0062386_1001055151 | 3300004152 | Bog Forest Soil | MFDNFPLWPQRASSTAGNVDALFIFLLIVSGLMTLLVFSAVVYFAAR |
| Ga0066676_107805342 | 3300005186 | Soil | MFDNFPLWPARASTMAGNVDALFIFLLIVSGMMTLLIFAALVIFAARYRHRKG |
| Ga0070683_1006573411 | 3300005329 | Corn Rhizosphere | MFDNFPLWPARASTAAGNVDALYIFLIIVSGMMTLLVFTAIVIFAARY |
| Ga0066388_1076086651 | 3300005332 | Tropical Forest Soil | MFDNFPLWPARASSMAGNVDALYVFLLLISVMVCALIFTLILVFAIRF |
| Ga0070667_1006176842 | 3300005367 | Switchgrass Rhizosphere | MFENFPLWPARASTMAGNVDALFVFLLLLSAFMCAAIFSMILIFALK |
| Ga0070667_1008356392 | 3300005367 | Switchgrass Rhizosphere | MFDNLPLWPTRASTTAGSVDALFIFLVALSALVTAAIVAIIIVFA |
| Ga0070709_112841262 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VGLFNNFPLWPERASTVAGQVDALFIALIIVTGTVTLLIWIVIF |
| Ga0070714_1007956631 | 3300005435 | Agricultural Soil | MFDNFPLWPARASTAAGNVDALYIFLIIVSGMMTLLVFTAIIIF |
| Ga0070713_1009262592 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNFPLWPARASSTAGNVDALFIFLLIVSGMMTLLIFTAVVYFAARYRHRKGVPAEQVE |
| Ga0070710_113972541 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNFPLWPAKASSYAGNVDALFIFLVLLAGLMSLAIFVMIA |
| Ga0070701_113143442 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MFESFPLWPQRASTIAGQVDALYVFLVLLSLFMTAAIFTMILI |
| Ga0066689_110444572 | 3300005447 | Soil | MFDNFPLWPARAATTAGQVDALYIFLVLLSAFMSVAIFIM |
| Ga0070741_115578711 | 3300005529 | Surface Soil | MFDNFPLWPSRASTAAGNVDALFIFLLIVSGLMTLLIFTAVIYFAA |
| Ga0070731_108661402 | 3300005538 | Surface Soil | MFDNFPLWPVAASTGARNVDALYIFLVLIAAFMSVAIFTM |
| Ga0070732_104713202 | 3300005542 | Surface Soil | MFDNFPLWPIRASTGAGNVDALFIFLLALSAFMCL |
| Ga0070732_108370801 | 3300005542 | Surface Soil | MFDNFPLWPARASTAAGNVDALFIFLLIVSGMMTL |
| Ga0066704_1000220610 | 3300005557 | Soil | MFDNFPLWPARASTTAGNVDALYIFLVVLSTFMSVAIFV |
| Ga0066703_104885752 | 3300005568 | Soil | MFDNFPLWPARASTAAGNVDALYIFLIIVSGMMTLLVFT |
| Ga0068857_1005773521 | 3300005577 | Corn Rhizosphere | MFDNFPLWPARASTAAGNVDALYIFLIIVSGMMTLLVF |
| Ga0070762_102282791 | 3300005602 | Soil | MFDNLPLWPERASSMASQVDAIYIFLLVVCGMVALLV |
| Ga0070762_103167131 | 3300005602 | Soil | MFDNFPLWPVRASAGAGNIDALYIFLVALSALMCVAIFTMILVF |
| Ga0066903_1013055171 | 3300005764 | Tropical Forest Soil | MFDNFPLWPVPASSGARNIDALFIFLVLLAGFVSLAIFTMI |
| Ga0075029_1002477182 | 3300006052 | Watersheds | MFDNFPLWPQRASSMAGNVDALFIFLLIVSGLMTL |
| Ga0075026_1003753931 | 3300006057 | Watersheds | MLENIPFWPTRASTTANNVDALFIFLVVVSALMTMLIFTMVI |
| Ga0075017_1001541663 | 3300006059 | Watersheds | MFDNFPLWPDRASTAAGNVDALFIFLIIVSGLMTLLI |
| Ga0075030_1012741751 | 3300006162 | Watersheds | MFDNFPLWPDRASTAAGNVDALFIFLIIVSGLMTAL |
| Ga0075018_106865792 | 3300006172 | Watersheds | MFDNFPLWPVRAAAGAGNVDALYIFLLALSAFMCAAIFTMILV |
| Ga0075014_1003356552 | 3300006174 | Watersheds | MFDNFPLWPDRASTAAGNVDALFIFLIIVSGLMTLL |
| Ga0070765_1014751242 | 3300006176 | Soil | MFDNLPLWPARASTGAGNVDALYIFLILLSGFMCVAIFTMIV |
| Ga0073928_111322261 | 3300006893 | Iron-Sulfur Acid Spring | MFENFPLWPPQASSGAANVDALYVFLLVLSSFMCVAIFSL |
| Ga0075426_113506541 | 3300006903 | Populus Rhizosphere | MFDNFPLWPARASTAAGNVDALYIFLIIVSGMMTLL |
| Ga0111539_109284081 | 3300009094 | Populus Rhizosphere | MWDNFPLWPERASTMASNVDALYIFLLLVCGTMTVL |
| Ga0116218_12472961 | 3300009522 | Peatlands Soil | MFDNFPLWPDRASSTAGNVDALYLFLLIVSGLMTL |
| Ga0116221_10640314 | 3300009523 | Peatlands Soil | MFDNFPLWPVRASTGAGNVDALYIFLLALSAFMCLAIFTM |
| Ga0116220_104554132 | 3300009525 | Peatlands Soil | MFDNFPLWPDRASTAAGNVDALFIFLLIVSGLMTALIFTAVVYFAA |
| Ga0105238_130012442 | 3300009551 | Corn Rhizosphere | MFEDFPLWPARASTMAGNVDALFVFLLLLSAFICAAIFSM |
| Ga0116111_10557183 | 3300009616 | Peatland | MFDNFPLWPDRASTAAGNVDALFIFLLIVSGLMTLLIFIAVVYFAARYR |
| Ga0116120_11459911 | 3300009641 | Peatland | MLNNFPLWPQQASTLAAHVDALYIFLLIVTGMMALLVFVL |
| Ga0116106_12297861 | 3300009645 | Peatland | MFDNFPLWPQRASTMAGSVDALYIFLLIVSGLMTLLI |
| Ga0116215_12167201 | 3300009672 | Peatlands Soil | MFDNLPLWPARASTGAANVDALYIFLVLLAGFMSAAIFSMILVF |
| Ga0116215_14645411 | 3300009672 | Peatlands Soil | MLNNFPLWPQQASTLAHRVDALYIFLLVVTGMMAL |
| Ga0116216_104169102 | 3300009698 | Peatlands Soil | MFDNFPLWPERASSAAGSVDALFIFLLIVSGLMTALIFT |
| Ga0116217_109849741 | 3300009700 | Peatlands Soil | MFDNFPLWPQRASTTAGNVDALFIFLIIVSGLMTLLIFTAVIYFAARYRRQQGVQAEQIE |
| Ga0126374_104739222 | 3300009792 | Tropical Forest Soil | MFENMPLWPARASTMANNVDALYIFLLVVSGMMTALIF |
| Ga0126380_120255591 | 3300010043 | Tropical Forest Soil | MFENMPLWPARASTMANNVDALYIFLLVVSAMMTIL |
| Ga0126384_104472342 | 3300010046 | Tropical Forest Soil | MFDSFPLWPARAATTAGQVDALYIFLVLLSAFMSAAIFIMILVFAT |
| Ga0134125_112222631 | 3300010371 | Terrestrial Soil | MWDNFPLWPERASTMASNVDALYIFLLLVCGTMTVLVS |
| Ga0136449_1006568661 | 3300010379 | Peatlands Soil | MFDNLPLWPARASTGAGNVDALYIFLLLVSGFVCLA |
| Ga0134126_101487644 | 3300010396 | Terrestrial Soil | MLDNFPLWPVGASSNAGAVDALYIFLVALSTFMTVAIFATIAVFGLKYR |
| Ga0137383_106948552 | 3300012199 | Vadose Zone Soil | MFDNFPLWPQRASSMAGNVDALFIFLLIVSGLMTLLIFTALIYFAAR |
| Ga0137363_117698982 | 3300012202 | Vadose Zone Soil | MFNNFPIWPERASSIAGNVDALFIFLLIVTGMVSLLIFACLLF |
| Ga0137399_104131021 | 3300012203 | Vadose Zone Soil | MFDNFPLWPQRASTMAGNVDALYIFLLIVSGLMTLLIFVCV |
| Ga0150985_1015600322 | 3300012212 | Avena Fatua Rhizosphere | MFENLPLWPVRASSTAGSVDALYIFLLTLCGVMCIGIF |
| Ga0137387_108909282 | 3300012349 | Vadose Zone Soil | MFQTFPLWPERASTTAGGVDALFIFLLTLCGLMAIMIF |
| Ga0137360_110613931 | 3300012361 | Vadose Zone Soil | MFDNFPLWPQRASTMAGNVDALYIFLLIVSGLITLLIFVCVVFFAAK |
| Ga0137358_107041381 | 3300012582 | Vadose Zone Soil | MFDNLPLWPARASTTAGSVDALYIFLVALSLFVSVAI |
| Ga0137359_114570541 | 3300012923 | Vadose Zone Soil | MFGHLPLWPENASTNAGNVDALYIFLLLVSGIMTVLIFAVLTA |
| Ga0126375_104689881 | 3300012948 | Tropical Forest Soil | MFDNFPLWPQRASTMAGNVDALFIFLLIVTGMMTLLVFCAIVYFAAR |
| Ga0157378_106453732 | 3300013297 | Miscanthus Rhizosphere | MYDTFPLWPARASTTAGSVDTLFIFLVILSAMVSVAIFAAMVLFAV |
| Ga0181534_107897761 | 3300014168 | Bog | MFDNFPLWPDRASTAAGNVDALFIFLIIVSGLMTLLIFAT |
| Ga0181526_108233102 | 3300014200 | Bog | MGHLPFWPEAASTNAGNVDALYIFLLMVSGIMTLMIFS |
| Ga0182018_107556341 | 3300014489 | Palsa | MFDNFPLWPARASAGAANVDALYIFLVLLSSFMCAAIFTTI |
| Ga0182013_103436801 | 3300014492 | Bog | MFDNFPLWPARASSGAANVDALYIFLLLLSSFMCAAIFTTILVFAV |
| Ga0182024_127423291 | 3300014501 | Permafrost | MLNNFPLWPQQASTLAGHVDALYIFLLIVTGMMALLVFTLIIYF |
| Ga0137403_104485472 | 3300015264 | Vadose Zone Soil | MFESFPLWPQRASSIAGEVDALYVFLLLLSAFMTAAIFTMILI |
| Ga0132255_1054683892 | 3300015374 | Arabidopsis Rhizosphere | MWDNFPLWPERASTMASNVDALYIFLLLVCGTMTVLVSL |
| Ga0134069_10456312 | 3300017654 | Grasslands Soil | MFDNLPLWPARASTTAGSVDALYIFLVALSLFMSVAIFTMI |
| Ga0134112_103138672 | 3300017656 | Grasslands Soil | MFDNFPLWPARASTAAGNVDALYIFLIIVSGMMTLLVFTAIVIF |
| Ga0134083_100083481 | 3300017659 | Grasslands Soil | MFDNLPLWPARASTTAGSVDALYIFLVALSLFVSVAIFTMICI |
| Ga0187802_104531392 | 3300017822 | Freshwater Sediment | MFDNFPLWPQRASTTAGGVDALYIFLLIVCGLMTLLIFITLI |
| Ga0187814_104578962 | 3300017932 | Freshwater Sediment | MFDNFPLWPVRASTGAGNVDALFIFLLALSAFMCLAIFAMI |
| Ga0187803_104048471 | 3300017934 | Freshwater Sediment | MFDNFPLWPVRASKGAGNVDALYIFLVLLAGFMSVAIFTMILV |
| Ga0187809_100770031 | 3300017937 | Freshwater Sediment | MFDNFPLWPQRASSIAGNVDALFIFLIIVSGMMTLLIFCAVLYFAARYRHRRGVLAEQ |
| Ga0187819_101694842 | 3300017943 | Freshwater Sediment | MFDNFPLWPVRAAAGAGNVDALYIFLLALSAFMCAAIF |
| Ga0187817_103529131 | 3300017955 | Freshwater Sediment | MFDNFPLWPQQASSTAGNVDALFIFLLIVSGMMTLLIFTAVVY |
| Ga0187817_108804111 | 3300017955 | Freshwater Sediment | MFGHFPLWPENASTSAGNVDALYIFLVMVSGIMTVLI |
| Ga0187778_109518322 | 3300017961 | Tropical Peatland | MFNNFPLWPQRASTLAGNVDALFIFLLIVSGLMTLLIFAAVIYFAEIGR |
| Ga0187783_107598411 | 3300017970 | Tropical Peatland | MFDNFPLWPARASTGAGNVDALFLFLVLLAGFMSLAI |
| Ga0187777_112507641 | 3300017974 | Tropical Peatland | MFDSFPLWPTRASTVASQVDALYIFLVALSVLMSSTIFVL |
| Ga0187782_101475894 | 3300017975 | Tropical Peatland | MLENVPLWPQTASTGAGNVDALYIFLVLLSSFMCALIFLTVLVF |
| Ga0187804_102073231 | 3300018006 | Freshwater Sediment | MFDNFPLWPQRASSTAGNVDALFIFLLIVSGMMTLLVFSAVVYFAARYRYRRGVP |
| Ga0187805_100266412 | 3300018007 | Freshwater Sediment | MFDNFPLWPQRASTAAGNVDALFIFLLIVSGLMSLLIFTAILYFAARYRRRQGVPAEQI |
| Ga0187859_100856141 | 3300018047 | Peatland | MGHLPFWPEAASTNAGNVDALYIFLLMVSGIMTLMIFSVLI |
| Ga0187766_113040682 | 3300018058 | Tropical Peatland | MFDNFPLWPQRASTLAGNVDALYIFLLIVSGLMTALIFAALIYFAA |
| Ga0187766_113640052 | 3300018058 | Tropical Peatland | MFDNFPLWPQRASTQASNVDALYIFLLIVSALMTLL |
| Ga0187772_109735531 | 3300018085 | Tropical Peatland | MFDNFPLWPARASSGAGNVDALYIFLLLLAGFMSVAIFTMIVVF |
| Ga0187772_111489442 | 3300018085 | Tropical Peatland | MLNNFPLWPQRASTAAGNVDALFIFLLIVAGLMTLLIFVTLIYFAA |
| Ga0066667_123331041 | 3300018433 | Grasslands Soil | MFDNLPLWPARASTTAGSVDALYIFLVALSLFVSVA |
| Ga0182025_12120362 | 3300019786 | Permafrost | MFDNFHFGPRRASTGAGNVDALYIFRLLRSALMCATIFTMIWCLL |
| Ga0193707_10034388 | 3300019881 | Soil | MFDTFPLWPARASTTAGSVDALFVFLVALSALMSLA |
| Ga0193735_11727981 | 3300020006 | Soil | MFDNFPLWPARASTTAGNVDALYIFLVVLSSFMSVAIFLM |
| Ga0193733_11302411 | 3300020022 | Soil | MFDNFPLWPQRASTMAGNVDALYIFLLIVSGLMTLLIFFCVVYFA |
| Ga0210403_112400992 | 3300020580 | Soil | MFDNFPLWPDRASAAAGNVDALFIFLLIVSGLMSLL |
| Ga0210395_104027141 | 3300020582 | Soil | MFDNFPLWPDRASTTAGNVDALYIFLLILSALMTGL |
| Ga0210401_115864702 | 3300020583 | Soil | MFDNFPLWPQRASSMAGNVDALFIFLLIVSGLMTLL |
| Ga0210404_106173531 | 3300021088 | Soil | MFENLPLWPVRASSGAGNVDALYIFLLSLSAFMCLAIFTMILVF |
| Ga0210400_100991051 | 3300021170 | Soil | MFDNFPLWPDRASTAAGNVDALFIFLIIVSGLMTALIFTAV |
| Ga0210396_109548231 | 3300021180 | Soil | MLNNFPLWPQQASTLAGRVDALYIFLLIVCGMMTLLVFAFVV |
| Ga0210388_108625441 | 3300021181 | Soil | MFENLPLWPVRASSGAGNVDALYIFLLALSAFMCA |
| Ga0210393_101111581 | 3300021401 | Soil | MFDNFPLWPERASTAAANVDALFIFLLIVSGMMTALIFTAV |
| Ga0210393_101759831 | 3300021401 | Soil | MFDNLPLWPARASTGAGNVDALYIFLVLLSGFMCLAIFT |
| Ga0210393_110461112 | 3300021401 | Soil | MFDNFPLWPVRAAAGAGNVDALYIFLLALSAFMCAAIFTMILVFAT |
| Ga0210387_102413383 | 3300021405 | Soil | MFDNLPLWPERASSMASQVDAIYIFLLVVCGMVAL |
| Ga0210387_103831321 | 3300021405 | Soil | MFDNFPLWPARASTAAGNVDALFIFLLIVSGLMTL |
| Ga0210383_109525211 | 3300021407 | Soil | MFDNLPLWPERASAGAGNVDALYIFLVLLAGFMSAAIFTMIVVF |
| Ga0210394_104661982 | 3300021420 | Soil | MFDNFPLWPQRASSTAGNVDALFIFLIIVSGLMTLLIFSALIYFAARYRHRKGVLAE |
| Ga0210394_114335442 | 3300021420 | Soil | MFDNFPLWPARASTAAGNVDALFIFLLIVSGLMTLLIFTALVYFAARYRYRRGVLAEQI |
| Ga0210394_117245161 | 3300021420 | Soil | MFDNFPLWPARASAGAANVDALFIFLLALSAFMCLAIF |
| Ga0210391_106458782 | 3300021433 | Soil | MFGHIPFWPESASTNAGNVDALFIFLLLVSGIMTAMIFA |
| Ga0182009_100101671 | 3300021445 | Soil | MFANFPLWPTRASTAAGNVDALYIFLIIVSGMMTLLVFTALIIF |
| Ga0210390_105699171 | 3300021474 | Soil | MLNNFPLWPQQASTLAGHVDALYIFLLIVTGMMALLVF |
| Ga0210398_107245402 | 3300021477 | Soil | MFDNFPLWPARASTAAGNVDALFIFLLIVSGLMTLLI |
| Ga0210402_114041982 | 3300021478 | Soil | MFDNFPLWPVRASTGAGNVDALYIFLVALSAFMCLAI |
| Ga0126371_138444181 | 3300021560 | Tropical Forest Soil | MLNNFPLWPERASSMAGNVDALFIFLLIVSGMMTLLIFVALIYFAARYRH |
| Ga0212123_106439512 | 3300022557 | Iron-Sulfur Acid Spring | MFDNFPLWPARASTAAGNVDALFIFLLIVSGLMTLLIFSALVYFAARY |
| Ga0212123_107550182 | 3300022557 | Iron-Sulfur Acid Spring | MFDNFPLWPDRASTAAGNVDALFIFLLIVSGLMTLLIFTAVVYFAARYRHRR |
| Ga0224572_10432982 | 3300024225 | Rhizosphere | MFDNFPLWPVRASAGAGNVDALYIFLVALSAFMCVAIFTMILVFA |
| Ga0207699_101612183 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDTFPLWPARASTAAGSVDAFFIFLVILSSMVSLAIFTAIVVF |
| Ga0207663_104358812 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MFENMPLWPARASTMANNVDALYIFLLVVSALMSVLI |
| Ga0207700_105690451 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDNFPLWPQRASTTAGNVDALYIFLIIVSGLMTLLIFTAV |
| Ga0207690_100581361 | 3300025932 | Corn Rhizosphere | MFDTFPLWPTRASTTAGSVDALFIFLVALSALMSLAI |
| Ga0207704_106238311 | 3300025938 | Miscanthus Rhizosphere | MWDNFPLWPERASTMASNVDALYIFLLLVCGTMTVLV |
| Ga0209377_10871641 | 3300026334 | Soil | MFGHLPLWPENASTNAGNVDALYIFLLLVSGIMTVLIF |
| Ga0257179_10239621 | 3300026371 | Soil | MFDNFPLWPQRASTMAGNVDALYIFLLIVSGLITLLIF |
| Ga0257167_10637761 | 3300026376 | Soil | MFGHLPLWPENASTNAGNVDALYIFLLLVSGIMTVLIFA |
| Ga0257172_10328811 | 3300026482 | Soil | MFDNFPLWPQRASTMAGNVDALYIFLLIVSGLITLL |
| Ga0257161_11056561 | 3300026508 | Soil | MFNNFPLWPERASSVAGNVDALFIFLLIVSGLMTLLIFACVVYFAARYRYRPGVLAE |
| Ga0209806_11850451 | 3300026529 | Soil | MFDNFPLWPDRASTAAGNVDALFIFLLIVCGLMTLL |
| Ga0209160_10062759 | 3300026532 | Soil | MFDNFPLWPARASTTAGNVDALYIFLVVLSTFMSVAIC |
| Ga0209056_100988114 | 3300026538 | Soil | MFDNFPLWPQRASTMAGNVDALYIFLLMVSGLMTLL |
| Ga0209474_106058682 | 3300026550 | Soil | MFNNFPLWPVGASNFAGNVDALFVFLLLVTGAVTVAIFI |
| Ga0207804_1266361 | 3300026849 | Tropical Forest Soil | MFDNFPLWPDRASSTAGNVDALFIFLVIVSALMTLLIFTAVLY |
| Ga0207740_10393212 | 3300027011 | Tropical Forest Soil | MFDNFPLWPDRASSTAGNVDALFIFLVIVSALMTLLIFTAV |
| Ga0207726_10413402 | 3300027045 | Tropical Forest Soil | MFDNFPLWPDRASSTAGNVDALFIFLVIVSALMTLLIFTAVLYFAARYRRQKDVLA |
| Ga0209527_10507131 | 3300027583 | Forest Soil | MFDNFPLWPDRASAAAGNVDALFIFLLIVSGLMSLLIFS |
| Ga0208324_10451061 | 3300027604 | Peatlands Soil | MFDNFPLWPVRASTGAGNVDALYIFLVLLSGFMSVAI |
| Ga0209221_10077564 | 3300027609 | Forest Soil | MFDNFPLWPVRASAGAANVDALYIFLVALSALMCVAIFTMI |
| Ga0209736_10744951 | 3300027660 | Forest Soil | MFDNFPLWPARASTAAGNVDALFIFLLIVSGLMTLLIFTALVYFAARYRYRP |
| Ga0209333_10032488 | 3300027676 | Forest Soil | MLNNFPLWPEQASTMAAHVDALYIFLLIVTGMMSLL |
| Ga0209530_10377431 | 3300027692 | Forest Soil | MFDNLPLWPERASSMAGQVDAIYIFLLVVCGMVAL |
| Ga0209581_11524602 | 3300027706 | Surface Soil | MFDNFPLWPSRASTAAGNVDALFIFLLIVSGLMTLLIFTAVIYFAARYRHRKGVLAEQ |
| Ga0209248_100072671 | 3300027729 | Bog Forest Soil | MLNNFPLWPEQASTMAGHVDALYIFLLIVCGMMSLLIF |
| Ga0209248_100318941 | 3300027729 | Bog Forest Soil | MFDNFPLWPVRASAGAGNVDALYIFLVALSALMCVAIFTM |
| Ga0209656_100305545 | 3300027812 | Bog Forest Soil | MFDNFPLWPDRASTAAGNVDALFIFLIIVSGLMTLLTFT |
| Ga0209040_101835661 | 3300027824 | Bog Forest Soil | MFDNFPLWPQRASSTAGNVDALFIFLLIVSGLMTLLVFS |
| Ga0209580_106134772 | 3300027842 | Surface Soil | MFNNFPLWPDRASTAAGNVDALFIFLLIVSGMMTLLIFVAL |
| Ga0209693_103220111 | 3300027855 | Soil | MLNNFPLWPEQASTTAPHVDALYIFLLIVTGMMTLL |
| Ga0209579_100785761 | 3300027869 | Surface Soil | MFDNFPLWPERASTTAGNVDALYIFLLILSALMTGLIFVAVVYFA |
| Ga0209579_101251991 | 3300027869 | Surface Soil | MFDNFPLWPARASAGAANVDALFIFLLALSALMCVAIFTMILVFATK |
| Ga0209579_102815812 | 3300027869 | Surface Soil | MFDNFPLWPARASTVAGNVDALFVFLLIVSGLMCLLIFTLI |
| Ga0209579_105870211 | 3300027869 | Surface Soil | MFDNFPLWPQRASSMAGNVDALFIFLLIVSGMMTLLVF |
| Ga0209488_110015202 | 3300027903 | Vadose Zone Soil | MLNNFPLWPEQASTMARNVDALYIFLLIVCGMMTLL |
| Ga0209415_100563531 | 3300027905 | Peatlands Soil | MFDNFPLWPDRASTAAGNVDALFIFLLIVSGLMTALIF |
| Ga0209006_114989402 | 3300027908 | Forest Soil | MLNNFPLWPQQASTLAGRVDALYIFLLIVCGMMTLLVFA |
| Ga0209698_105163111 | 3300027911 | Watersheds | MFDNFPLWPQRASSMAGNVDALFIFLLIVSGLMTLLI |
| Ga0209526_109917371 | 3300028047 | Forest Soil | MFDNFPLWPARASSAAGNVDALFIFLLIVSGLISLLIFTALVYFAARYRYRR |
| Ga0265336_100736252 | 3300028666 | Rhizosphere | MFDNFPLWPDRASTAAGNVDALFILLLIVSGLMTLLIFVA |
| Ga0302156_105000471 | 3300028748 | Bog | MLNNFPLWPQQASTIAGNVDALYIFLLIVTGMMALL |
| Ga0265338_106910721 | 3300028800 | Rhizosphere | MFDNFPLWPDRASTAAGNVDALFIFLLIVSGLMTLLIFTALVFFAA |
| Ga0308309_100919064 | 3300028906 | Soil | MFGHIPFWPESASTNAGNVDALFIFLLLVSGIMTAMIFAVLTAFA |
| Ga0308309_104126253 | 3300028906 | Soil | MFGHLPLWPENASTNAGNVDALYIFLLLVSGIMTVLIFS |
| Ga0308309_116801412 | 3300028906 | Soil | MFDNLPLWPERASSMAGQVDAIYIFLLVVCGMVALLV |
| Ga0311370_109945441 | 3300030503 | Palsa | MFDNLPLWPERASSMAGQVDAIYIFLLVVCGMVALLVF |
| Ga0311356_106827402 | 3300030617 | Palsa | MLNNFPLWPERASTLAGHVDALYIFLLIVTGMMASLVFVLLIFF |
| Ga0302309_103388342 | 3300030687 | Palsa | MLNNFPLWPVQASTIARSVDALYIFLLIVTGMMTLL |
| Ga0310038_100554024 | 3300030707 | Peatlands Soil | MFGHFPLWPESASTAAGNVDALYIFLLLVSGIMTTLIFTVLTIFAV |
| Ga0170834_1053872712 | 3300031057 | Forest Soil | MYDTFPLWPARASTTAGSVDTLYIFLVILSTMVSVAIFAAIVLFAVR |
| Ga0307497_103465392 | 3300031226 | Soil | MFDNFPLWPQRASSMAGNVDALFIFLLIVSGLMSLLIF |
| Ga0170824_1026084211 | 3300031231 | Forest Soil | MLDNFPLWPERASTMAGSVDALYIFLLIVSGLMTLLIFVAL |
| Ga0265330_101135282 | 3300031235 | Rhizosphere | MFDNFPLWPDRASTAAGNVDALFIFLIIVSGMMTALIF |
| Ga0318538_104949952 | 3300031546 | Soil | MFDNFPLWPDRASSTAGNVDALFIFLLIVSGLMTLLIFTAIIYFAARYRHRKGVLA |
| Ga0307469_119787261 | 3300031720 | Hardwood Forest Soil | MYDTFPLWPARASTTAGSVDALFIFLVALSTIMSVAIFTMIVVFAV |
| Ga0307469_123739141 | 3300031720 | Hardwood Forest Soil | MFENMPLWPARASTMANNVDALYIFLLVVSAMMTV |
| Ga0307468_1001558541 | 3300031740 | Hardwood Forest Soil | MLQNMPFWPARASAAANNVDALFIFLVVVSGLMTALIF |
| Ga0318548_101463193 | 3300031793 | Soil | MFQTMPLWPVRASTTANSVDALYIFLVVVSALMSAAIFTMVVY |
| Ga0318550_102454082 | 3300031797 | Soil | VNMFQTMPLWPVRASTTANSVDALYIFLVVVSALMSAAIFTMVV |
| Ga0307473_111882161 | 3300031820 | Hardwood Forest Soil | MFDNFPLWPQRASSMAGNVDALFIFLLIVSGLMSL |
| Ga0307478_110365292 | 3300031823 | Hardwood Forest Soil | MLNNFPLWPQQASTMAGRVDALYIFLLIVCGMMTLLI |
| Ga0306925_117831842 | 3300031890 | Soil | MFDNFPLWPVPASSGARNIDALFIFLVLLAGFVSIAIF |
| Ga0306921_101996991 | 3300031912 | Soil | MFDNFPLWPDRASSTAGNVDALFIFLLIVSGLMTLLIFTAII |
| Ga0308175_1017238362 | 3300031938 | Soil | MFDNFPLWPARASTAAGNVDALYIFLLIVSGMMTLLVF |
| Ga0308175_1021423982 | 3300031938 | Soil | MFENLPLWPVRASSTAGSVDALYIFLLTLCGVMCIGIFTMI |
| Ga0310913_106548561 | 3300031945 | Soil | MFQNMPFWPQRASTMANNVDALYIFLLTVSGLMVL |
| Ga0306926_122195802 | 3300031954 | Soil | MFDNFPLWPQRASSMAGNVDALFIFLLLVSGMMTLLIFVAI |
| Ga0307479_101465704 | 3300031962 | Hardwood Forest Soil | MFNNFPLWPDRASTAAGNVDALFIFLLIVSGMMTLLIFVALTYFAARYRHRRGVPAE |
| Ga0307479_105395811 | 3300031962 | Hardwood Forest Soil | MFETFPLWPARASTTAGSVDQLFIFLVILSAMVSVAIFAAIVLFAI |
| Ga0307470_117860661 | 3300032174 | Hardwood Forest Soil | MFDNFPLWPDRASTAAGNVDALFIFLIIVSGLITALIFT |
| Ga0307471_1011368272 | 3300032180 | Hardwood Forest Soil | MFDNFPLWPQRASSTAGNVDALFIFLLIVSGLMTLLIFTAIIYFAARY |
| Ga0307472_1004644532 | 3300032205 | Hardwood Forest Soil | MFDNFPLWPVRASTGAGGIDALFIFLVMLSALVSVTIFIMI |
| Ga0307472_1018111151 | 3300032205 | Hardwood Forest Soil | MLQNMPFWPARASAAANNVDALFIFLVVVSGLMTA |
| Ga0306920_1002302921 | 3300032261 | Soil | MFQNMPFWPQRASTIANNVDALYIFLLTVSGLMVLSIFT |
| Ga0335085_102365154 | 3300032770 | Soil | MFDNFPLWPQRASSMAGNVDALFIFLIIVSGLMTLLIFCAVLYFAARYRHRKGVLAEQVE |
| Ga0335085_103376074 | 3300032770 | Soil | MFDNFPLWPDRASTAAGNVDALFIFLLIVSGLMTLLIFIAVAYF |
| Ga0335082_101446874 | 3300032782 | Soil | MFDNFPLWPDRASSMAGNVDALFIFLVIVSGLMTLLIFTAVVYF |
| Ga0335079_120375132 | 3300032783 | Soil | MFNNFPLWPDRASTSAGNVDALYIFLVVVSALMCVLI |
| Ga0335078_100819841 | 3300032805 | Soil | MFDNFPLWPQRASTMAGNVDALYIFLLIVSGMMTLL |
| Ga0335078_104622884 | 3300032805 | Soil | MFDNFPLWPIRASTGAGNVDALYIFLVVLSAFMSAAIFTMIIVFAVQY |
| Ga0335070_101429391 | 3300032829 | Soil | MFDNFPLWPARASAGAGNVDALYVFLLLIAGFMCLAIFTFIILF |
| Ga0335081_102276771 | 3300032892 | Soil | MFENFSMWPARASTTAGNVDALFVFLVLLSAFMSAAIFTMITVFALR |
| Ga0335081_103029961 | 3300032892 | Soil | MFDNFPLWPQRASSMAGNVDALFIFLVILSGMMTLLIFVSL |
| Ga0335076_107077822 | 3300032955 | Soil | MFDNLPLWPVRASSGAANVDALYIFLLLLAGFVCLAIFTMIIFFAL |
| Ga0335084_104537181 | 3300033004 | Soil | MFDNFPLWPQRASSMAGNVDALFIFLIIVSGLMTLLIFCAVL |
| Ga0335077_103924343 | 3300033158 | Soil | MFDNFPLWPVRASTMAANVDALYIFLVVLASFMSASIFTMILI |
| Ga0335077_105039813 | 3300033158 | Soil | MYETFPLWPARGSAGAAGVDALYVFLVALSVFTCLAIFAMILVFAV |
| Ga0314867_123824_489_602 | 3300033808 | Peatland | MFDNFPLWPARASSGAGNVDALYIFLVLLASFMSLAIF |
| ⦗Top⦘ |