| Basic Information | |
|---|---|
| Family ID | F023172 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 211 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Number of Associated Samples | 171 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.95 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 89.10 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.526 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.431 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.910 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.028 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 0.00% Coil/Unstructured: 77.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 211 Family Scaffolds |
|---|---|---|
| PF00494 | SQS_PSY | 92.42 |
| PF01593 | Amino_oxidase | 1.42 |
| PF01904 | DUF72 | 0.47 |
| PF02371 | Transposase_20 | 0.47 |
| PF03308 | MeaB | 0.47 |
| PF13450 | NAD_binding_8 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 211 Family Scaffolds |
|---|---|---|---|
| COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 92.42 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.47 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.53 % |
| Unclassified | root | N/A | 0.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000178|FW301_c1014942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300001137|JGI12637J13337_1015696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300001159|JGI12650J13346_1008004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 520 | Open in IMG/M |
| 3300001356|JGI12269J14319_10208706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300001413|JGI20180J14839_1013142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 566 | Open in IMG/M |
| 3300001593|JGI12635J15846_10166438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1494 | Open in IMG/M |
| 3300001661|JGI12053J15887_10428284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300002910|JGI25615J43890_1058270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300002917|JGI25616J43925_10311708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300004080|Ga0062385_11301055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
| 3300004092|Ga0062389_104109671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300004152|Ga0062386_100892959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300005180|Ga0066685_10025169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3623 | Open in IMG/M |
| 3300005332|Ga0066388_106365708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300005439|Ga0070711_101879765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005447|Ga0066689_10545169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300005467|Ga0070706_101323305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300005554|Ga0066661_10655667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300005575|Ga0066702_10456257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300005591|Ga0070761_10126439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1487 | Open in IMG/M |
| 3300005591|Ga0070761_10820345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300005843|Ga0068860_100062673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3533 | Open in IMG/M |
| 3300005844|Ga0068862_101902288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300005881|Ga0075294_1037857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005921|Ga0070766_11271496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300006031|Ga0066651_10001557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7930 | Open in IMG/M |
| 3300006174|Ga0075014_100043992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1884 | Open in IMG/M |
| 3300006175|Ga0070712_100137900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
| 3300006794|Ga0066658_10573949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300006797|Ga0066659_10833067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300006881|Ga0068865_100540492 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300006893|Ga0073928_10121892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2148 | Open in IMG/M |
| 3300006893|Ga0073928_10331747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300009012|Ga0066710_104724018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300009038|Ga0099829_10387024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300009038|Ga0099829_10439784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300009088|Ga0099830_10000131 | All Organisms → cellular organisms → Bacteria | 26917 | Open in IMG/M |
| 3300009088|Ga0099830_10752041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300009088|Ga0099830_11028779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300009089|Ga0099828_10166667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1955 | Open in IMG/M |
| 3300009089|Ga0099828_12040251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300009143|Ga0099792_10687590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300009519|Ga0116108_1007660 | All Organisms → cellular organisms → Bacteria | 4308 | Open in IMG/M |
| 3300009521|Ga0116222_1299848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300009545|Ga0105237_10536367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300009645|Ga0116106_1152311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 739 | Open in IMG/M |
| 3300010043|Ga0126380_10181723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300010322|Ga0134084_10082671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300010339|Ga0074046_10464971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300010343|Ga0074044_10846762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300010359|Ga0126376_13183600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300010360|Ga0126372_10446258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300010361|Ga0126378_10201137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2069 | Open in IMG/M |
| 3300010361|Ga0126378_12909671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300010362|Ga0126377_10311750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
| 3300010376|Ga0126381_100935653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300010376|Ga0126381_105165348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300010379|Ga0136449_101702208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300010880|Ga0126350_10215748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300011120|Ga0150983_10943845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300011269|Ga0137392_10138996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1952 | Open in IMG/M |
| 3300011270|Ga0137391_11002881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300011270|Ga0137391_11004313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300012096|Ga0137389_10086019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2468 | Open in IMG/M |
| 3300012096|Ga0137389_11164373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300012189|Ga0137388_11395009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300012189|Ga0137388_11535535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300012189|Ga0137388_11752993 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012202|Ga0137363_11661682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012203|Ga0137399_10469567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300012203|Ga0137399_11580900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300012205|Ga0137362_10007484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7731 | Open in IMG/M |
| 3300012205|Ga0137362_11020011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300012209|Ga0137379_10726070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300012349|Ga0137387_10063745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2494 | Open in IMG/M |
| 3300012349|Ga0137387_10382247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300012361|Ga0137360_10191273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1651 | Open in IMG/M |
| 3300012363|Ga0137390_10223653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1868 | Open in IMG/M |
| 3300012923|Ga0137359_10219520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
| 3300012923|Ga0137359_10267732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
| 3300012923|Ga0137359_10510610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300012924|Ga0137413_10974238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300012927|Ga0137416_11403783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300012929|Ga0137404_10286522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300012931|Ga0153915_11914487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300012971|Ga0126369_10023958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4934 | Open in IMG/M |
| 3300014154|Ga0134075_10039447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1935 | Open in IMG/M |
| 3300014155|Ga0181524_10085751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1811 | Open in IMG/M |
| 3300014491|Ga0182014_10597258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300015054|Ga0137420_1033023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300015168|Ga0167631_1050847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300016270|Ga0182036_10997649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300016319|Ga0182033_10668318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300016341|Ga0182035_11278786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300017656|Ga0134112_10330760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300017659|Ga0134083_10057039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
| 3300017934|Ga0187803_10079173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300017947|Ga0187785_10761515 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300017970|Ga0187783_10576961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300017974|Ga0187777_11118283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300018026|Ga0187857_10090452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1500 | Open in IMG/M |
| 3300018086|Ga0187769_11228687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300018088|Ga0187771_10311268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
| 3300018090|Ga0187770_10458497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300018482|Ga0066669_10743603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300019360|Ga0187894_10096898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1585 | Open in IMG/M |
| 3300020199|Ga0179592_10048511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1929 | Open in IMG/M |
| 3300020579|Ga0210407_10120575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2006 | Open in IMG/M |
| 3300020579|Ga0210407_10300425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300020579|Ga0210407_10442821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300020579|Ga0210407_10760267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300020579|Ga0210407_10805042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300020580|Ga0210403_10348640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300020580|Ga0210403_11270947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300020581|Ga0210399_10374169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300020581|Ga0210399_11301601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300021086|Ga0179596_10266306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300021168|Ga0210406_10640171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300021170|Ga0210400_10106038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2230 | Open in IMG/M |
| 3300021170|Ga0210400_10281350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300021171|Ga0210405_10126848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2016 | Open in IMG/M |
| 3300021171|Ga0210405_10835378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300021180|Ga0210396_10131237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2258 | Open in IMG/M |
| 3300021402|Ga0210385_11022397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300021404|Ga0210389_11020284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300021404|Ga0210389_11106179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300021405|Ga0210387_10397844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300021407|Ga0210383_10046354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3625 | Open in IMG/M |
| 3300021432|Ga0210384_10602777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300021475|Ga0210392_10536171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300021476|Ga0187846_10237371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300021477|Ga0210398_10375733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300021559|Ga0210409_10416682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300021560|Ga0126371_11095811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300021860|Ga0213851_1210788 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300022724|Ga0242665_10092526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300024179|Ga0247695_1046646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300024222|Ga0247691_1061583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300024227|Ga0228598_1129536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300024325|Ga0247678_1076339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300025899|Ga0207642_10967746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300025905|Ga0207685_10720494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300025906|Ga0207699_10992955 | Not Available | 620 | Open in IMG/M |
| 3300025915|Ga0207693_10480312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300025916|Ga0207663_11369108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300026328|Ga0209802_1310868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300026332|Ga0209803_1137944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300026355|Ga0257149_1035940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300026374|Ga0257146_1016539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300026376|Ga0257167_1075221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300026467|Ga0257154_1023609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300026489|Ga0257160_1034286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300026524|Ga0209690_1107028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300026524|Ga0209690_1279042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300027334|Ga0209529_1024589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300027548|Ga0209523_1127750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300027576|Ga0209003_1056076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300027663|Ga0208990_1021835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2079 | Open in IMG/M |
| 3300027738|Ga0208989_10179220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300027821|Ga0209811_10101931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300027853|Ga0209274_10176062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300027855|Ga0209693_10139191 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300027862|Ga0209701_10140868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
| 3300027862|Ga0209701_10152178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
| 3300027862|Ga0209701_10322433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300027875|Ga0209283_10082710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2082 | Open in IMG/M |
| 3300027889|Ga0209380_10410460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300027910|Ga0209583_10348479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300028047|Ga0209526_10430037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300028047|Ga0209526_10998160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300028381|Ga0268264_10062278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3132 | Open in IMG/M |
| 3300028536|Ga0137415_10186269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1899 | Open in IMG/M |
| 3300028731|Ga0302301_1119720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300028906|Ga0308309_10008476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6338 | Open in IMG/M |
| 3300029636|Ga0222749_10332405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300030509|Ga0302183_10384986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300031057|Ga0170834_101054917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300031122|Ga0170822_16197070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300031474|Ga0170818_113539804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300031573|Ga0310915_10076669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2214 | Open in IMG/M |
| 3300031668|Ga0318542_10471403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300031679|Ga0318561_10268405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300031708|Ga0310686_115207155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031718|Ga0307474_10704786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300031720|Ga0307469_10116763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1919 | Open in IMG/M |
| 3300031753|Ga0307477_10081392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2244 | Open in IMG/M |
| 3300031753|Ga0307477_10150787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1621 | Open in IMG/M |
| 3300031753|Ga0307477_10200822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
| 3300031753|Ga0307477_10646314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300031754|Ga0307475_10648543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300031754|Ga0307475_10685564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300031754|Ga0307475_11394356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300031879|Ga0306919_10445591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300031896|Ga0318551_10816010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300031962|Ga0307479_12032938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300032001|Ga0306922_10683583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300032010|Ga0318569_10073072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1520 | Open in IMG/M |
| 3300032067|Ga0318524_10629391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300032094|Ga0318540_10117521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1260 | Open in IMG/M |
| 3300032174|Ga0307470_10856560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300032205|Ga0307472_102546236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300032261|Ga0306920_100102191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4244 | Open in IMG/M |
| 3300032261|Ga0306920_102059481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300032261|Ga0306920_102157703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300032261|Ga0306920_102564750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300032261|Ga0306920_102768436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300032828|Ga0335080_11397603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300032828|Ga0335080_12241979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300032898|Ga0335072_10313443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1747 | Open in IMG/M |
| 3300033158|Ga0335077_11269378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300033402|Ga0326728_10729105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.95% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.47% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.47% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.47% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.47% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.47% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.47% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.47% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.47% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.47% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.47% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000178 | Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced) | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001413 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FW301_10149421 | 3300000178 | Groundwater | EAVARGDISAQDLISGEVRLADLPEAFRKMKSQRGEIKLVVRP* |
| JGI12637J13337_10156961 | 3300001137 | Forest Soil | EAIRRGDILSHDFITEEIRLADLPNAFARMKSRSGEIKLAVRP* |
| JGI12650J13346_10080042 | 3300001159 | Forest Soil | REALEAIRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP* |
| JGI12269J14319_102087061 | 3300001356 | Peatlands Soil | AMEAIRRGDISAQDFVTEEIGLVDLPQAFERMKARSGDIKLAVRP* |
| JGI20180J14839_10131421 | 3300001413 | Arctic Peat Soil | GDVSAQEFVTEEIRLEELPDAFARMKSRSGEIKLAVRP* |
| JGI12635J15846_101664381 | 3300001593 | Forest Soil | ILAHDFVTEEIRLADLPSAFARMKSRSGEIKLAVRP* |
| JGI12053J15887_104282842 | 3300001661 | Forest Soil | DISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| JGI25615J43890_10582701 | 3300002910 | Grasslands Soil | EAIRRGDILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP* |
| JGI25616J43925_103117081 | 3300002917 | Grasslands Soil | IRRGDISARDFVTEEIRLADLPQAFARMKARSGEIKLAVRP* |
| Ga0062385_113010552 | 3300004080 | Bog Forest Soil | IREALEAVRRGDVSAHEFVTEEIRLEDLPQAFARMKTRSGEIKLAVRP* |
| Ga0062389_1041096711 | 3300004092 | Bog Forest Soil | REALEAIRRGDIVGQDFVTEEIRLTELPQAFERMKIRSGEIKLAVRP* |
| Ga0062386_1008929592 | 3300004152 | Bog Forest Soil | EALEAVRRGDISAHDFVTEEIQLADLPQAFERMKARSGEIKLAVRP* |
| Ga0066685_100251693 | 3300005180 | Soil | FREALEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0066388_1063657082 | 3300005332 | Tropical Forest Soil | RGDISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP* |
| Ga0070711_1018797652 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FFREALEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0066689_105451691 | 3300005447 | Soil | EALEAIRRGDILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP* |
| Ga0070706_1013233051 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AIRRGDVSAQDFVTEDIRLEDLPQAFERMKARSGEIKLAVRP* |
| Ga0066661_106556672 | 3300005554 | Soil | LEAIRRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0066702_104562572 | 3300005575 | Soil | RRGDILAHDFVTEEIRLADLPHAFEKMKSRSGEIKLAVRP* |
| Ga0070761_101264392 | 3300005591 | Soil | IVGQDFVTEEIRLTDLPQAFERMKARSGEIKLAVRP* |
| Ga0070761_108203452 | 3300005591 | Soil | VGQDFVTEEIRLTDLPQAFERMKSRSGEIKLAVRP* |
| Ga0068860_1000626731 | 3300005843 | Switchgrass Rhizosphere | EALEAVRRGDISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP* |
| Ga0068862_1019022881 | 3300005844 | Switchgrass Rhizosphere | RRGDILAHDFVTEEITLAELPQAFERMKSRSGEIKLAVRP* |
| Ga0075294_10378571 | 3300005881 | Rice Paddy Soil | EAIRRGDVLARDFVTEEIRLVDLPQAFQKMKSRSGEIKLAVRP* |
| Ga0070766_112714962 | 3300005921 | Soil | RRGDIVGQDFVTEEIRLTDLPQAFERMKARSGEIKLAVRP* |
| Ga0066651_1000155710 | 3300006031 | Soil | GDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0075014_1000439921 | 3300006174 | Watersheds | ISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0070712_1001379002 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SAQDFVTEDIRLEDLPQAFERMKARSGEIKLAVRP* |
| Ga0066658_105739491 | 3300006794 | Soil | EALEAIRRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0066659_108330671 | 3300006797 | Soil | DISAHDFVTEEISLNDLPQAFERMKARSGEIKVAVRP* |
| Ga0068865_1005404921 | 3300006881 | Miscanthus Rhizosphere | EAIRRGDILAHDFVTEEITLAELPQAFERMKSRSGEIKLAVRP* |
| Ga0073928_101218922 | 3300006893 | Iron-Sulfur Acid Spring | DALEAIRRGDISAHDFVTEEIRLADLPQAFERMQARSGQIKLAVRP* |
| Ga0073928_103317472 | 3300006893 | Iron-Sulfur Acid Spring | LAHDFVTEEIRLDELPQAFERMKSRSGEIKLAVRP* |
| Ga0066710_1047240181 | 3300009012 | Grasslands Soil | RGDISAHDFVTEEISLNDLPQAFERMKARSGEIKVAVRP |
| Ga0099829_103870242 | 3300009038 | Vadose Zone Soil | EAVRRGEISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0099829_104397842 | 3300009038 | Vadose Zone Soil | REALEAIRRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0099830_1000013124 | 3300009088 | Vadose Zone Soil | IREALEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0099830_107520411 | 3300009088 | Vadose Zone Soil | DISARDFVTEEIRLADLPQAFARMKARSGEIKLAVRP* |
| Ga0099830_110287791 | 3300009088 | Vadose Zone Soil | DILAHDFVTEEIRLEDLPHAFEKMKTRSGEIKLAVRP* |
| Ga0099828_101666672 | 3300009089 | Vadose Zone Soil | ARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0099828_120402512 | 3300009089 | Vadose Zone Soil | EAIRRGDISAHDFVTQDIRLEDLPQAFERMKTRSGEIKLAVRP* |
| Ga0099792_106875901 | 3300009143 | Vadose Zone Soil | LAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP* |
| Ga0116108_10076605 | 3300009519 | Peatland | EAIRRGDISAQDFVTEEIGLADLPQAFERMKARSGEIKLAVRP* |
| Ga0116222_12998482 | 3300009521 | Peatlands Soil | REAMEAIRRGDISAQDFVTEEIGLVDLPQAFERMKARSGDIKLAVRP* |
| Ga0105237_105363671 | 3300009545 | Corn Rhizosphere | AVRRGDISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP* |
| Ga0116106_11523111 | 3300009645 | Peatland | RGDISAQDFVTEEIGLADLPQAFERMKARSGEIKLAVRP* |
| Ga0126380_101817231 | 3300010043 | Tropical Forest Soil | ISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0134084_100826712 | 3300010322 | Grasslands Soil | LEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0074046_104649712 | 3300010339 | Bog Forest Soil | REALEAVRRGDVSAEEFVTEEIRLEDLPQAFARMKSRSGEIKLAVRP* |
| Ga0074044_108467622 | 3300010343 | Bog Forest Soil | FFREALEAIRRGDISAHDFVTEEIALTELPQAFERMKARSGEIKVAVRP* |
| Ga0126376_131836001 | 3300010359 | Tropical Forest Soil | ISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP* |
| Ga0126372_104462581 | 3300010360 | Tropical Forest Soil | IREALEAIKRGDISAHDFVTEEITLNDLPQAFERMKSRSGEIKVAVRP* |
| Ga0126378_102011371 | 3300010361 | Tropical Forest Soil | EALEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0126378_129096711 | 3300010361 | Tropical Forest Soil | SAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0126377_103117502 | 3300010362 | Tropical Forest Soil | AQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0126381_1009356531 | 3300010376 | Tropical Forest Soil | ALEAIRRGDVSAQDLVTEDIRLEDLPQAFERMKARSGEIKLAVRP* |
| Ga0126381_1051653481 | 3300010376 | Tropical Forest Soil | EALEAVRRGDISAQDFVTEEIRLADLPQAFERMKTRSGEIKLAVRP* |
| Ga0136449_1017022081 | 3300010379 | Peatlands Soil | GDIVGQDFVTEEIRLTELPQAFERMKIRSGEIKLAVRP* |
| Ga0126350_102157482 | 3300010880 | Boreal Forest Soil | RFFRDALEAIRRGDISAHDFVTEEIRLADLPQAFERMQARSGQIKLAVRP* |
| Ga0150983_109438452 | 3300011120 | Forest Soil | LEAIRRGDISARDFVTEEIRLADLPQAFARIKSRSGEIKLAVRP* |
| Ga0137392_101389961 | 3300011269 | Vadose Zone Soil | ARDFVTEEIRLADLPQAFARMKARSGEIKLAVRP* |
| Ga0137391_110028812 | 3300011270 | Vadose Zone Soil | DISAHDFVTQEVRLADLPQAFERMKTRSGEIKLAVRP* |
| Ga0137391_110043132 | 3300011270 | Vadose Zone Soil | GDILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP* |
| Ga0137389_100860191 | 3300012096 | Vadose Zone Soil | ILAHDFVTEEIRLADLPSAFERMKSRSGEIKLAVRP* |
| Ga0137389_111643731 | 3300012096 | Vadose Zone Soil | MADRLFEAIRRGDISAHDFVTQEIRLADLPQAFQRMKTRSGEIKLAVRP* |
| Ga0137388_113950091 | 3300012189 | Vadose Zone Soil | EALEAIRRGDILAHDFVTEEIRLEDLPHAFEKMKTRSGEIKLAVRP* |
| Ga0137388_115355351 | 3300012189 | Vadose Zone Soil | AHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0137388_117529931 | 3300012189 | Vadose Zone Soil | ILAREFVTEEIRLADLPQAFQKMKSHDGEIKLAVRP* |
| Ga0137363_116616821 | 3300012202 | Vadose Zone Soil | ILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP* |
| Ga0137399_104695671 | 3300012203 | Vadose Zone Soil | ISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP* |
| Ga0137399_115809002 | 3300012203 | Vadose Zone Soil | IREAMEAIRRGDILAHDFVTEEIRLADLPSAFERMKSRSGEIKLAVRP* |
| Ga0137362_100074841 | 3300012205 | Vadose Zone Soil | RGDISARDFVTQEVRLADLPQAFERMKTRSGEIKLAVRP* |
| Ga0137362_110200111 | 3300012205 | Vadose Zone Soil | EALEAIKRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0137379_107260701 | 3300012209 | Vadose Zone Soil | IREAREAVRRGDISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0137387_100637453 | 3300012349 | Vadose Zone Soil | AIRRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0137387_103822471 | 3300012349 | Vadose Zone Soil | LEAVRRGDISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0137360_101912731 | 3300012361 | Vadose Zone Soil | EALEAVRRGDISAQDFVTEEIRLAELPQAFERMKSRSGEIKLAVRP* |
| Ga0137390_102236531 | 3300012363 | Vadose Zone Soil | GDISARDFVTEEIRLADLPQAFARMKACSGEIKLAVRP* |
| Ga0137359_102195201 | 3300012923 | Vadose Zone Soil | GDISARDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0137359_102677322 | 3300012923 | Vadose Zone Soil | CGDILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP* |
| Ga0137359_105106102 | 3300012923 | Vadose Zone Soil | IRRGDILAHDFVTEEIRLADLPHAFEKMKSRSGEIKLAVRP* |
| Ga0137413_109742381 | 3300012924 | Vadose Zone Soil | IREALEAIRRGDILAHDFVTEEIRLADLPHAFEKMKSRSGEIKLAVRP* |
| Ga0137416_114037831 | 3300012927 | Vadose Zone Soil | DILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP* |
| Ga0137404_102865221 | 3300012929 | Vadose Zone Soil | MPTTTIETFAQREALEAVRRGDISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP* |
| Ga0153915_119144872 | 3300012931 | Freshwater Wetlands | GDVLARDFVTEEIRLVDLPQAFQKMKSRSGEIKLAVRP* |
| Ga0126369_100239585 | 3300012971 | Tropical Forest Soil | DISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP* |
| Ga0134075_100394472 | 3300014154 | Grasslands Soil | ALEAIRRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0181524_100857511 | 3300014155 | Bog | RGDISAQDFVTEEIGLVDLPQAFERMKARSGEIKLAVRP* |
| Ga0182014_105972581 | 3300014491 | Bog | REALEAVRRGDVSAEEFVSEEIRLEDLPQAFARMKSRSGELKLAVRPDWRFVTGAW* |
| Ga0137420_10330231 | 3300015054 | Vadose Zone Soil | IRRGDISVSARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP* |
| Ga0167631_10508471 | 3300015168 | Glacier Forefield Soil | LQANRRGDISAPDFVTEEIRLADLPRAFERMQARSGQIKLAVRP* |
| Ga0182036_109976492 | 3300016270 | Soil | DVSAPDFVTEDIRLEDLPQAFERMKARSGEIKLAVRP |
| Ga0182033_106683181 | 3300016319 | Soil | AVRRGDISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP |
| Ga0182035_112787862 | 3300016341 | Soil | DVSAEAFVTEEIRLEDLPQAFARMKARSGEIKLAVRP |
| Ga0134112_103307601 | 3300017656 | Grasslands Soil | AIRRGDISAHDFVSEEIRLTDLPQAFERMKSRSGEIKLAVRP |
| Ga0134083_100570392 | 3300017659 | Grasslands Soil | RRGDISAHDFVSEEIRLTDLPQAFERMKSRSGEIKLAVRP |
| Ga0187803_100791732 | 3300017934 | Freshwater Sediment | GDISAQDFVTEEIGLVDLPQAFERMKARSGEIKLAVRP |
| Ga0187785_107615151 | 3300017947 | Tropical Peatland | LEAVRRGDVSAEEFVTEEIRLEDLPQAFERMKSRSGEIKLAVRP |
| Ga0187783_105769612 | 3300017970 | Tropical Peatland | GDILAHDFVTEEISLAELPQAFERMKSRSGEIKLAVRP |
| Ga0187777_111182832 | 3300017974 | Tropical Peatland | LEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0187857_100904521 | 3300018026 | Peatland | AMEAIRRGDISAQDFVTEEIGLVDLPQAFERMKARSGEIKLAVRP |
| Ga0187769_112286871 | 3300018086 | Tropical Peatland | AVRRGDISAQEFVTEEIRLEGLPQAFERMKSRSGEIKLAVRP |
| Ga0187771_103112681 | 3300018088 | Tropical Peatland | REALEAVRRGDISAEEFVTEEIRLQGLPQAFERMKARSGEIKLAVRP |
| Ga0187770_104584971 | 3300018090 | Tropical Peatland | EAVRRGDISAAEFVTEEIPLQGLPQAFERMKSRSGEIKLAVRP |
| Ga0066669_107436032 | 3300018482 | Grasslands Soil | ALEAVKRGDISAHDFVTEEISLNDLPQAFERMKARSGEIKVAVRP |
| Ga0187894_100968982 | 3300019360 | Microbial Mat On Rocks | DISAQDFISGEIYLCDLPDAFHKMKSRRGEIKLAVRP |
| Ga0179592_100485111 | 3300020199 | Vadose Zone Soil | IRRGDIVGQDFVTEEIRLTDLPQAFERMKSRSGEIKLAVRP |
| Ga0210407_101205752 | 3300020579 | Soil | RFILEALEAIKRGDITAQDFVTEEISLADLPEAFERMKSRSGEIKLAVRP |
| Ga0210407_103004252 | 3300020579 | Soil | REALEAIRRGDILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP |
| Ga0210407_104428211 | 3300020579 | Soil | GDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0210407_107602672 | 3300020579 | Soil | EALEAIRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0210407_108050422 | 3300020579 | Soil | FREALEAIRRGDISAHDFVTEEIRLTDLPQAFARMKSRSGEIKLAVRP |
| Ga0210403_103486402 | 3300020580 | Soil | DISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0210403_112709471 | 3300020580 | Soil | LAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP |
| Ga0210399_103741692 | 3300020581 | Soil | RRGDIVGQDFVTEEIRLTELPQAFERMKIRSGEIKLAVRP |
| Ga0210399_113016011 | 3300020581 | Soil | DISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP |
| Ga0179596_102663061 | 3300021086 | Vadose Zone Soil | RFFREALEAIRRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP |
| Ga0210406_106401712 | 3300021168 | Soil | AIRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0210400_101060381 | 3300021170 | Soil | ALEAIRRGDILAHDFVTEEIRLDELPQAFERMKSRSGEIKLAVRP |
| Ga0210400_102813502 | 3300021170 | Soil | IREALEAIRRGDILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP |
| Ga0210405_101268482 | 3300021171 | Soil | IREALEAIRRGDVSAQDFVTEDIRLEDLPQAFERMKARSGEIKLAVRP |
| Ga0210405_108353782 | 3300021171 | Soil | LEAIRRGDISAHDFVTQEIRLADLPQAFQRMKTRSGEIKLAVRP |
| Ga0210396_101312372 | 3300021180 | Soil | IRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0210385_110223971 | 3300021402 | Soil | RGDILAHDFVTEEISLDELPQAFERMKSRSGEIKLAVRP |
| Ga0210389_110202841 | 3300021404 | Soil | RDALEAIRRGDISAHDFVTEEIRLADLPQAFERMQARSGQIKLAVRP |
| Ga0210389_111061791 | 3300021404 | Soil | RGDILAHDFVTEEIRLEDLPHAFQKMKSRSGEIKLAVRP |
| Ga0210387_103978441 | 3300021405 | Soil | PRVIREALEAIRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0210383_100463543 | 3300021407 | Soil | RGDILAHDFVTEEISLNELPQAFQRMKSRNGEMKLAVRP |
| Ga0210384_106027772 | 3300021432 | Soil | LEAIRRGDILAHDFVTEEIRLEDLPHAFQKMKSRSGEIKLAVRP |
| Ga0210392_105361711 | 3300021475 | Soil | ALEAIRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0187846_102373711 | 3300021476 | Biofilm | AIRRGDISARDFVSEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0210398_103757332 | 3300021477 | Soil | AIRRGDIVGQDFVTEEIRLTELPQAFERMKIRSGEIKLAVRP |
| Ga0210409_104166821 | 3300021559 | Soil | LAHDFVTEEISLNELPQAFERMKTRNGEIKLAVRP |
| Ga0126371_110958111 | 3300021560 | Tropical Forest Soil | EAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0213851_12107881 | 3300021860 | Watersheds | REALEAIRRGDISAHDFVTQEIRLADLPQAFQRMKTRSGEIKLAVRP |
| Ga0242665_100925261 | 3300022724 | Soil | TPRFFREALEAIRRGDISAHDFVTEEIRLTDLPQAFARMKSRSGEIKLAVRP |
| Ga0247695_10466462 | 3300024179 | Soil | IRRGDIVGHDFVTEEIRLTDLPQAFERMKSRSGEIKLAVRP |
| Ga0247691_10615831 | 3300024222 | Soil | SAQDFVTEEINLTDLPQAFERMKARSGEIKVAVRP |
| Ga0228598_11295361 | 3300024227 | Rhizosphere | IVGQDFVTEEIPLTELPRAFERMKIRSGEIKLAVRP |
| Ga0247678_10763391 | 3300024325 | Soil | LEAVKRGDISAQDFVTEEISLNDLPQAFERMKARSGEIKVAVRP |
| Ga0207642_109677462 | 3300025899 | Miscanthus Rhizosphere | VRRGDISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP |
| Ga0207685_107204942 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | REALEAIRRGDILAHDFITEEITLAELPNAFERMKSRSGEIKLAVRP |
| Ga0207699_109929551 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DILAHDFVTEEITLAELPQAFERMKARSGEIKLAVRP |
| Ga0207693_104803121 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAIRRGDILAHDFVTEEITLAELPQAFERMKSRSGEIKLAVRP |
| Ga0207663_113691082 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EALEAVRRGDISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP |
| Ga0209802_13108681 | 3300026328 | Soil | RRGDISAHDFVSEEIRLTDLPRAFERMKSRSGEIKLAVRP |
| Ga0209803_11379441 | 3300026332 | Soil | RFFREALEAIRRGEISARDFVTEEIPLQELPQAFERMKTRSGEIKLAVRP |
| Ga0257149_10359401 | 3300026355 | Soil | FREALEAIRRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP |
| Ga0257146_10165392 | 3300026374 | Soil | RGDISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0257167_10752211 | 3300026376 | Soil | FFREALEAIRRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP |
| Ga0257154_10236092 | 3300026467 | Soil | LGHDFVTEEIRLTDLPQAFERMKSRSGEIKLAVRP |
| Ga0257160_10342861 | 3300026489 | Soil | SAQDFVTEEISLSDLPQAFERMKARSGEIKVAVRP |
| Ga0209690_11070282 | 3300026524 | Soil | ISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0209690_12790421 | 3300026524 | Soil | RGEISARDFVTEEIPLQELPQAFERMKTRSGEIKLAVRP |
| Ga0209529_10245891 | 3300027334 | Forest Soil | LEAIRRGDILAHDFVTEEIRLDELPQAFERMKSRSGEIKLAVRP |
| Ga0209523_11277502 | 3300027548 | Forest Soil | NTPLSKLALEAIRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0209003_10560762 | 3300027576 | Forest Soil | REALEAVRRGDISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0208990_10218352 | 3300027663 | Forest Soil | IREALEAIRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0208989_101792202 | 3300027738 | Forest Soil | ISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0209811_101019312 | 3300027821 | Surface Soil | RGDIVGHDFVTEEIRLTDLPQAFERMKSRSGEIKLAVRP |
| Ga0209274_101760622 | 3300027853 | Soil | REALEAIRRGDIVGQDFVTEEIRLTDLPQAFERMKARSGEIKLAVRP |
| Ga0209693_101391912 | 3300027855 | Soil | RGDIVGQDFVTEEIRLTDLPQAFERMKSRSGEIKLAVRP |
| Ga0209701_101408681 | 3300027862 | Vadose Zone Soil | RRGDISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP |
| Ga0209701_101521782 | 3300027862 | Vadose Zone Soil | RRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0209701_103224332 | 3300027862 | Vadose Zone Soil | IRRGDILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP |
| Ga0209283_100827102 | 3300027875 | Vadose Zone Soil | RGDISARDFVTEEIRLADLPQAFARMKARSGEIKLAVRP |
| Ga0209380_104104601 | 3300027889 | Soil | EALEAIRRGDILAHDFVTEEIRLDELPQAFERMKSRSGEIKLAVRP |
| Ga0209583_103484791 | 3300027910 | Watersheds | IRRGDISAGDFVSEEIRLEDLPQAFARMKTRSGEIKLAVRP |
| Ga0209526_104300372 | 3300028047 | Forest Soil | ISAHDFVTEEIRLADLPQAFERMQARSGQIKLAVRP |
| Ga0209526_109981601 | 3300028047 | Forest Soil | TPRFFRDALEAIRRGDISAHDFVTEEIRLADLPQAFERMQTRSGQIKLAVRP |
| Ga0268264_100622781 | 3300028381 | Switchgrass Rhizosphere | REALEAVRRGDISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP |
| Ga0137415_101862691 | 3300028536 | Vadose Zone Soil | IRRGDISARDFVTEEIRLADLPQAFARMKARSGEIKLAVRP |
| Ga0302301_11197201 | 3300028731 | Palsa | RRGDISASEFVTEEIALAQLPQAFEKMKSRSGEIKVAVRP |
| Ga0308309_100084768 | 3300028906 | Soil | LEAIRRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0222749_103324052 | 3300029636 | Soil | RGDILAHDFVTEEISLAELPQAFERMKSRSGEVKLAVRP |
| Ga0302183_103849862 | 3300030509 | Palsa | LEAIRRGDISAHDFVTEEIALRELPQAFERMKARSGEIKVAVRP |
| Ga0170834_1010549172 | 3300031057 | Forest Soil | LEAVRRGDISAQDFVTEEIRLTDLPQAFERMKSRSGEIKLAVRP |
| Ga0170822_161970701 | 3300031122 | Forest Soil | RRGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0170818_1135398041 | 3300031474 | Forest Soil | LEAVRRGDISAQDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0310915_100766691 | 3300031573 | Soil | GDVSAEEIVTEEIRLEELPQAFERMKARSGEIKLAVRP |
| Ga0318542_104714032 | 3300031668 | Soil | LEAVRRGDVSAEEIVTEEIRLEELPQAFERMKARSGEIKLAVRP |
| Ga0318561_102684052 | 3300031679 | Soil | RRGDVSAEEIVTEEIRLEELPQAFERMKARSGEIKLAVRP |
| Ga0310686_1152071552 | 3300031708 | Soil | DISAHDFVTEEIALTELPQAFERMKARSGEIKVAVRP |
| Ga0307474_107047861 | 3300031718 | Hardwood Forest Soil | ALEAIRRGDILAHDFVTEEIRLNELPQAFERMKSRNGEIKLAVRP |
| Ga0307469_101167631 | 3300031720 | Hardwood Forest Soil | RGDVSAQDFVTEDIRLEDLPQAFERMKARSGEIKLAVRP |
| Ga0307477_100813922 | 3300031753 | Hardwood Forest Soil | FREALEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0307477_101507871 | 3300031753 | Hardwood Forest Soil | DILAHDFVTEEIRLEDLPHAFEKMKSRSGEIKLAVRP |
| Ga0307477_102008222 | 3300031753 | Hardwood Forest Soil | ISARDFVTEEIRLADLPQAFARMKSRSGEIKLAVRP |
| Ga0307477_106463142 | 3300031753 | Hardwood Forest Soil | RGDISAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0307475_106485431 | 3300031754 | Hardwood Forest Soil | RRGDILAHDFVTEEISLNELPQAFERMKTRNGEIKLAVRP |
| Ga0307475_106855642 | 3300031754 | Hardwood Forest Soil | REALEAIRRGDILAHDFVSEEIRLEDLPRAFEKMKSRSGEIKLAVRP |
| Ga0307475_113943561 | 3300031754 | Hardwood Forest Soil | SAHDFVTEDIRLEDLPQAFERMKTRSGEIKLAVRP |
| Ga0306919_104455912 | 3300031879 | Soil | IREALEAVRRGDISAQDFVTEEIRLADLPQAFERMKARSGEIKLAVRP |
| Ga0318551_108160101 | 3300031896 | Soil | ALEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKVAVRP |
| Ga0307479_120329381 | 3300031962 | Hardwood Forest Soil | AIKRGDISARDFVTEEIRLADLPQAFARMKERSGEIKLAVRP |
| Ga0306922_106835831 | 3300032001 | Soil | RGDVSAEEIVTEEIRLEELPQAFERMKARSGEIKLAVRP |
| Ga0318569_100730722 | 3300032010 | Soil | EALEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKVAVRP |
| Ga0318524_106293911 | 3300032067 | Soil | REALEAVRRGDVSAEEIVTEEIRLEELPQAFERMKARSGEIKLAVRP |
| Ga0318540_101175212 | 3300032094 | Soil | DIYAQDFVTEEIRLEDLPLAFEKMKSRSGEIKLAVRP |
| Ga0307470_108565601 | 3300032174 | Hardwood Forest Soil | GDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0307472_1025462362 | 3300032205 | Hardwood Forest Soil | ALEAIRRGDISAHDFVTEEIRLADLPQAFERMKSRSGEIKLAVRP |
| Ga0306920_1001021915 | 3300032261 | Soil | EAIRRGDISANDFVTEDIRLEDLPQAFERMKSRSGEIKLAVRP |
| Ga0306920_1020594811 | 3300032261 | Soil | IRRGDVSAHDFVTEDIRLEDLPQAFERMKSRSGEIKLAVRP |
| Ga0306920_1021577032 | 3300032261 | Soil | LEAVKRGDISAQDFVTEEITLADLPQTFERMKSRSGEIKVAVRP |
| Ga0306920_1025647501 | 3300032261 | Soil | LEAIRRGDISAHDFVTEDILLEDLPQAFERMKARSGEIKLAVRP |
| Ga0306920_1027684362 | 3300032261 | Soil | VRRGDVSAEEIVTEEIRLEELPQAFERMKARSGEIKLAVRP |
| Ga0335080_113976031 | 3300032828 | Soil | DILGQDFVTEEIRLSDLPQAFERMKSRSGEIKLAVRP |
| Ga0335080_122419792 | 3300032828 | Soil | IMGQDFVTEEIRLTDLPRAFERMKSRSGEIKLAVRP |
| Ga0335072_103134431 | 3300032898 | Soil | AMEAVRRGDISAQDFVSEEIALVDLPQAFERMKTRSGEIKLAVRP |
| Ga0335077_112693781 | 3300033158 | Soil | QYHKHKLHDELTNKNIVTEDIRLEDLPQAFERMKARSGEIKLAVRP |
| Ga0326728_107291051 | 3300033402 | Peat Soil | GDVSAQEFVTEEIRLEELPEAFARMKSRSGEIKLAVRP |
| ⦗Top⦘ |