NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F023151

Metagenome / Metatranscriptome Family F023151

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023151
Family Type Metagenome / Metatranscriptome
Number of Sequences 211
Average Sequence Length 47 residues
Representative Sequence KSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR
Number of Associated Samples 133
Number of Associated Scaffolds 211

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.47 %
% of genes near scaffold ends (potentially truncated) 99.53 %
% of genes from short scaffolds (< 2000 bps) 91.94 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.526 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(38.389 % of family members)
Environment Ontology (ENVO) Unclassified
(57.820 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.133 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.86%    β-sheet: 28.17%    Coil/Unstructured: 61.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 211 Family Scaffolds
PF01594AI-2E_transport 8.53
PF13091PLDc_2 2.37
PF10691DUF2497 1.90
PF03401TctC 0.95
PF11684DUF3280 0.95
PF00941FAD_binding_5 0.47
PF10518TAT_signal 0.47
PF01047MarR 0.47
PF13676TIR_2 0.47
PF02738MoCoBD_1 0.47
PF00239Resolvase 0.47
PF01381HTH_3 0.47
PF02780Transketolase_C 0.47
PF01341Glyco_hydro_6 0.47
PF13565HTH_32 0.47
PF00118Cpn60_TCP1 0.47
PF03767Acid_phosphat_B 0.47
PF13379NMT1_2 0.47
PF00994MoCF_biosynth 0.47
PF01642MM_CoA_mutase 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 211 Family Scaffolds
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 8.53
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.95
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.47
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.47
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.47
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.47
COG2503Predicted secreted acid phosphataseGeneral function prediction only [R] 0.47
COG3700Acid phosphatase, class BInorganic ion transport and metabolism [P] 0.47
COG5297Cellulase/cellobiase CelA1Carbohydrate transport and metabolism [G] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.53 %
UnclassifiedrootN/A0.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000443|F12B_10385119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1071375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1056682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1018232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1153Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1078724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300001545|JGI12630J15595_10058943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium762Open in IMG/M
3300002910|JGI25615J43890_1026449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium958Open in IMG/M
3300004479|Ga0062595_100958424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium729Open in IMG/M
3300004633|Ga0066395_10485819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium709Open in IMG/M
3300004633|Ga0066395_10588859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300004633|Ga0066395_10689607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300005163|Ga0066823_10040361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium810Open in IMG/M
3300005165|Ga0066869_10097716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300005332|Ga0066388_100277959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02832317Open in IMG/M
3300005332|Ga0066388_100577223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1750Open in IMG/M
3300005332|Ga0066388_101508437All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300005332|Ga0066388_102956784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium868Open in IMG/M
3300005332|Ga0066388_103671762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium783Open in IMG/M
3300005332|Ga0066388_104959343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300005332|Ga0066388_104961725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300005332|Ga0066388_106242705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300005347|Ga0070668_102129963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300005363|Ga0008090_10064849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium957Open in IMG/M
3300005363|Ga0008090_10069088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium804Open in IMG/M
3300005575|Ga0066702_10161653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1333Open in IMG/M
3300005713|Ga0066905_101008318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium734Open in IMG/M
3300005764|Ga0066903_101311128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1353Open in IMG/M
3300005764|Ga0066903_103274733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium875Open in IMG/M
3300005764|Ga0066903_106455403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300005764|Ga0066903_108154706All Organisms → cellular organisms → Bacteria → Proteobacteria536Open in IMG/M
3300005764|Ga0066903_108609367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300006034|Ga0066656_10398875All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300006175|Ga0070712_102053493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300006800|Ga0066660_11242769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300006852|Ga0075433_11289761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300006854|Ga0075425_102270142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300009038|Ga0099829_11088946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300009100|Ga0075418_13170894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300009137|Ga0066709_103136914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300009143|Ga0099792_10416314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium825Open in IMG/M
3300009147|Ga0114129_11035377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1032Open in IMG/M
3300009147|Ga0114129_11934135All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300009162|Ga0075423_11219726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium803Open in IMG/M
3300009792|Ga0126374_10882663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300010043|Ga0126380_10584472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium876Open in IMG/M
3300010043|Ga0126380_10638538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium845Open in IMG/M
3300010043|Ga0126380_11353528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300010046|Ga0126384_11148905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria714Open in IMG/M
3300010046|Ga0126384_11252860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300010046|Ga0126384_11625083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300010323|Ga0134086_10134502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium894Open in IMG/M
3300010359|Ga0126376_10273747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1451Open in IMG/M
3300010359|Ga0126376_12187837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300010360|Ga0126372_10158673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1821Open in IMG/M
3300010360|Ga0126372_10809145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium929Open in IMG/M
3300010360|Ga0126372_12095722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300010361|Ga0126378_10731388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1101Open in IMG/M
3300010361|Ga0126378_11268794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium833Open in IMG/M
3300010362|Ga0126377_10892045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium951Open in IMG/M
3300010366|Ga0126379_10695973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1110Open in IMG/M
3300010366|Ga0126379_11457861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium790Open in IMG/M
3300010376|Ga0126381_100906774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS1131269Open in IMG/M
3300010376|Ga0126381_102208127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium792Open in IMG/M
3300010376|Ga0126381_103214511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300010396|Ga0134126_12504376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300010398|Ga0126383_11916116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300010398|Ga0126383_13146380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300010868|Ga0124844_1109850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1051Open in IMG/M
3300011271|Ga0137393_11024255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium703Open in IMG/M
3300012198|Ga0137364_10232531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1358Open in IMG/M
3300012201|Ga0137365_10810924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium683Open in IMG/M
3300012211|Ga0137377_11270245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium666Open in IMG/M
3300012285|Ga0137370_10297113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium964Open in IMG/M
3300012350|Ga0137372_10835324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300012361|Ga0137360_10393885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1166Open in IMG/M
3300012941|Ga0162652_100039824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium736Open in IMG/M
3300012955|Ga0164298_10993131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300012989|Ga0164305_10934863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium731Open in IMG/M
3300015357|Ga0134072_10115981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium842Open in IMG/M
3300016270|Ga0182036_11243652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300016294|Ga0182041_11507184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300016319|Ga0182033_10674139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300016357|Ga0182032_10883169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium759Open in IMG/M
3300016371|Ga0182034_10445857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1071Open in IMG/M
3300016371|Ga0182034_10550778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium968Open in IMG/M
3300016371|Ga0182034_10759446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium828Open in IMG/M
3300016387|Ga0182040_11017871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300016387|Ga0182040_11160238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300016404|Ga0182037_10719511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium856Open in IMG/M
3300016404|Ga0182037_11713492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300016422|Ga0182039_10555049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium999Open in IMG/M
3300016445|Ga0182038_10280248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1354Open in IMG/M
3300016445|Ga0182038_10931279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium767Open in IMG/M
3300016445|Ga0182038_10968207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium752Open in IMG/M
3300016445|Ga0182038_11317060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300016445|Ga0182038_11997930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300021560|Ga0126371_10848898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1058Open in IMG/M
3300021560|Ga0126371_11101791All Organisms → cellular organisms → Bacteria → Proteobacteria933Open in IMG/M
3300025906|Ga0207699_10302171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1118Open in IMG/M
3300026327|Ga0209266_1275040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300026507|Ga0257165_1031042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium932Open in IMG/M
3300027654|Ga0209799_1007457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2299Open in IMG/M
3300027874|Ga0209465_10092191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1482Open in IMG/M
3300027874|Ga0209465_10108163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1366Open in IMG/M
3300031543|Ga0318516_10828152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300031545|Ga0318541_10086191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1668Open in IMG/M
3300031546|Ga0318538_10066541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1801Open in IMG/M
3300031546|Ga0318538_10542760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300031561|Ga0318528_10010584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4175Open in IMG/M
3300031561|Ga0318528_10265275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium921Open in IMG/M
3300031564|Ga0318573_10053084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1984Open in IMG/M
3300031564|Ga0318573_10776930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300031572|Ga0318515_10007803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4613Open in IMG/M
3300031573|Ga0310915_10830610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300031640|Ga0318555_10598009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300031668|Ga0318542_10003104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5411Open in IMG/M
3300031679|Ga0318561_10048542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2115Open in IMG/M
3300031679|Ga0318561_10105835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1482Open in IMG/M
3300031679|Ga0318561_10483747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300031680|Ga0318574_10578277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium658Open in IMG/M
3300031682|Ga0318560_10043580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2184Open in IMG/M
3300031713|Ga0318496_10520765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium657Open in IMG/M
3300031724|Ga0318500_10021505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2473Open in IMG/M
3300031724|Ga0318500_10356107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium723Open in IMG/M
3300031736|Ga0318501_10072915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1662Open in IMG/M
3300031736|Ga0318501_10418165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium725Open in IMG/M
3300031744|Ga0306918_10067058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2448Open in IMG/M
3300031744|Ga0306918_10200997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1502Open in IMG/M
3300031747|Ga0318502_10598285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300031751|Ga0318494_10191366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1163Open in IMG/M
3300031763|Ga0318537_10207622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium728Open in IMG/M
3300031764|Ga0318535_10316943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300031764|Ga0318535_10481164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300031768|Ga0318509_10003892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5717Open in IMG/M
3300031770|Ga0318521_10591599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300031777|Ga0318543_10471992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300031780|Ga0318508_1054844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1060Open in IMG/M
3300031780|Ga0318508_1184101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300031792|Ga0318529_10473699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300031794|Ga0318503_10146283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium761Open in IMG/M
3300031796|Ga0318576_10124946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1189Open in IMG/M
3300031805|Ga0318497_10169404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1200Open in IMG/M
3300031805|Ga0318497_10804259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300031832|Ga0318499_10309811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300031835|Ga0318517_10239744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium818Open in IMG/M
3300031835|Ga0318517_10361294All Organisms → cellular organisms → Bacteria → Proteobacteria656Open in IMG/M
3300031846|Ga0318512_10113205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1285Open in IMG/M
3300031859|Ga0318527_10139464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1013Open in IMG/M
3300031860|Ga0318495_10208358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium879Open in IMG/M
3300031879|Ga0306919_10048188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2804Open in IMG/M
3300031879|Ga0306919_10606589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium844Open in IMG/M
3300031879|Ga0306919_10851738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300031879|Ga0306919_11052099All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300031879|Ga0306919_11276454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300031879|Ga0306919_11484960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300031880|Ga0318544_10031032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1856Open in IMG/M
3300031890|Ga0306925_10608326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1153Open in IMG/M
3300031894|Ga0318522_10015276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2405Open in IMG/M
3300031896|Ga0318551_10832476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300031897|Ga0318520_10118449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1505Open in IMG/M
3300031910|Ga0306923_11083216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium864Open in IMG/M
3300031912|Ga0306921_10221676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2216Open in IMG/M
3300031912|Ga0306921_10776765All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300031912|Ga0306921_10814613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1065Open in IMG/M
3300031912|Ga0306921_11271849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300031941|Ga0310912_10769513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium744Open in IMG/M
3300031942|Ga0310916_10196140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1687Open in IMG/M
3300031942|Ga0310916_10367720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1222Open in IMG/M
3300031942|Ga0310916_10866415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium758Open in IMG/M
3300031942|Ga0310916_10874783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300031945|Ga0310913_10046030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2833Open in IMG/M
3300031945|Ga0310913_10783881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300031945|Ga0310913_11183233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300031946|Ga0310910_10324741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1213Open in IMG/M
3300031947|Ga0310909_10067273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2805Open in IMG/M
3300031947|Ga0310909_10526666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium990Open in IMG/M
3300031947|Ga0310909_11234357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium603Open in IMG/M
3300031954|Ga0306926_10060436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4556Open in IMG/M
3300031954|Ga0306926_11377646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium819Open in IMG/M
3300031954|Ga0306926_12163914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300031954|Ga0306926_12555890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300031959|Ga0318530_10280936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium687Open in IMG/M
3300031981|Ga0318531_10155123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1026Open in IMG/M
3300031981|Ga0318531_10381750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300032001|Ga0306922_10753234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1021Open in IMG/M
3300032001|Ga0306922_10807872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium980Open in IMG/M
3300032010|Ga0318569_10528597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300032039|Ga0318559_10061666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1596Open in IMG/M
3300032044|Ga0318558_10133871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1184Open in IMG/M
3300032044|Ga0318558_10600498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300032044|Ga0318558_10692674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300032051|Ga0318532_10009399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2959Open in IMG/M
3300032055|Ga0318575_10491405All Organisms → cellular organisms → Bacteria → Proteobacteria623Open in IMG/M
3300032065|Ga0318513_10391355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300032066|Ga0318514_10550131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300032068|Ga0318553_10282187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium868Open in IMG/M
3300032076|Ga0306924_10634981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1205Open in IMG/M
3300032076|Ga0306924_10919173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium966Open in IMG/M
3300032090|Ga0318518_10538388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300032091|Ga0318577_10188963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium984Open in IMG/M
3300032091|Ga0318577_10577291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300032094|Ga0318540_10140500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1154Open in IMG/M
3300032094|Ga0318540_10586177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300032180|Ga0307471_102832931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300032205|Ga0307472_101061856Not Available763Open in IMG/M
3300032261|Ga0306920_101028392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1198Open in IMG/M
3300032261|Ga0306920_101886622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium840Open in IMG/M
3300032261|Ga0306920_102311409All Organisms → cellular organisms → Bacteria → Proteobacteria744Open in IMG/M
3300033289|Ga0310914_10478273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1127Open in IMG/M
3300033290|Ga0318519_10274946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium980Open in IMG/M
3300033290|Ga0318519_10467073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil38.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil9.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.47%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.47%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F12B_1038511923300000443SoilAAPSTHESHTHELRREGRHMVLRRVRIDCAFAHH*
AF_2010_repII_A01DRAFT_107137513300000580Forest SoilAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR*
AP72_2010_repI_A10DRAFT_105668213300000651Forest SoilRGRLKVARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGWHC*
AP72_2010_repI_A001DRAFT_101823213300000893Forest SoilRGRLKVARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRIRIDCGGCHR*
AP72_2010_repI_A001DRAFT_107872423300000893Forest SoilRAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGWHC*
JGI12630J15595_1005894313300001545Forest SoilKTAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFVHR*
JGI25615J43890_102644913300002910Grasslands SoilKAAKSAAEVVRAAAPSTHXTYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0062595_10095842423300004479SoilRRGRLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0066395_1048581913300004633Tropical Forest SoilKPAAEVVRSAAPLTHETHTHELRREGRQMVLRRVRIDCGGGYR*
Ga0066395_1058885913300004633Tropical Forest SoilKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0066395_1068960713300004633Tropical Forest SoilKPAAEVVRSAAPLTHETHTHELRREGRQMVLRRVRIDCGGCHC*
Ga0066823_1004036113300005163SoilAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0066869_1009771623300005165SoilGRLKIPRAGKGTAETLRAAAPQTHETHTHELRREGKHMVLRRVRIDCGFAHH*
Ga0066388_10027795953300005332Tropical Forest SoilSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0066388_10057722323300005332Tropical Forest SoilAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGGYR*
Ga0066388_10150843713300005332Tropical Forest SoilLKVAKAGKPAAEVVRPSAPLTHETHTHELRREGRQMVLRRVRIDCRGWHR*
Ga0066388_10295678413300005332Tropical Forest SoilKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDQR*
Ga0066388_10367176233300005332Tropical Forest SoilPGKPGAEIMRSSAASTHETHTHELRREGGQMVLRRVRIDCGHACC*
Ga0066388_10495934323300005332Tropical Forest SoilAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0066388_10496172523300005332Tropical Forest SoilRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0066388_10624270523300005332Tropical Forest SoilAKPAAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0070668_10212996323300005347Switchgrass RhizospherePRAGKGTAETLRAAAPQTHETHTHELRREGKHMVLRRVRIDCGFAHH*
Ga0008090_1006484913300005363Tropical Rainforest SoilEDLLRRGRLKVAKATKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDQR*
Ga0008090_1006908823300005363Tropical Rainforest SoilKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDHR*
Ga0066702_1016165343300005575SoilFEDLLRRGRLKVAKSDKPGAETVRSTAPLTHETHSHELRREGGQLVLRRVRIDCGFAHH*
Ga0066905_10100831813300005713Tropical Forest SoilVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0066903_10131112833300005764Tropical Forest SoilFEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0066903_10327473313300005764Tropical Forest SoilKATKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0066903_10645540323300005764Tropical Forest SoilAEVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDQR*
Ga0066903_10815470613300005764Tropical Forest SoilVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0066903_10860936723300005764Tropical Forest SoilLLRRGRLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0066656_1039887513300006034SoilDLLRRGRLKVAKSDKPGAETVRSTAPLTHETHSHELRREGGQLVLRRVRIDCGFAHH*
Ga0070712_10205349323300006175Corn, Switchgrass And Miscanthus RhizosphereKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0066660_1124276923300006800SoilKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFTHR*
Ga0075433_1128976123300006852Populus RhizosphereEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0075425_10227014213300006854Populus RhizosphereVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0099829_1108894623300009038Vadose Zone SoilVAKPGKPGAEIVRSSAASTHETHTHELRREGGQMVLRRVRIDCGHASC*
Ga0075418_1317089413300009100Populus RhizosphereGAAETVRAAAPQTHETHTHELRREGKHMVLRRIRIDCGFAHH*
Ga0066709_10313691423300009137Grasslands SoilMRSSAASTHETHTHELRREGGQMVLRRVRIDCGFTHH*
Ga0099792_1041631413300009143Vadose Zone SoilLRRGRLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0114129_1103537733300009147Populus RhizosphereAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0114129_1193413523300009147Populus RhizosphereRSSAPLTHETYTHELRREGRQMVLRRVRIDCGSWHR*
Ga0075423_1121972613300009162Populus RhizosphereDRNCCEFEDLLRRGRLTVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0126374_1088266313300009792Tropical Forest SoilVVRPSAPLTHETHTHELRREGRQMVLRRVRIDCRGWHR*
Ga0126380_1058447213300010043Tropical Forest SoilAAKPAAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0126380_1063853833300010043Tropical Forest SoilVRSTAPLTHETHTHELRREGRQMVLRRVRIDCGGWHG*
Ga0126380_1135352823300010043Tropical Forest SoilVRAAAPSTHETHTHELHREGRHMVLRRVRIDCAFAHH*
Ga0126384_1114890513300010046Tropical Forest SoilIPRAGKGAAETVRAAAPQTHETHTHELRREGKHMVLRRGRIDCGLAYH*
Ga0126384_1125286013300010046Tropical Forest SoilSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR*
Ga0126384_1162508313300010046Tropical Forest SoilAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0134086_1013450233300010323Grasslands SoilEIMRSSAASTHETHTHELRREGGQMVLRRVRIDCGHACC*
Ga0126376_1027374713300010359Tropical Forest SoilRRGRVKITRACKPAAEVVRSAAPLTHETHTHELRREGRQMVLRRVRIDCRGWHR*
Ga0126376_1218783713300010359Tropical Forest SoilAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0126372_1015867313300010360Tropical Forest SoilKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0126372_1080914523300010360Tropical Forest SoilGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0126372_1209572213300010360Tropical Forest SoilRLKIPRAGKPAAEVVRSAAPPTHETHTHELRREGRQMVLRRVRIDCGDGYP*
Ga0126378_1073138813300010361Tropical Forest SoilKSFFEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0126378_1126879433300010361Tropical Forest SoilRSAAPLTHETHTHELRREGRQMVLRRVRIDCGGCHC*
Ga0126377_1089204533300010362Tropical Forest SoilAAITRPTAAETHETYTHELRREGKAIVLRRVRIDCAF*
Ga0126379_1069597313300010366Tropical Forest SoilAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFNHR*
Ga0126379_1145786113300010366Tropical Forest SoilLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0126381_10090677413300010376Tropical Forest SoilFFEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR
Ga0126381_10220812713300010376Tropical Forest SoilVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0126381_10321451123300010376Tropical Forest SoilTVRAAAPQTHETHTHELRREGKHMVLRRVRIDCGLAHH*
Ga0134126_1250437613300010396Terrestrial SoilSFFEDLLRRGRLKVARAGKPAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR*
Ga0126383_1191611613300010398Tropical Forest SoilAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGLDHR*
Ga0126383_1314638023300010398Tropical Forest SoilAAAPQTHETHTHELRREGKHMVLRRVRIDCGLAHH*
Ga0124844_110985033300010868Tropical Forest SoilRRGRLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR*
Ga0137393_1102425533300011271Vadose Zone SoilASAASTHETHTHELRREGGQMVLRRVRIDCGFAHH*
Ga0137364_1023253133300012198Vadose Zone SoilGKPAAEVVRSSAPLTHETYSHELRREGRQMVLRRVRIDCGFAHR*
Ga0137365_1081092413300012201Vadose Zone SoilRLKVAKAGKSAAEVVRAAAPSTHESHTHELRREGRQMVLRRVRIDCGHDHR*
Ga0137377_1127024523300012211Vadose Zone SoilKPGAEIMRSSAASTHETHTHELRREGGQMVLRRVRIDCGHACC*
Ga0137370_1029711313300012285Vadose Zone SoilPRAGKGTAETLRAAAPQTHETHTHELRREGKHMVLRRVRIDCGFGHH*
Ga0137372_1083532423300012350Vadose Zone SoilAAKSFFGELLRRGRLKVAKAAKSAAEVVRAAAPSTHESQTHELRREGRHMVLRRVRIDCAFAHH*
Ga0137360_1039388513300012361Vadose Zone SoilRASAPLTHETHTHELRREGRQMVLRRVRIDCGGWHR*
Ga0162652_10003982413300012941SoilLRAAAPQTHETHTHELRREGKHMVLRRIRIDCGFAHH*
Ga0164298_1099313113300012955SoilKGTAETLRAAAPQTHETHTHELRREGKHMVLRRVRIACGFAHH*
Ga0164305_1093486313300012989SoilAETLRAAAPQTHETHTHELRREGKHMVLRRVRIGCGFAPH*
Ga0134072_1011598133300015357Grasslands SoilRRGRLKVAKPGKPGAEIMRSSAASTHETHTHELRREGGQMVLRRVRIDCGHACC*
Ga0182036_1124365223300016270SoilAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0182041_1150718413300016294SoilVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0182033_1067413923300016319SoilKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0182032_1088316933300016357SoilRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRLMVLRRVRIDCGFDHR
Ga0182034_1044585733300016371SoilAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0182034_1055077813300016371SoilRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRLMVLRRVRIDCGFDHR
Ga0182034_1075944613300016371SoilLARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0182040_1101787123300016387SoilEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHC
Ga0182040_1116023823300016387SoilEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRLMVLRRVRIDCGFDHR
Ga0182037_1071951113300016404SoilTKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0182037_1171349223300016404SoilAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0182039_1055504913300016422SoilKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR
Ga0182038_1028024823300016445SoilVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGGYP
Ga0182038_1093127913300016445SoilKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCAGWHG
Ga0182038_1096820713300016445SoilVVRSAAPLTHETHTHELRREGRQMVLRRVRIDCGGCHC
Ga0182038_1131706013300016445SoilVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDHR
Ga0182038_1199793013300016445SoilRSAAPLTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0126371_1084889833300021560Tropical Forest SoilLRRGRLKVAKPGKPGAEIIRFSASSTHETHTHELRREGGQMVLRRVRIDCGHACC
Ga0126371_1110179123300021560Tropical Forest SoilSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR
Ga0207699_1030217113300025906Corn, Switchgrass And Miscanthus RhizosphereLKIPRAGKGTAETLRAAAPHTHETHTHELRREGKHMVLRRVRIDCGFAHH
Ga0209266_127504023300026327SoilGRLKVARAGKPAAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0257165_103104213300026507SoilEVVRASAPLTHETHTHELRREGRQMVLRRVRIDCGGWHR
Ga0209799_100745743300027654Tropical Forest SoilIARAGKPAAEVVRSAAPLTHETHTHELRREGRQMVLRRVRIDCGGCHC
Ga0209465_1009219113300027874Tropical Forest SoilRRGRLKVAKPGKPGAEIIRFSASSTHDTHTHELRREGGQMVLRRVRIDCGHACC
Ga0209465_1010816313300027874Tropical Forest SoilAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318516_1082815223300031543SoilAKSFFEDLLRRGRLKVARAAKPAAAIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0318541_1008619113300031545SoilLKVAKAAKSAAEVVRAAAPSTHEGYTHELRREGRQMVLRRVRIDCGFAHR
Ga0318538_1006654133300031546SoilAIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0318538_1054276023300031546SoilLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHC
Ga0318528_1001058413300031561SoilGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGGYP
Ga0318528_1026527533300031561SoilSFFEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDH
Ga0318573_1005308423300031564SoilRGRLKIPKAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGGYP
Ga0318573_1077693023300031564SoilSSAPLTHETHTHELRREGRQMVLRRVRIDCAGWHG
Ga0318515_1000780313300031572SoilVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0310915_1083061023300031573SoilAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318555_1059800923300031640SoilAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0318542_1000310413300031668SoilKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0318561_1004854213300031679SoilKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDHR
Ga0318561_1010583513300031679SoilAAEVVRSAAPLTHETHTHELRREGRQMVLRRVRIDCGGCHC
Ga0318561_1048374713300031679SoilHHLPSSAPPTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0318574_1057827723300031680SoilDLLRRGRLKVAKATKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318560_1004358013300031682SoilVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR
Ga0318496_1052076513300031713SoilHLPSSAPLTHETHTHELRREGRQMVLRRVRIDCAGWHG
Ga0318500_1002150553300031724SoilLKVARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0318500_1035610713300031724SoilARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0318501_1007291533300031736SoilVARAAKPAAAIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0318501_1041816523300031736SoilRLKVARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0306918_1006705813300031744SoilFEDLLRRGRLKVAKAAKSAAEVVRAGAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0306918_1020099723300031744SoilKSFFEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318502_1059828523300031747SoilIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0318494_1019136623300031751SoilVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGGYP
Ga0318537_1020762213300031763SoilGRLKLARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0318535_1031694313300031764SoilRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0318535_1048116413300031764SoilEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDHR
Ga0318509_1000389263300031768SoilRLKVARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRIRIDCGGCHR
Ga0318521_1059159923300031770SoilIARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0318543_1047199213300031777SoilKAAKSAAEVVRAGAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318508_105484413300031780SoilAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGGYP
Ga0318508_118410123300031780SoilAAKSFFEDLLRRGRLKVARAAKPAAEIVRSSAPLTHETYTHELRREGRQMVLHRVRIDCRGYH
Ga0318529_1047369923300031792SoilLKVAKAAKSAAEVVRAGAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318503_1014628323300031794SoilRGRLKIARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0318576_1012494633300031796SoilVVRAVAPSTHESYTHELRREGRQMVLRRIRIDCGFDHR
Ga0318497_1016940433300031805SoilAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0318497_1080425913300031805SoilLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318499_1030981113300031832SoilTGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0318517_1023974413300031835SoilAKAGKPAAEVLRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGWHR
Ga0318517_1036129413300031835SoilIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCRGYH
Ga0318512_1011320533300031846SoilLRRGRLKLARAGKPAAEVVRSSAPLTRETHTHELRREGRQMVLRRVRIDCGGWHG
Ga0318527_1013946423300031859SoilLAPSAPLTHETYTHELRREGRQMVLRRVRIDCRGYH
Ga0318495_1020835833300031860SoilAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRIRIDCGGCHR
Ga0306919_1004818853300031879SoilRAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0306919_1060658913300031879SoilFEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRLMVLRRVRIDCGFDHR
Ga0306919_1085173813300031879SoilFEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHC
Ga0306919_1105209923300031879SoilARAGKPAAEVVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGG
Ga0306919_1127645423300031879SoilRSAAPLTHETHTHELRREGRQMVLRRVRIDCGGCHC
Ga0306919_1148496013300031879SoilGRLTVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318544_1003103223300031880SoilHHLPSSAPLTHETHTHELRREGRQMVLRRVRIDCGGGYP
Ga0306925_1060832613300031890SoilAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR
Ga0318522_1001527643300031894SoilARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRIRIDCGGCHR
Ga0318551_1083247613300031896SoilFFEDLLRRGRLKVARAAKPAAEIVRSSAPLTHETYTHELRREGRQMVLHRVRIDCRGYH
Ga0318520_1011844913300031897SoilKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0306923_1108321633300031910SoilAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0306921_1022167643300031912SoilLLRRGRLKVAKATKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0306921_1077676543300031912SoilLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRLMVLRRVRIDCGFDHR
Ga0306921_1081461333300031912SoilEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0306921_1127184913300031912SoilKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0310912_1076951313300031941SoilAGKPAAEVVRSSAPLTRETHTHELRREGRQMVLRRVRIDCGGWHG
Ga0310916_1019614043300031942SoilRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDHR
Ga0310916_1036772013300031942SoilAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0310916_1086641513300031942SoilVVRAAAPSTHEGYTHELRREGRQMVLRRVRIDCGFAHR
Ga0310916_1087478333300031942SoilKAAKSAAEVVRAAAPSTHESYTHELRREGRLMVLRRVRIDCGFDHR
Ga0310913_1004603063300031945SoilVAKAAKSAAEVVRAGAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0310913_1078388113300031945SoilDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR
Ga0310913_1118323313300031945SoilRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0310910_1032474133300031946SoilAAKPAAAIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0310909_1006727343300031947SoilRLKVARAAKPAAAIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0310909_1052666613300031947SoilLKVAKATKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0310909_1123435713300031947SoilDQAAKSFFEDLLRRGRLKVAKAAKPTAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGGYR
Ga0306926_1006043613300031954SoilKVARAAKPAAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0306926_1137764613300031954SoilRRGRLKVARAAKPAAEIVRSSAPLTHETYTHELRREGRQMVLHRVRIDCRGYH
Ga0306926_1216391413300031954SoilARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCAGWHG
Ga0306926_1255589013300031954SoilLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318530_1028093623300031959SoilMRSSAASTHETHTHELRREGGQMVLRRVRIDCGHACC
Ga0318531_1015512333300031981SoilAAAIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCGGWHR
Ga0318531_1038175023300031981SoilRGRLKVARTGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0306922_1075323433300032001SoilSAAEVVRAAAPSTHESYTHELRREGRLMVLRRVRIDCGFDHR
Ga0306922_1080787233300032001SoilLLRRGRLKVAKATKSAAEVVRAAAPSTHESYSHELRREGRQMVLRRVRIDCGFAHR
Ga0318569_1052859723300032010SoilFEDLLRRGRLKVAKATKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318559_1006166623300032039SoilFEDLLRRGRLKVARAAKPAAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCRGYH
Ga0318558_1013387113300032044SoilLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRIRIDCGFDHR
Ga0318558_1060049823300032044SoilVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318558_1069267423300032044SoilLLRRGRLKVAKPGKPGAEIMRSSAASTHETHTHELRREGGQMVLRRVRIDCGHACC
Ga0318532_1000939913300032051SoilPSFAPLTHETHTHELRREGRQMVLRRIRIDCGGCHR
Ga0318575_1049140513300032055SoilRAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGGYP
Ga0318513_1039135523300032065SoilLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHC
Ga0318514_1055013113300032066SoilARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCRGCHC
Ga0318553_1028218713300032068SoilRRGRLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDHR
Ga0306924_1063498133300032076SoilEDLLRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0306924_1091917333300032076SoilEVVRAAAPSTHESYTHELRREGRLMVLRRVRIDCGFDHR
Ga0318518_1053838823300032090SoilGRLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR
Ga0318577_1018896323300032091SoilLKVAKAAKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFAHR
Ga0318577_1057729113300032091SoilRLKIARAGKPAAEVVRSSAPLTHETHTHELRREGRQMVLRRVRIDCGGCHR
Ga0318540_1014050023300032094SoilSSAPLTHETHTHELRREGRQMVLRRVRIDCGGGYP
Ga0318540_1058617723300032094SoilSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0307471_10283293113300032180Hardwood Forest SoilAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR
Ga0307472_10106185613300032205Hardwood Forest SoilVASARAAVERPHAPETHETNTHELRREGKAIVLRRVRIDCAF
Ga0306920_10102839233300032261SoilSFFEDLLRRGRLKVAKAGKSAAEVVRAAAPSTHETYTHELRREGRQMVLRRVRIDCGFDH
Ga0306920_10188662223300032261SoilRRGRLKVAKAAKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFAHR
Ga0306920_10231140913300032261SoilEDLLRRGRLKVARAAKPAAEIVRSSAPLTHETYTHELRREGRQMVLRRVRIDCRGYH
Ga0310914_1047827333300033289SoilVAKATKSAAEVVRAAAPSTHESYTHELRREGRQMVLRRVRIDCGFDHR
Ga0318519_1027494613300033290SoilEAGKPAAEVVRSSAPLTRETHTHELRREGRQMVLRRVRIDCGGWHG
Ga0318519_1046707313300033290SoilRGRLKIPRAGKPAAEVVRSSAPPTHETHTHELRREGRQMVLRRVRIDCGGCHR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.