| Basic Information | |
|---|---|
| Family ID | F023145 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 211 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTVLTRWEPFREFSTLQDRMNRLFRESYNDAGRDESLT |
| Number of Associated Samples | 184 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.10 % |
| % of genes near scaffold ends (potentially truncated) | 98.10 % |
| % of genes from short scaffolds (< 2000 bps) | 85.78 % |
| Associated GOLD sequencing projects | 172 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.156 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.796 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.749 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.768 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 211 Family Scaffolds |
|---|---|---|
| PF10672 | Methyltrans_SAM | 65.88 |
| PF02591 | zf-RING_7 | 2.84 |
| PF00892 | EamA | 0.47 |
| PF13185 | GAF_2 | 0.47 |
| PF13581 | HATPase_c_2 | 0.47 |
| PF09723 | Zn-ribbon_8 | 0.47 |
| PF00216 | Bac_DNA_binding | 0.47 |
| PF13426 | PAS_9 | 0.47 |
| PF00588 | SpoU_methylase | 0.47 |
| PF01435 | Peptidase_M48 | 0.47 |
| PF15780 | ASH | 0.47 |
| PF00155 | Aminotran_1_2 | 0.47 |
| PF08338 | DUF1731 | 0.47 |
| PF00004 | AAA | 0.47 |
| PF00011 | HSP20 | 0.47 |
| PF02729 | OTCace_N | 0.47 |
| PF12847 | Methyltransf_18 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 211 Family Scaffolds |
|---|---|---|---|
| COG1579 | Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain | General function prediction only [R] | 2.84 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.47 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.16 % |
| Unclassified | root | N/A | 2.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001087|JGI12677J13195_1001814 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300001471|JGI12712J15308_10108658 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300001661|JGI12053J15887_10180035 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300004092|Ga0062389_100279180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1721 | Open in IMG/M |
| 3300004152|Ga0062386_101670776 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300004480|Ga0062592_100239258 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300004633|Ga0066395_10735575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 588 | Open in IMG/M |
| 3300005434|Ga0070709_10291944 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300005534|Ga0070735_10194609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1243 | Open in IMG/M |
| 3300005534|Ga0070735_10943594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 506 | Open in IMG/M |
| 3300005541|Ga0070733_10693953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 683 | Open in IMG/M |
| 3300005541|Ga0070733_10779561 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005568|Ga0066703_10888205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300005610|Ga0070763_10098514 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300005764|Ga0066903_101374862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
| 3300005844|Ga0068862_100577394 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300005878|Ga0075297_1035515 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005983|Ga0081540_1307355 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006031|Ga0066651_10187607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1092 | Open in IMG/M |
| 3300006041|Ga0075023_100286574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300006162|Ga0075030_100406574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300006176|Ga0070765_101125486 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300006176|Ga0070765_101543824 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300006791|Ga0066653_10456755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300006893|Ga0073928_10017513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 7586 | Open in IMG/M |
| 3300009093|Ga0105240_10142093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2869 | Open in IMG/M |
| 3300009521|Ga0116222_1070839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300009545|Ga0105237_11411643 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300009548|Ga0116107_1133443 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009650|Ga0105857_1225865 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010048|Ga0126373_11318087 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300010339|Ga0074046_10320875 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300010358|Ga0126370_11019380 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300010366|Ga0126379_10959472 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300010371|Ga0134125_11328754 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300010376|Ga0126381_100380685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1960 | Open in IMG/M |
| 3300010379|Ga0136449_104352587 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010397|Ga0134124_10602376 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300010399|Ga0134127_10217068 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300011043|Ga0138528_140416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300012200|Ga0137382_11133095 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012201|Ga0137365_11246167 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012203|Ga0137399_10743229 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300012209|Ga0137379_10559865 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300012210|Ga0137378_10616026 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012285|Ga0137370_10086248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1749 | Open in IMG/M |
| 3300012923|Ga0137359_11601214 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012924|Ga0137413_10374930 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300012924|Ga0137413_11313262 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012925|Ga0137419_11850821 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012957|Ga0164303_11160700 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012960|Ga0164301_10002032 | All Organisms → cellular organisms → Bacteria | 6724 | Open in IMG/M |
| 3300012961|Ga0164302_10736844 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012971|Ga0126369_12741393 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012989|Ga0164305_11843171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300013770|Ga0120123_1071261 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300014493|Ga0182016_10669305 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300014654|Ga0181525_10385603 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300015052|Ga0137411_1314194 | Not Available | 6544 | Open in IMG/M |
| 3300015241|Ga0137418_10877333 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300015357|Ga0134072_10493046 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300015372|Ga0132256_103791011 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300016341|Ga0182035_11633202 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300017822|Ga0187802_10094785 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300017823|Ga0187818_10214647 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300017938|Ga0187854_10235020 | Not Available | 799 | Open in IMG/M |
| 3300017943|Ga0187819_10303264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300017955|Ga0187817_10335222 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300017972|Ga0187781_11221446 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300017973|Ga0187780_11407456 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300017975|Ga0187782_10906534 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300018006|Ga0187804_10489869 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300018017|Ga0187872_10139018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300018022|Ga0187864_10317918 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300018025|Ga0187885_10539843 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018042|Ga0187871_10049770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2525 | Open in IMG/M |
| 3300018044|Ga0187890_10405665 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300018057|Ga0187858_10879524 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018058|Ga0187766_10656954 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018062|Ga0187784_10363948 | Not Available | 1171 | Open in IMG/M |
| 3300018062|Ga0187784_10867929 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300018064|Ga0187773_10031502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2341 | Open in IMG/M |
| 3300018085|Ga0187772_11306392 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300018086|Ga0187769_10775941 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300018088|Ga0187771_11526997 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300018090|Ga0187770_10733244 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300018090|Ga0187770_11280746 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300019786|Ga0182025_1245098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2760 | Open in IMG/M |
| 3300019789|Ga0137408_1362200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2494 | Open in IMG/M |
| 3300020004|Ga0193755_1140953 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300020581|Ga0210399_11090498 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300020582|Ga0210395_10500492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300020582|Ga0210395_10533614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300021046|Ga0215015_10188203 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300021168|Ga0210406_10395152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300021171|Ga0210405_10179161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1680 | Open in IMG/M |
| 3300021171|Ga0210405_11439907 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300021178|Ga0210408_11467479 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021181|Ga0210388_10020852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5306 | Open in IMG/M |
| 3300021401|Ga0210393_10408804 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300021402|Ga0210385_10077853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2271 | Open in IMG/M |
| 3300021402|Ga0210385_10315424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300021403|Ga0210397_11371868 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300021403|Ga0210397_11390774 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021405|Ga0210387_11382575 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021405|Ga0210387_11560367 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300021407|Ga0210383_10184142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1783 | Open in IMG/M |
| 3300021420|Ga0210394_10391796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300021432|Ga0210384_10806682 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300021432|Ga0210384_11623132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300021474|Ga0210390_10651355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300021474|Ga0210390_10890079 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300021477|Ga0210398_10278665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300021478|Ga0210402_11234287 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300021559|Ga0210409_10641738 | Not Available | 931 | Open in IMG/M |
| 3300021560|Ga0126371_10004730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12024 | Open in IMG/M |
| 3300022728|Ga0224566_102928 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300024225|Ga0224572_1073201 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300024331|Ga0247668_1029118 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300025320|Ga0209171_10281707 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300025412|Ga0208194_1067106 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300025444|Ga0208189_1083701 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300025454|Ga0208039_1086260 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300025460|Ga0208562_1006898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3015 | Open in IMG/M |
| 3300025581|Ga0208355_1063542 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300025899|Ga0207642_10692897 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300025900|Ga0207710_10050491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1866 | Open in IMG/M |
| 3300025905|Ga0207685_10056111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1540 | Open in IMG/M |
| 3300025906|Ga0207699_10392762 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300025906|Ga0207699_11136352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300025912|Ga0207707_10006216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10432 | Open in IMG/M |
| 3300025913|Ga0207695_10014179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9456 | Open in IMG/M |
| 3300025928|Ga0207700_11103502 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300025928|Ga0207700_11467373 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300025932|Ga0207690_10504629 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300025942|Ga0207689_11175057 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300026142|Ga0207698_10569138 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300026310|Ga0209239_1128121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300026320|Ga0209131_1209448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300026325|Ga0209152_10386067 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300026327|Ga0209266_1065699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1710 | Open in IMG/M |
| 3300026331|Ga0209267_1034324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2399 | Open in IMG/M |
| 3300026508|Ga0257161_1093208 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300026530|Ga0209807_1186108 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300026557|Ga0179587_10658245 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300027158|Ga0208725_1037784 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300027559|Ga0209222_1026030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300027641|Ga0208827_1058092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1266 | Open in IMG/M |
| 3300027645|Ga0209117_1177877 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300027674|Ga0209118_1178116 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027698|Ga0209446_1148733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300027768|Ga0209772_10296424 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027825|Ga0209039_10267657 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300027826|Ga0209060_10463801 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027842|Ga0209580_10013013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3612 | Open in IMG/M |
| 3300027853|Ga0209274_10244328 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300027855|Ga0209693_10386377 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300027857|Ga0209166_10126221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
| 3300027867|Ga0209167_10027672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2714 | Open in IMG/M |
| 3300027867|Ga0209167_10425799 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300027867|Ga0209167_10475674 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027884|Ga0209275_10042778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2143 | Open in IMG/M |
| 3300027884|Ga0209275_10931004 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027898|Ga0209067_10919845 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027905|Ga0209415_10796988 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300027911|Ga0209698_10066790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3088 | Open in IMG/M |
| 3300027911|Ga0209698_10080527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2763 | Open in IMG/M |
| 3300027986|Ga0209168_10038890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2590 | Open in IMG/M |
| 3300028023|Ga0265357_1024619 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300028047|Ga0209526_10713030 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300028560|Ga0302144_10239464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300028747|Ga0302219_10088905 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300028748|Ga0302156_10161522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300028860|Ga0302199_1244668 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300028863|Ga0302218_10214217 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300028866|Ga0302278_10160579 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300028906|Ga0308309_10002738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10504 | Open in IMG/M |
| 3300028906|Ga0308309_10846494 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300028906|Ga0308309_11450953 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300028906|Ga0308309_11728362 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300030051|Ga0302195_10446564 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300030057|Ga0302176_10453483 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031234|Ga0302325_12594339 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031524|Ga0302320_10050230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7435 | Open in IMG/M |
| 3300031525|Ga0302326_10246458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2919 | Open in IMG/M |
| 3300031525|Ga0302326_11128516 | Not Available | 1086 | Open in IMG/M |
| 3300031668|Ga0318542_10693332 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031708|Ga0310686_109715334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031715|Ga0307476_10262984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1261 | Open in IMG/M |
| 3300031716|Ga0310813_11014578 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300031720|Ga0307469_11803706 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031753|Ga0307477_10946884 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031754|Ga0307475_10054460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3015 | Open in IMG/M |
| 3300031754|Ga0307475_10876230 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031912|Ga0306921_12514855 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031962|Ga0307479_10077102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3226 | Open in IMG/M |
| 3300032005|Ga0307411_10240394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300032160|Ga0311301_11685579 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300032174|Ga0307470_10257259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300032180|Ga0307471_100149522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2243 | Open in IMG/M |
| 3300032180|Ga0307471_103542474 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032605|Ga0316232_1300019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300032782|Ga0335082_11162773 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032783|Ga0335079_10018822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7900 | Open in IMG/M |
| 3300032783|Ga0335079_11466538 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300032805|Ga0335078_11448935 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300032805|Ga0335078_11539954 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032897|Ga0335071_10601540 | Not Available | 1051 | Open in IMG/M |
| 3300033134|Ga0335073_10192453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2541 | Open in IMG/M |
| 3300033402|Ga0326728_10404288 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300033803|Ga0314862_0058619 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.84% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.84% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.37% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.42% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.47% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.47% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.47% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.47% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.47% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.47% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.47% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.47% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.47% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.47% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.47% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011043 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12677J13195_10018141 | 3300001087 | Forest Soil | MTVLTRWEPFREFSTLQDRMNRLFRESYHEGGRDESLTASSF |
| JGI12712J15308_101086581 | 3300001471 | Forest Soil | MTVLTRWEPFREFSTLQDRMNRLFRESYNEGGRDES |
| JGI12053J15887_101800351 | 3300001661 | Forest Soil | MTVLTRWEPFREFSTLQDRMNRLFRETQGNTQDESLASS |
| Ga0062389_1002791801 | 3300004092 | Bog Forest Soil | MTVLTRWEPVREFSSLQDRINRVFRESYRGDGRDESLTSS |
| Ga0062386_1016707761 | 3300004152 | Bog Forest Soil | MTMITRWDPLREFATIQDRMNRLFRDSYGTEGREEALSNT |
| Ga0062592_1002392581 | 3300004480 | Soil | MTVLTRWEPFREFVTLQDRMNRLFRESYPEGREEALTTST |
| Ga0066395_107355752 | 3300004633 | Tropical Forest Soil | MTVLTRWDPFREFTTLQDRMGRLFRDSYGDREEALTTSTFA |
| Ga0070709_102919441 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVLTRWEPFRELSLLQDRMNRLFQDSMSSNHDEDLTTGAF |
| Ga0070735_101946092 | 3300005534 | Surface Soil | MTVLTRWEPFREFATLQDRMNRLFRESYNEAGRDESLTT |
| Ga0070735_109435941 | 3300005534 | Surface Soil | MTVLTRWDPFREFSTVQDRLNRLFRDSYGEGREEALTTST |
| Ga0070733_106939531 | 3300005541 | Surface Soil | MTVLTRWQPFREFSTLQDRINRVFRESYSGEGRDESLSTSS |
| Ga0070733_107795611 | 3300005541 | Surface Soil | MTVLTRWEPFREFSTLQDRINRVFRDSYSQAGQDESLASS |
| Ga0066703_108882051 | 3300005568 | Soil | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDHEEALTASTFA |
| Ga0070763_100985141 | 3300005610 | Soil | MKEITTMTVLTRFEPFREFSTLQDRINRVFRESYGQGSAGQDESL |
| Ga0066903_1013748622 | 3300005764 | Tropical Forest Soil | MTVLTRWEPFREFATLQDRMNRLFRESYSEGRDESLTT |
| Ga0068862_1005773941 | 3300005844 | Switchgrass Rhizosphere | MTVLTRFEPYREFATLQDRLNRLFQSSFGESQDSLTT |
| Ga0075297_10355151 | 3300005878 | Rice Paddy Soil | MTVLTRFEPYREFTTLQDRLNRLFQSSIGDSQEALTNSSFAPAVDV |
| Ga0081540_13073551 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MTVLTRFEPYREFATLQDRLNRLFQSSFGDNQDALT |
| Ga0066651_101876071 | 3300006031 | Soil | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDGREEALTT |
| Ga0075023_1002865741 | 3300006041 | Watersheds | MTVLTRWDPYREFSSVQDRLNRLFNASFNEGRDES |
| Ga0075030_1004065742 | 3300006162 | Watersheds | MTVITRWDPFREFSTLQDRMNRLFRESHGPEGREEAL |
| Ga0070765_1011254862 | 3300006176 | Soil | MTILTRWEPVREFTTLQDRMNRLFRDSFNADTQDQSLATS |
| Ga0070765_1015438242 | 3300006176 | Soil | MTVLTRWEPFRELSILQDRINRAFRESYREGGRDES |
| Ga0066653_104567551 | 3300006791 | Soil | MTVLTRWDAFREFSTLQDRMNRLFQQSYGDREEALTTSTF |
| Ga0073928_100175138 | 3300006893 | Iron-Sulfur Acid Spring | MTVLTRWEPFREFSTLQDRINRVFRDSYSAAAQDD |
| Ga0105240_101420932 | 3300009093 | Corn Rhizosphere | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDGREER* |
| Ga0116222_10708392 | 3300009521 | Peatlands Soil | MFTRSLTRWEPFRELSNMHDRMNRLLRESYSPEGPE |
| Ga0105237_114116431 | 3300009545 | Corn Rhizosphere | MTVLTRWEPFREFATLQDRMNRLFRESYNDAGQDESLTT |
| Ga0116107_11334432 | 3300009548 | Peatland | MTMFTRYDPFREFVTLQDRMNRLFRGPRGPEGQDDA |
| Ga0105857_12258651 | 3300009650 | Permafrost Soil | MTVLNRFEPFREVNTLQGRINRIFRESYGSEGRDEALTSSF |
| Ga0126373_113180872 | 3300010048 | Tropical Forest Soil | LKEDLAMTVLTRWEPFREFATLQDRINRVFRESYAAGQDDSLATSSF |
| Ga0074046_103208751 | 3300010339 | Bog Forest Soil | MTVLTRWEPFREFTTLQDRMNRLFRDSFGPEAQDQSLATTGF |
| Ga0126370_110193802 | 3300010358 | Tropical Forest Soil | LKEDFVMTVLTRWEPFREFATLQDRMSRLFRESYNDAGRDESLT |
| Ga0126379_109594722 | 3300010366 | Tropical Forest Soil | MTVITRWDPFREFTTLQDRLNRLFRQSYGPEGREE |
| Ga0134125_113287542 | 3300010371 | Terrestrial Soil | MTVLTRWDPYREFSSVQDRLNRLFNASFNEGRDESL |
| Ga0126381_1003806853 | 3300010376 | Tropical Forest Soil | MTVLTRWDPFREFTTLQNRMNRLFQDPFVQGRDETLSTS |
| Ga0136449_1043525872 | 3300010379 | Peatlands Soil | MTMFTRYDPFREFVTLQDRMNRLFRDPRGPEGQDESLTTTAFA |
| Ga0134124_106023761 | 3300010397 | Terrestrial Soil | MTVITRWDPFREFSTLQDRMNRLFQQSYNEGSNEA |
| Ga0134127_102170682 | 3300010399 | Terrestrial Soil | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDREEALTTS |
| Ga0138528_1404162 | 3300011043 | Peatlands Soil | MTVLTRWEPFREFATLQDRINRAFRESYAGADRDESLTTS |
| Ga0137382_111330951 | 3300012200 | Vadose Zone Soil | MTVLTRWEPFREFSTLQDRMNRLFRESYNDAGKDESLTT |
| Ga0137365_112461672 | 3300012201 | Vadose Zone Soil | MTVLTRWDPFREFSTLQDRMNRLFQQSYGDREEALTT |
| Ga0137399_107432291 | 3300012203 | Vadose Zone Soil | MTVLTRWDPFREFTTLQERMNRLVRDQYRAEGGSEES |
| Ga0137379_105598651 | 3300012209 | Vadose Zone Soil | MTVLTRWDPFREFSTLQDRMNRLFQQSYGDREEALTTST |
| Ga0137378_106160262 | 3300012210 | Vadose Zone Soil | MAVLTRWDPFREFSTLQDRMNRLFQQSYGDREEALT |
| Ga0137370_100862481 | 3300012285 | Vadose Zone Soil | MAVLTRWDPFREFSTLQDRMNRLFQQSYGDREEALTTSTFA |
| Ga0137359_116012142 | 3300012923 | Vadose Zone Soil | MTLITRYDPFREFVTLQDRMSRLFRDPRGPEGQDESL |
| Ga0137413_103749302 | 3300012924 | Vadose Zone Soil | MTVITRWDPFREFTTLQERMNRLVRDQYRGEGGAEESLTT |
| Ga0137413_113132621 | 3300012924 | Vadose Zone Soil | MTVLTRWDPFREFSTLQDLMNRLFRDNYGDGRDEALTT |
| Ga0137419_118508212 | 3300012925 | Vadose Zone Soil | MTVLTRWEPFREFSTLQDRMNRLFRETQGNSQDESLTS |
| Ga0164303_111607002 | 3300012957 | Soil | MTVLTRWEPIREFSTLQDRMNRLFRESFNDAGRDESLSTS |
| Ga0164301_1000203212 | 3300012960 | Soil | MAITRWDPFRELSTIKDRMNRLFQDSYGGQDKELSTR |
| Ga0164302_107368442 | 3300012961 | Soil | MIFMTVLTRWDPYREFSSVQDRLHRLFSASFSDASFNEGRDES |
| Ga0126369_127413932 | 3300012971 | Tropical Forest Soil | MTVLTRWEPFREFATLQDRMNRLFRESYNEGRDESLTT |
| Ga0164305_118431712 | 3300012989 | Soil | MTVLTRWDPFREFTTLQERMNRLVRDQYRAEGGPEESLTT |
| Ga0120123_10712612 | 3300013770 | Permafrost | MTVLTRFEPFRELTTLQDRMNRLFRDTYGDGRDEA |
| Ga0182016_106693051 | 3300014493 | Bog | MTLITRYDPFREFVTLQNRVNRLFGSQHSNQRGPE |
| Ga0181525_103856032 | 3300014654 | Bog | MTVITRWDPLREFATIQDRMNRLFRDSYANEGREEALS |
| Ga0137411_131419411 | 3300015052 | Vadose Zone Soil | MTVLTRFEPYREFTTLQDRLNRLFQSSFCDNQDALTTIELSPAVTSTKTSTP* |
| Ga0137418_108773332 | 3300015241 | Vadose Zone Soil | MTVLTRFEPYREFTTLQDRLNRLFQSSFADNQDALT |
| Ga0134072_104930462 | 3300015357 | Grasslands Soil | MTVLTRWDPFREFSTLQDRMNRLFQQSYGDREEAL |
| Ga0132256_1037910111 | 3300015372 | Arabidopsis Rhizosphere | MTVLTRWEPFREFATLQDRMNRLFRNSYNEAGRDE |
| Ga0182035_116332022 | 3300016341 | Soil | MTVITRWDPFREFSTLQDRMNSLFRQTYGPEGREESLTT |
| Ga0187802_100947852 | 3300017822 | Freshwater Sediment | MTMLTRWDPFREFVTLQDRMNRLFRDSFGPEGKDE |
| Ga0187818_102146472 | 3300017823 | Freshwater Sediment | MTMITRWDPFREFVTIQDRMNRLFRDSFGPEGTNEAEALRAT |
| Ga0187854_102350202 | 3300017938 | Peatland | MTRLTRWEPLREFSATQDRINRMSMNRLFRETYSP |
| Ga0187819_103032641 | 3300017943 | Freshwater Sediment | MTVLTRWEPFREFATLQDRMNRLFRESFSDDRDEALTTST |
| Ga0187817_103352221 | 3300017955 | Freshwater Sediment | MTVLTRWDPFRELNTLQDRMNRLFRDSVSPEAQDQTL |
| Ga0187781_112214462 | 3300017972 | Tropical Peatland | MTVLTRWEPFREFATLQDRINRVFRESYAGGQDESLTTS |
| Ga0187780_114074562 | 3300017973 | Tropical Peatland | MTVLTRWEPFREFATLQDRINRVFRESYSQGRDESLTTS |
| Ga0187782_109065342 | 3300017975 | Tropical Peatland | MTVLTRWEPFREFATLQDRINRVFRESYTGGQDESL |
| Ga0187804_104898691 | 3300018006 | Freshwater Sediment | MTVLTRWEPFREFSTLQDRMNRLFRDSFGDTREESLTTTNFA |
| Ga0187872_101390181 | 3300018017 | Peatland | MTVLTRWEPFREFTTLQDRMNRLFRESFGPEGQDQSLATSSF |
| Ga0187864_103179181 | 3300018022 | Peatland | MTMFTRYDPLREFVTLQDRMNRLFRDPRGPEGQDE |
| Ga0187885_105398432 | 3300018025 | Peatland | MTMFTRYDPFREFVTLQDRMNRLFRDPRGPEGQDESLTTT |
| Ga0187871_100497701 | 3300018042 | Peatland | MTVITRWEPFREFTTLQDRLNRLFQQSVSDGREEAL |
| Ga0187890_104056652 | 3300018044 | Peatland | MTVLTRFEPFRELSTLQDRLNRLFRESQREGQDESLTT |
| Ga0187858_108795242 | 3300018057 | Peatland | MTVLTRWEPFREFSTLQDRMNRLFRESFDDTGRDESLTASSFAPA |
| Ga0187766_106569541 | 3300018058 | Tropical Peatland | MTVLTRWEPFREFTTLQDRMNRLFRDSFGDSQEALTTT |
| Ga0187784_103639482 | 3300018062 | Tropical Peatland | MTLITRWDPFREFVTLQDRMNRLFRDSQGGQEEALT |
| Ga0187784_108679291 | 3300018062 | Tropical Peatland | MTMLTRWDPFREFVTIQDRMNRLFRDSFGPEGREEALT |
| Ga0187773_100315023 | 3300018064 | Tropical Peatland | MTVLTRWDPFREFSTLQERMNRLFRESFAEGGQEALM |
| Ga0187772_113063921 | 3300018085 | Tropical Peatland | MTVITRWDPFREFSTLQDRMDRLFRDSFGTEGREEALTTT |
| Ga0187769_107759411 | 3300018086 | Tropical Peatland | MTVLTRWEPFREFATLQDRMNRLFRESFNEGRDESLTTST |
| Ga0187771_115269972 | 3300018088 | Tropical Peatland | MTMITRWDPFREFVTLQDRMNRLFHNSFRDSFGSEGTKE |
| Ga0187770_107332441 | 3300018090 | Tropical Peatland | MTMITRWDPFREFVTLQDRMNRLFHNSFRDSFGPEGTKEDEALTTTR |
| Ga0187770_112807461 | 3300018090 | Tropical Peatland | MTMITRWDPFREFVTLQNRMNRLFHDSFGPEGTNESE |
| Ga0182025_12450985 | 3300019786 | Permafrost | MTVLTRFEPFREVATLQDRMNRLFRESFNQAGQEESLTNTKLRSSS |
| Ga0137408_13622001 | 3300019789 | Vadose Zone Soil | MTVLTRFEPYREFTTLQDRLNRLFQSSFADNQDALTT |
| Ga0193755_11409532 | 3300020004 | Soil | MTVLTRWDPFREFTTLQERMNRLVRDQYRAEGGTEES |
| Ga0210399_110904982 | 3300020581 | Soil | MTVLTRWEPFREFTTLQDRMNRLFRDSFGPEAQDQSLATSNFA |
| Ga0210395_105004921 | 3300020582 | Soil | MTVLTRWEPFREFSTLQDRMNRLFRQSHNEGGRDE |
| Ga0210395_105336142 | 3300020582 | Soil | MTVLTRWEPFREFSTLQDRINRAFRESYSDSGRDESLAASS |
| Ga0215015_101882031 | 3300021046 | Soil | MTVLTRWDPSREFTTLQDRMNRLFRETYNENQDQSLATSSSV |
| Ga0210406_103951522 | 3300021168 | Soil | MTVLTRFEPFREFSTLQDRMNRLFRETYNEGQDQS |
| Ga0210405_101791613 | 3300021171 | Soil | MTVITRWEPFREFATLQDRMNRLFRESYGPEGREES |
| Ga0210405_114399072 | 3300021171 | Soil | MTVLTRFEPFREFSTLQDRINRAFRESYREAGRDESLTTSS |
| Ga0210408_114674792 | 3300021178 | Soil | MTVLTRWEPFREFSTLQDRINRVFRDSYSGAAQDDSLSTSS |
| Ga0210388_100208521 | 3300021181 | Soil | MKEITTMTVLTRFEPFREFSTLQDRINRVFRESYGHGS |
| Ga0210393_104088041 | 3300021401 | Soil | MTVITRWDPFREFSTLQDRMNRLFRDSYGNEGREES |
| Ga0210385_100778533 | 3300021402 | Soil | VTVLARFEPFREFATLQDRINRVFRDAYSPEGRDESLTTSSFAPA |
| Ga0210385_103154242 | 3300021402 | Soil | MTVFTRWEPFRELSALQDRINRAFRESYTAGAHDESLTTSSFA |
| Ga0210397_113718681 | 3300021403 | Soil | MTVLTRWEPFREFTTLQDRMNRLFRDSFGSDAQDQ |
| Ga0210397_113907742 | 3300021403 | Soil | MTVLTRWEPFRELSTLQDRINRAFRESRTGEDDSLTTSSFA |
| Ga0210387_113825751 | 3300021405 | Soil | MTVLTRWEPFREFSTLQDRMNRLFRESYNDAGRDE |
| Ga0210387_115603671 | 3300021405 | Soil | MTILTRWEPFRELNTLQDRMNRLFRDSVAEAQDQSLATSAFAPAV |
| Ga0210383_101841422 | 3300021407 | Soil | MTVLTRWEPFREFSTLQDRINRVFRDSYSAAAQDDSLTT |
| Ga0210394_103917962 | 3300021420 | Soil | MTVLTRWDPFREFSTLQDRMNRLVRDSFGEGREESLTTTNFA |
| Ga0210384_108066821 | 3300021432 | Soil | MTVLTRWEPFREFSTLQDRMNRLFRETYNEGGRDESLTAS |
| Ga0210384_116231321 | 3300021432 | Soil | MTLLTRWEPFREFSTMQDLMSRMNRLSREPHGPEVPEDAL |
| Ga0210390_106513551 | 3300021474 | Soil | MTVLTRWEPFRELSTLQDRINRAFRESYSGAGHDE |
| Ga0210390_108900791 | 3300021474 | Soil | MTVLTRFEPFREFATLQDRINRAFRESYAGADRDESLTT |
| Ga0210398_102786652 | 3300021477 | Soil | MTVLTRWEPFREFSTLQDRMNRLFRESYHEGGRDESLTAS |
| Ga0210402_112342872 | 3300021478 | Soil | MTLITRFDPFREFVTIQDRMNRLFRDSYGPEGKDGAEVLTTTTF |
| Ga0210409_106417381 | 3300021559 | Soil | MTVLTRWEPFREFATLQDRINRAFRESYSGAGSQDESLTS |
| Ga0126371_1000473014 | 3300021560 | Tropical Forest Soil | MTVITRWDPFREFTTLQDRLNRLWRESYGPEGREES |
| Ga0224566_1029282 | 3300022728 | Plant Litter | MTVLTRFEPFREFSTLQDRMNRLFRESHNEGGRDESLTTSS |
| Ga0224572_10732012 | 3300024225 | Rhizosphere | MTVLTRFEPFREFSTLQDRMNRLFRESHNEGGRDESL |
| Ga0247668_10291182 | 3300024331 | Soil | MTVLTRWEPFREFSTLQDRMNRLFRESYNDAGRDESLT |
| Ga0209171_102817072 | 3300025320 | Iron-Sulfur Acid Spring | MTVLTRWDPFREFSTLQDRMNRLVRESFGDGQEALA |
| Ga0208194_10671062 | 3300025412 | Peatland | MTLLTRWDPFREYATIQDRMNRLFRDSYAQEGQDQS |
| Ga0208189_10837011 | 3300025444 | Peatland | MTMFTRYDPFREFVTLQDRMNRLFPRGPEGQDESLTTTAFAPP |
| Ga0208039_10862601 | 3300025454 | Peatland | MTVLTRWEPFREFSTLQDRMNRLFRESHNEGGRDEPLTSSSFAPA |
| Ga0208562_10068981 | 3300025460 | Peatland | MTVLTRWEPFREFSTLQDRMNRLFRESFDDTGRDE |
| Ga0208355_10635422 | 3300025581 | Arctic Peat Soil | MTMFTRYDPFREFVTLQDRMNRLFRDPRGPEGQDESLTSTAF |
| Ga0207642_106928972 | 3300025899 | Miscanthus Rhizosphere | MTVLTRFEPFREFSTLQDRMNRLFQQSFGEGREESLGNV |
| Ga0207710_100504913 | 3300025900 | Switchgrass Rhizosphere | MTVLTRWEPFREFVTLQDRMNRLFRESYPEGREEALTTS |
| Ga0207685_100561111 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVLTRWEPFREFSTLQDRMNRLFRESYNDAGKDESLT |
| Ga0207699_103927621 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVLTRWDPFREFSTLQDRMNRLFRDNYGDDRDEAL |
| Ga0207699_111363521 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTLTRWDPFRELTTIQDRMNRLFQDAYSPNREEG |
| Ga0207707_100062169 | 3300025912 | Corn Rhizosphere | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDHEEALT |
| Ga0207695_100141798 | 3300025913 | Corn Rhizosphere | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDGREER |
| Ga0207700_111035022 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVLTRWDPFRELASVQDRMNRLFQDSFGTSREEG |
| Ga0207700_114673731 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVLTRWEPFREFATLQDRINRVFRDSYSGAAQDDSLTTS |
| Ga0207690_105046292 | 3300025932 | Corn Rhizosphere | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDRDEALTT |
| Ga0207689_111750571 | 3300025942 | Miscanthus Rhizosphere | MTVLTRWEPFREFVTLQDRMNRLFRESYPEGREEALTT |
| Ga0207698_105691381 | 3300026142 | Corn Rhizosphere | MTVLTRWEPFREFVTLQDRMNRLFRESYPEGREEALT |
| Ga0209239_11281211 | 3300026310 | Grasslands Soil | MTVLTRWEPFREFSTLQDRMNRLFRESFSEGSRDESLVASSFAPA |
| Ga0209131_12094482 | 3300026320 | Grasslands Soil | MTVLTRFEPFREFSTLQDRMNRLFRETYNEGQDQSLAASTFAPAV |
| Ga0209152_103860671 | 3300026325 | Soil | MTVITRWDPFREFSTLQDRMNRLFRESHGPEGEESLSTST |
| Ga0209266_10656993 | 3300026327 | Soil | MTVLTRWDPFREFSTLQDRMNRLFQQSYGDREEALT |
| Ga0209267_10343241 | 3300026331 | Soil | MTMLTRWDPFREFVTLQDRMNRLFREPFAPEGREE |
| Ga0257161_10932082 | 3300026508 | Soil | MTLITRYDPFREFVTLQDRMNRLFRDPRGPEGHDES |
| Ga0209807_11861082 | 3300026530 | Soil | MTVLTRWDPFREFSTLQDRMNRLFQQSYGDREEALTTSTFA |
| Ga0179587_106582451 | 3300026557 | Vadose Zone Soil | MTLITRYDPFREFATLQDRMNRLFRDPRVSEGHDES |
| Ga0208725_10377841 | 3300027158 | Forest Soil | MTVLTRWEPFRELSTLQDRVNRAFRESYRQGGRDES |
| Ga0209222_10260301 | 3300027559 | Forest Soil | MTVLTRFEPFREFATLQDRINRVFRESVGREGDESLTTSSF |
| Ga0208827_10580921 | 3300027641 | Peatlands Soil | MTVLTRWEPFREFTTLQDRMNRLFRDSFGPEAQDQSLATSNF |
| Ga0209117_11778772 | 3300027645 | Forest Soil | MTLITRYDPFREFATLQDRMNRLFRDPRVSEGHDESLT |
| Ga0209118_11781161 | 3300027674 | Forest Soil | MTVLTRWEPFREFSTLQDRMNRLFRETQGNTQDDSLTSSNFA |
| Ga0209446_11487331 | 3300027698 | Bog Forest Soil | MTVITRWEPFREFSTLQDRLNRLFQQSVGEGREESLTT |
| Ga0209772_102964241 | 3300027768 | Bog Forest Soil | MTVITRWEPFREFSTLQDRLNRLFQQSVGEGREEF |
| Ga0209039_102676571 | 3300027825 | Bog Forest Soil | MTVLTRFEPFRDFTTLQDRINRVFRETYAPEGRDES |
| Ga0209060_104638011 | 3300027826 | Surface Soil | MTVLTRWDPVREFTTLQDRMNRLFHDSFSEDREALTTT |
| Ga0209580_100130131 | 3300027842 | Surface Soil | MTVLTRWEPFREFATLQDRMNRLFRESYNDAGRDESLTT |
| Ga0209274_102443282 | 3300027853 | Soil | MTVLTRWEPFREFTTLQDRLNRLYRDSVSADAQDQSLA |
| Ga0209693_103863771 | 3300027855 | Soil | MTVLTRWEPFREFSTLQDRMNRLFRETQGNSQDESLTSSS |
| Ga0209166_101262211 | 3300027857 | Surface Soil | MTVLTRFQPFRELPTLQDRINRVFRESYRGEGQDDSLTESS |
| Ga0209167_100276723 | 3300027867 | Surface Soil | MTVLTRWHPFNEFPTLQNRMNRLFRDSFAEGQEEALTNTS |
| Ga0209167_104257991 | 3300027867 | Surface Soil | MTVLTRWEPFRELNTLQDRMNRLFRDSVAEAQDQSLATSAFAPA |
| Ga0209167_104756741 | 3300027867 | Surface Soil | MTVLTRWEPFREFSTLQDRINRVFRDSYSQAGQDESL |
| Ga0209275_100427783 | 3300027884 | Soil | MTVLTRWEPIREFATLQDRMNRLFRDSFGGDTQDQSLATSAF |
| Ga0209275_109310041 | 3300027884 | Soil | MTIIRRWDPSREFATIQDRMNRLFRDSYGAEGQDQSLATSA |
| Ga0209067_109198451 | 3300027898 | Watersheds | MTVLTRWEPFREFGTLQDRMNRLFRESYNDAGRDE |
| Ga0209415_107969881 | 3300027905 | Peatlands Soil | MTVLTRWEPFRELSTLQDRINRVFRESRSAEDESLTTSSFSP |
| Ga0209698_100667901 | 3300027911 | Watersheds | MTLITRWDPFREFVTIQDRMNRLFRDSYAPEGREEA |
| Ga0209698_100805271 | 3300027911 | Watersheds | MTVLTRWEPFREFATLQDRMNRLFRESYNDDSRDES |
| Ga0209168_100388903 | 3300027986 | Surface Soil | MTVLTRWDPVREFTTLQDRMNRLFHDSFSEDREALTT |
| Ga0265357_10246191 | 3300028023 | Rhizosphere | MTVLTRWQPFREFSTLQDRVNRVFRESYRGEGQDESL |
| Ga0209526_107130301 | 3300028047 | Forest Soil | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDSREEALTTST |
| Ga0302144_102394642 | 3300028560 | Bog | MTVLTRFEPFREFSTLQDRMNRLFRETYSEGGRDESLTASS |
| Ga0302219_100889052 | 3300028747 | Palsa | MTVITRWDPLREFATIQDRMNRLFRDSYGNEGREEAL |
| Ga0302156_101615221 | 3300028748 | Bog | MTVLTRFEPFREFSTLQDRMNRLFRETYNNEGGQDQSLTASN |
| Ga0302199_12446681 | 3300028860 | Bog | MTLITRFDPFREFVTLQDRMNRLLRDSRADGQDEALTTSSFA |
| Ga0302218_102142171 | 3300028863 | Palsa | MTVITRWDPLREFATIQDRMNRLFRDSYGNEGREEALGNTA |
| Ga0302278_101605791 | 3300028866 | Bog | MTLITRFDPFREFVTLQERMNQLVRANRGGDGQEEALTTTGFAPP |
| Ga0308309_100027388 | 3300028906 | Soil | MTVITRWEPFREFTTLQDRMNRLFRDSFGPEAQEQS |
| Ga0308309_108464941 | 3300028906 | Soil | MTVLTRFEPFREFSTLQDRINRVFRDSYSNAGQDESLTT |
| Ga0308309_114509531 | 3300028906 | Soil | MTVLTRWEPIREFATLQDRMNRLFRDSFGGDTQDQSLAT |
| Ga0308309_117283622 | 3300028906 | Soil | MTILTRWEPVREFTTLQDRMNRLFRDSFNADTQDQSLATSAF |
| Ga0302195_104465641 | 3300030051 | Bog | MTVLTRFEPFREFSSLQDRINRVFRESYGHGPEGRDES |
| Ga0302176_104534831 | 3300030057 | Palsa | MTVISRFEPFREFATLQDRMNRLFRSSVHEDGRDESLTTSSFAPAVDV |
| Ga0302325_125943392 | 3300031234 | Palsa | MTVLTRFEPFRELSTLQDRLNRLFRESQREGQDESLTTS |
| Ga0302320_100502308 | 3300031524 | Bog | MTVLTRFEPFREFSTLQDRMNRLFRETYNNEGGQDQSLTA |
| Ga0302326_102464581 | 3300031525 | Palsa | MTVLTRFEPFRELSTLQERINRAFRESYNGTDRDDSLNT |
| Ga0302326_111285162 | 3300031525 | Palsa | MTVLTRFEPFREFSTLQRMNRLFRESFNDAGRDESLTTSSFAPAV |
| Ga0318542_106933321 | 3300031668 | Soil | MTVITRWDPFREFSTLQDRMNRLFRESYGPEGREESL |
| Ga0310686_1097153341 | 3300031708 | Soil | MTLLTRWEPFRESSTMQDRMNRLFRESYSSEEAVHAVLHG |
| Ga0307476_102629842 | 3300031715 | Hardwood Forest Soil | MTVLTRWEPFREFSTLQDRMNRLFRESYNEGGRDESLT |
| Ga0310813_110145781 | 3300031716 | Soil | MTVLTRWDPFREFSTLQDRMNRLFRDSYGDHEEALTT |
| Ga0307469_118037062 | 3300031720 | Hardwood Forest Soil | MTVLTRWYPYRELNTLQDRVNRLFHESFTGDGRDESLATSSF |
| Ga0307477_109468842 | 3300031753 | Hardwood Forest Soil | MTVLTRWEPFREFSTLQDRMNRLFRESYNEGGRDESLTA |
| Ga0307475_100544601 | 3300031754 | Hardwood Forest Soil | MTVITRWDPFREFSTLQDRMHRLFRESYVPEGRDEA |
| Ga0307475_108762301 | 3300031754 | Hardwood Forest Soil | MTVLTRWEPFREFTTLQDRMNRLFRDSFGPETQDQSLATSGF |
| Ga0306921_125148552 | 3300031912 | Soil | MTVITRWDPFREFTTLQDRLNRLFRQSYGPEGREESLTT |
| Ga0307479_100771025 | 3300031962 | Hardwood Forest Soil | MTVLTRWDPFHEFTTLQDRMNRLFRNSYGSEGQEESLTNTSF |
| Ga0307411_102403943 | 3300032005 | Rhizosphere | MTVLTRWDPFRELSSIQDRMNRLFQDQYSGREESLVSGSF |
| Ga0311301_116855792 | 3300032160 | Peatlands Soil | MTVLTRWEPFREFSTLQDRMNRLFRESFHEGGRDESLVA |
| Ga0307470_102572592 | 3300032174 | Hardwood Forest Soil | MTVLTRWEPFRELSTLQDRINRAFRESYTGADREDS |
| Ga0307471_1001495221 | 3300032180 | Hardwood Forest Soil | MTVLTRWEPFREFATLQDRMNRLFRESYNDAGRDE |
| Ga0307471_1035424741 | 3300032180 | Hardwood Forest Soil | MTVIARWDPFREFSTLQDRLNRLFRESYGPEGRDES |
| Ga0316232_13000192 | 3300032605 | Freshwater | MTMITRWDPFRELSTLQDRMNRLFQDSFGSQGNRSEESLV |
| Ga0335082_111627732 | 3300032782 | Soil | MTFVTRWDPFREYVSLQDRVNRLFREAQGGEGREESLTTST |
| Ga0335079_100188228 | 3300032783 | Soil | MTVLTRWDPFREFSTLQDRMNRLFHDSFGDGREEA |
| Ga0335079_114665381 | 3300032783 | Soil | MTVLTRWEPFREFTTLQDRMNRLFRDSFGDGQEALTTTNFAPA |
| Ga0335078_114489352 | 3300032805 | Soil | MTVLTRWDPFREFTTLQGRMNRLFHESFNEGRDES |
| Ga0335078_115399542 | 3300032805 | Soil | MTVLTRWEPFREFTTLQDRMNRLFRDSFGDREETLTTSN |
| Ga0335071_106015403 | 3300032897 | Soil | MTMITRWDPFREFVTLQNRMNRLFSDSFGSEGRDETLTTTTF |
| Ga0335073_101924531 | 3300033134 | Soil | MTVLTRWDPFREFNTLQDRMNRLFRDSFSEGREEGLTTT |
| Ga0326728_104042881 | 3300033402 | Peat Soil | MTVLTRWEPIREFASLQDRMNRLFNMNMNDNFGQV |
| Ga0314862_0058619_1_114 | 3300033803 | Peatland | MTVITRWDPFREFVSLQGRMNRLFRDSQGQDEALTTST |
| ⦗Top⦘ |