| Basic Information | |
|---|---|
| Family ID | F023135 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 211 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FFGTKLAAIKPIIIALSAAKIISIKIIWDKIMNSSIKVSL |
| Number of Associated Samples | 172 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.53 % |
| % of genes from short scaffolds (< 2000 bps) | 82.46 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.237 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (18.957 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.512 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.995 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 211 Family Scaffolds |
|---|---|---|
| PF03480 | DctP | 28.91 |
| PF03746 | LamB_YcsF | 14.69 |
| PF13181 | TPR_8 | 10.90 |
| PF13458 | Peripla_BP_6 | 5.69 |
| PF04290 | DctQ | 4.27 |
| PF06808 | DctM | 3.79 |
| PF02682 | CT_C_D | 3.32 |
| PF07719 | TPR_2 | 2.84 |
| PF00120 | Gln-synt_C | 2.37 |
| PF01321 | Creatinase_N | 1.90 |
| PF02653 | BPD_transp_2 | 1.90 |
| PF14559 | TPR_19 | 1.42 |
| PF13424 | TPR_12 | 1.42 |
| PF02626 | CT_A_B | 1.42 |
| PF02776 | TPP_enzyme_N | 0.95 |
| PF01925 | TauE | 0.47 |
| PF01019 | G_glu_transpept | 0.47 |
| PF02347 | GDC-P | 0.47 |
| PF13414 | TPR_11 | 0.47 |
| PF03741 | TerC | 0.47 |
| PF00733 | Asn_synthase | 0.47 |
| PF00515 | TPR_1 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 211 Family Scaffolds |
|---|---|---|---|
| COG1540 | 5-oxoprolinase subunit A | Amino acid transport and metabolism [E] | 14.69 |
| COG2049 | 5-oxoprolinase subunit B/Allophanate hydrolase subunit 1 | Amino acid transport and metabolism [E] | 3.32 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 1.90 |
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.47 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.47 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.47 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.47 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.24 % |
| Unclassified | root | N/A | 49.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000149|LPaug09P1610mDRAFT_c1044660 | Not Available | 518 | Open in IMG/M |
| 3300001352|JGI20157J14317_10004221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 11153 | Open in IMG/M |
| 3300001352|JGI20157J14317_10070106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1444 | Open in IMG/M |
| 3300001355|JGI20158J14315_10065590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1418 | Open in IMG/M |
| 3300001935|GOS2223_1016961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1587 | Open in IMG/M |
| 3300001946|GOS2244_1009336 | Not Available | 1182 | Open in IMG/M |
| 3300001947|GOS2218_1008076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1705 | Open in IMG/M |
| 3300002040|GOScombined01_101531484 | Not Available | 1000 | Open in IMG/M |
| 3300003476|NAP2_1150694 | Not Available | 524 | Open in IMG/M |
| 3300004097|Ga0055584_100979157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 885 | Open in IMG/M |
| 3300004280|Ga0066606_10269566 | Not Available | 605 | Open in IMG/M |
| 3300005239|Ga0073579_1000231 | Not Available | 1014 | Open in IMG/M |
| 3300005404|Ga0066856_10295495 | Not Available | 698 | Open in IMG/M |
| 3300005735|Ga0076923_110848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2036 | Open in IMG/M |
| 3300005837|Ga0078893_10384358 | Not Available | 592 | Open in IMG/M |
| 3300005837|Ga0078893_10454191 | Not Available | 655 | Open in IMG/M |
| 3300006011|Ga0066373_10245236 | Not Available | 525 | Open in IMG/M |
| 3300006024|Ga0066371_10202772 | Not Available | 616 | Open in IMG/M |
| 3300006190|Ga0075446_10215303 | Not Available | 534 | Open in IMG/M |
| 3300006191|Ga0075447_10049478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1553 | Open in IMG/M |
| 3300006413|Ga0099963_1300007 | Not Available | 549 | Open in IMG/M |
| 3300006842|Ga0068494_112608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3737 | Open in IMG/M |
| 3300006947|Ga0075444_10151751 | Not Available | 970 | Open in IMG/M |
| 3300007325|Ga0079257_1369365 | Not Available | 519 | Open in IMG/M |
| 3300007342|Ga0079227_1298127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 884 | Open in IMG/M |
| 3300007622|Ga0102863_1024827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1705 | Open in IMG/M |
| 3300008097|Ga0111541_10224894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300008995|Ga0102888_1004573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2616 | Open in IMG/M |
| 3300009050|Ga0102909_1180309 | Not Available | 506 | Open in IMG/M |
| 3300009080|Ga0102815_10064573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2001 | Open in IMG/M |
| 3300009193|Ga0115551_1446569 | Not Available | 553 | Open in IMG/M |
| 3300009409|Ga0114993_10259121 | Not Available | 1331 | Open in IMG/M |
| 3300009420|Ga0114994_10982613 | Not Available | 546 | Open in IMG/M |
| 3300009425|Ga0114997_10166553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1290 | Open in IMG/M |
| 3300009425|Ga0114997_10472002 | Not Available | 671 | Open in IMG/M |
| 3300009476|Ga0115555_1096162 | Not Available | 1276 | Open in IMG/M |
| 3300009481|Ga0114932_10225403 | Not Available | 1135 | Open in IMG/M |
| 3300009512|Ga0115003_10336564 | Not Available | 891 | Open in IMG/M |
| 3300009512|Ga0115003_10491841 | Not Available | 718 | Open in IMG/M |
| 3300009512|Ga0115003_10867613 | Not Available | 524 | Open in IMG/M |
| 3300009592|Ga0115101_1639701 | Not Available | 553 | Open in IMG/M |
| 3300009705|Ga0115000_10202573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1307 | Open in IMG/M |
| 3300009785|Ga0115001_10337521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 951 | Open in IMG/M |
| 3300010883|Ga0133547_11458397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1287 | Open in IMG/M |
| 3300010883|Ga0133547_11799951 | Not Available | 1132 | Open in IMG/M |
| 3300012524|Ga0129331_1077023 | Not Available | 611 | Open in IMG/M |
| 3300012525|Ga0129353_1643825 | Not Available | 668 | Open in IMG/M |
| 3300012936|Ga0163109_10411020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 991 | Open in IMG/M |
| 3300012936|Ga0163109_11129956 | Not Available | 572 | Open in IMG/M |
| 3300012954|Ga0163111_10523892 | Not Available | 1096 | Open in IMG/M |
| 3300012954|Ga0163111_11171439 | Not Available | 749 | Open in IMG/M |
| 3300012954|Ga0163111_11612052 | Not Available | 645 | Open in IMG/M |
| 3300017697|Ga0180120_10048534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1920 | Open in IMG/M |
| 3300017720|Ga0181383_1008986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2680 | Open in IMG/M |
| 3300017720|Ga0181383_1121167 | Not Available | 702 | Open in IMG/M |
| 3300017724|Ga0181388_1047963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1034 | Open in IMG/M |
| 3300017728|Ga0181419_1007193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3388 | Open in IMG/M |
| 3300017728|Ga0181419_1041395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1224 | Open in IMG/M |
| 3300017731|Ga0181416_1141557 | Not Available | 579 | Open in IMG/M |
| 3300017732|Ga0181415_1010252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2235 | Open in IMG/M |
| 3300017741|Ga0181421_1066191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 951 | Open in IMG/M |
| 3300017745|Ga0181427_1158615 | Not Available | 547 | Open in IMG/M |
| 3300017749|Ga0181392_1140790 | Not Available | 708 | Open in IMG/M |
| 3300017759|Ga0181414_1070895 | Not Available | 925 | Open in IMG/M |
| 3300017762|Ga0181422_1142591 | Not Available | 737 | Open in IMG/M |
| 3300017763|Ga0181410_1124009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 737 | Open in IMG/M |
| 3300017770|Ga0187217_1311151 | Not Available | 506 | Open in IMG/M |
| 3300017771|Ga0181425_1021843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2120 | Open in IMG/M |
| 3300017772|Ga0181430_1133056 | Not Available | 728 | Open in IMG/M |
| 3300017779|Ga0181395_1114047 | Not Available | 862 | Open in IMG/M |
| 3300017781|Ga0181423_1020379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2722 | Open in IMG/M |
| 3300017781|Ga0181423_1141513 | Not Available | 929 | Open in IMG/M |
| 3300017783|Ga0181379_1092552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1113 | Open in IMG/M |
| 3300017783|Ga0181379_1119608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 954 | Open in IMG/M |
| 3300017786|Ga0181424_10453964 | Not Available | 517 | Open in IMG/M |
| 3300018036|Ga0181600_10558917 | Not Available | 537 | Open in IMG/M |
| 3300019751|Ga0194029_1008353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1445 | Open in IMG/M |
| 3300020165|Ga0206125_10117847 | Not Available | 1101 | Open in IMG/M |
| 3300020187|Ga0206130_10350059 | Not Available | 613 | Open in IMG/M |
| 3300020238|Ga0211492_1017847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1392 | Open in IMG/M |
| 3300020278|Ga0211606_1080846 | Not Available | 634 | Open in IMG/M |
| 3300020289|Ga0211621_1017523 | Not Available | 1163 | Open in IMG/M |
| 3300020296|Ga0211474_1039459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 749 | Open in IMG/M |
| 3300020298|Ga0211657_1056954 | Not Available | 772 | Open in IMG/M |
| 3300020316|Ga0211487_1110956 | Not Available | 534 | Open in IMG/M |
| 3300020319|Ga0211517_1066418 | Not Available | 704 | Open in IMG/M |
| 3300020330|Ga0211572_1047363 | Not Available | 1105 | Open in IMG/M |
| 3300020349|Ga0211511_1140030 | Not Available | 545 | Open in IMG/M |
| 3300020352|Ga0211505_1136840 | Not Available | 579 | Open in IMG/M |
| 3300020376|Ga0211682_10196294 | Not Available | 784 | Open in IMG/M |
| 3300020376|Ga0211682_10256512 | Not Available | 666 | Open in IMG/M |
| 3300020382|Ga0211686_10254096 | Not Available | 723 | Open in IMG/M |
| 3300020382|Ga0211686_10461685 | Not Available | 507 | Open in IMG/M |
| 3300020385|Ga0211677_10365645 | Not Available | 566 | Open in IMG/M |
| 3300020395|Ga0211705_10181409 | Not Available | 772 | Open in IMG/M |
| 3300020406|Ga0211668_10103280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1191 | Open in IMG/M |
| 3300020419|Ga0211512_10150967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
| 3300020431|Ga0211554_10182833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1018 | Open in IMG/M |
| 3300020445|Ga0211564_10635370 | Not Available | 517 | Open in IMG/M |
| 3300020451|Ga0211473_10329801 | Not Available | 782 | Open in IMG/M |
| 3300020452|Ga0211545_10315786 | Not Available | 714 | Open in IMG/M |
| 3300020462|Ga0211546_10116654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1313 | Open in IMG/M |
| 3300020462|Ga0211546_10302511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 800 | Open in IMG/M |
| 3300020462|Ga0211546_10565114 | Not Available | 573 | Open in IMG/M |
| 3300020464|Ga0211694_10281096 | Not Available | 696 | Open in IMG/M |
| 3300020464|Ga0211694_10518198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300020468|Ga0211475_10016848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4353 | Open in IMG/M |
| 3300020468|Ga0211475_10214681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 963 | Open in IMG/M |
| 3300020469|Ga0211577_10014197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6435 | Open in IMG/M |
| 3300020469|Ga0211577_10116623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1833 | Open in IMG/M |
| 3300020469|Ga0211577_10431617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 809 | Open in IMG/M |
| 3300020472|Ga0211579_10055925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2436 | Open in IMG/M |
| 3300020477|Ga0211585_10144453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1564 | Open in IMG/M |
| 3300021347|Ga0213862_10074250 | Not Available | 1202 | Open in IMG/M |
| 3300021375|Ga0213869_10099373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1418 | Open in IMG/M |
| 3300021375|Ga0213869_10339707 | Not Available | 630 | Open in IMG/M |
| 3300021389|Ga0213868_10040638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3333 | Open in IMG/M |
| 3300021389|Ga0213868_10171285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1325 | Open in IMG/M |
| 3300021957|Ga0222717_10190054 | Not Available | 1225 | Open in IMG/M |
| 3300021957|Ga0222717_10614991 | Not Available | 568 | Open in IMG/M |
| 3300021960|Ga0222715_10113668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1730 | Open in IMG/M |
| 3300021960|Ga0222715_10196111 | Not Available | 1212 | Open in IMG/M |
| 3300021960|Ga0222715_10296057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 921 | Open in IMG/M |
| 3300023704|Ga0228684_1045619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 680 | Open in IMG/M |
| 3300024221|Ga0228666_1021814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1538 | Open in IMG/M |
| 3300024226|Ga0228667_1084119 | Not Available | 599 | Open in IMG/M |
| 3300024229|Ga0233402_1019826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1483 | Open in IMG/M |
| 3300024235|Ga0228665_1014006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1618 | Open in IMG/M |
| 3300024235|Ga0228665_1046930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 891 | Open in IMG/M |
| 3300024236|Ga0228655_1029418 | Not Available | 1331 | Open in IMG/M |
| 3300024237|Ga0228653_1003556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4001 | Open in IMG/M |
| 3300024242|Ga0228673_1026162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1033 | Open in IMG/M |
| (restricted) 3300024256|Ga0233446_1016957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3019 | Open in IMG/M |
| (restricted) 3300024261|Ga0233439_10137551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1189 | Open in IMG/M |
| 3300024294|Ga0228664_1004821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5474 | Open in IMG/M |
| 3300024314|Ga0228657_1015676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1824 | Open in IMG/M |
| 3300024321|Ga0228626_1006980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3505 | Open in IMG/M |
| 3300024322|Ga0228656_1012176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1998 | Open in IMG/M |
| 3300024348|Ga0244776_10131903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1837 | Open in IMG/M |
| 3300024359|Ga0228628_1093450 | Not Available | 577 | Open in IMG/M |
| 3300025508|Ga0208148_1012937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2509 | Open in IMG/M |
| 3300025547|Ga0209556_1004472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5820 | Open in IMG/M |
| 3300025663|Ga0209775_1052059 | Not Available | 1244 | Open in IMG/M |
| 3300025680|Ga0209306_1011413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3372 | Open in IMG/M |
| 3300025685|Ga0209095_1052330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1460 | Open in IMG/M |
| 3300025690|Ga0209505_1106398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 792 | Open in IMG/M |
| 3300025699|Ga0209715_1012948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4668 | Open in IMG/M |
| 3300025712|Ga0209305_1022216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2469 | Open in IMG/M |
| 3300025809|Ga0209199_1047745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2148 | Open in IMG/M |
| 3300025821|Ga0209600_1014242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3369 | Open in IMG/M |
| 3300025830|Ga0209832_1014093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3477 | Open in IMG/M |
| 3300025860|Ga0209119_1057280 | Not Available | 1911 | Open in IMG/M |
| 3300025870|Ga0209666_1120247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1240 | Open in IMG/M |
| 3300025880|Ga0209534_10099640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1658 | Open in IMG/M |
| 3300025881|Ga0209309_10062078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2178 | Open in IMG/M |
| 3300025881|Ga0209309_10145168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1210 | Open in IMG/M |
| 3300025886|Ga0209632_10488257 | Not Available | 565 | Open in IMG/M |
| 3300025890|Ga0209631_10005496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 13401 | Open in IMG/M |
| 3300025890|Ga0209631_10124200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1437 | Open in IMG/M |
| 3300025890|Ga0209631_10157384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1216 | Open in IMG/M |
| 3300025892|Ga0209630_10045959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2646 | Open in IMG/M |
| 3300025892|Ga0209630_10451594 | Not Available | 542 | Open in IMG/M |
| 3300025894|Ga0209335_10093529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 1603 | Open in IMG/M |
| 3300025897|Ga0209425_10165522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1216 | Open in IMG/M |
| 3300026076|Ga0208261_1137787 | Not Available | 619 | Open in IMG/M |
| 3300026270|Ga0207993_1034802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1495 | Open in IMG/M |
| 3300026270|Ga0207993_1042319 | Not Available | 1323 | Open in IMG/M |
| 3300026466|Ga0247598_1086428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 828 | Open in IMG/M |
| 3300026491|Ga0228641_1012558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2366 | Open in IMG/M |
| 3300026505|Ga0228647_1034576 | Not Available | 1307 | Open in IMG/M |
| 3300027077|Ga0208941_1001866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3685 | Open in IMG/M |
| 3300027406|Ga0208965_1099493 | Not Available | 575 | Open in IMG/M |
| 3300027572|Ga0208964_1019436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1798 | Open in IMG/M |
| 3300027672|Ga0209383_1038308 | Not Available | 1882 | Open in IMG/M |
| 3300027687|Ga0209710_1083074 | Not Available | 1315 | Open in IMG/M |
| 3300027687|Ga0209710_1198129 | Not Available | 686 | Open in IMG/M |
| 3300027702|Ga0209036_1205277 | Not Available | 552 | Open in IMG/M |
| 3300027752|Ga0209192_10034837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2364 | Open in IMG/M |
| 3300027752|Ga0209192_10068290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1540 | Open in IMG/M |
| 3300027752|Ga0209192_10097405 | Not Available | 1222 | Open in IMG/M |
| 3300027757|Ga0208671_10163565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 806 | Open in IMG/M |
| 3300027779|Ga0209709_10026976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3634 | Open in IMG/M |
| 3300027779|Ga0209709_10089201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1648 | Open in IMG/M |
| 3300027779|Ga0209709_10155766 | Not Available | 1114 | Open in IMG/M |
| 3300027791|Ga0209830_10014467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 4838 | Open in IMG/M |
| 3300027801|Ga0209091_10468634 | Not Available | 554 | Open in IMG/M |
| 3300027830|Ga0209359_10152182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1014 | Open in IMG/M |
| 3300027839|Ga0209403_10022507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 5282 | Open in IMG/M |
| 3300027847|Ga0209402_10204231 | Not Available | 1287 | Open in IMG/M |
| 3300027859|Ga0209503_10308599 | Not Available | 772 | Open in IMG/M |
| 3300028128|Ga0228645_1078577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 733 | Open in IMG/M |
| 3300028129|Ga0228634_1011810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2962 | Open in IMG/M |
| 3300028129|Ga0228634_1111593 | Not Available | 587 | Open in IMG/M |
| 3300028136|Ga0228608_1016802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2156 | Open in IMG/M |
| 3300028194|Ga0257106_1245298 | Not Available | 601 | Open in IMG/M |
| 3300028233|Ga0256417_1114759 | Not Available | 725 | Open in IMG/M |
| 3300031510|Ga0308010_1311168 | Not Available | 537 | Open in IMG/M |
| 3300031519|Ga0307488_10477464 | Not Available | 750 | Open in IMG/M |
| 3300031628|Ga0308014_1015970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1980 | Open in IMG/M |
| 3300031630|Ga0308004_10275195 | Not Available | 658 | Open in IMG/M |
| 3300031637|Ga0302138_10246282 | Not Available | 585 | Open in IMG/M |
| 3300031659|Ga0307986_10140716 | Not Available | 1129 | Open in IMG/M |
| 3300031659|Ga0307986_10335437 | Not Available | 623 | Open in IMG/M |
| 3300031696|Ga0307995_1151748 | Not Available | 858 | Open in IMG/M |
| 3300031702|Ga0307998_1044162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. HIMB1321 | 1792 | Open in IMG/M |
| 3300031721|Ga0308013_10089177 | Not Available | 1220 | Open in IMG/M |
| 3300031775|Ga0315326_11021760 | Not Available | 504 | Open in IMG/M |
| 3300032011|Ga0315316_10186609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1728 | Open in IMG/M |
| 3300032073|Ga0315315_10193310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1900 | Open in IMG/M |
| 3300032088|Ga0315321_10858794 | Not Available | 510 | Open in IMG/M |
| 3300032132|Ga0315336_1144764 | Not Available | 945 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 18.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.06% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 12.80% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.43% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 6.64% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.69% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.74% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.27% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.84% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.37% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.37% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.37% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.42% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.42% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.95% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.47% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.47% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.47% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.47% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.47% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001935 | Marine microbial communities from Northern Gulf of Maine, Canada - GS007 | Environmental | Open in IMG/M |
| 3300001946 | Marine microbial communities from North James Bay, Santigo Island, Equador | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300003476 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004280 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005735 | Seawater microbial communities from Vineyard Sound, MA, USA - control T0 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006011 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_O2min_ad_340m_LV | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006842 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_1_0025m | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007325 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007342 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300008995 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
| 3300020278 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556076-ERR599151) | Environmental | Open in IMG/M |
| 3300020289 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556122-ERR599019) | Environmental | Open in IMG/M |
| 3300020296 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140) | Environmental | Open in IMG/M |
| 3300020298 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX556051-ERR599128) | Environmental | Open in IMG/M |
| 3300020316 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX555946-ERR599134) | Environmental | Open in IMG/M |
| 3300020319 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX556039-ERR599073) | Environmental | Open in IMG/M |
| 3300020330 | Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX556097-ERR599147) | Environmental | Open in IMG/M |
| 3300020349 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300023704 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024226 | Seawater microbial communities from Monterey Bay, California, United States - 81D | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
| 3300024242 | Seawater microbial communities from Monterey Bay, California, United States - 91D | Environmental | Open in IMG/M |
| 3300024256 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_120_MG | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024321 | Seawater microbial communities from Monterey Bay, California, United States - 31D | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024359 | Seawater microbial communities from Monterey Bay, California, United States - 34D | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025547 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025663 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300026466 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026491 | Seawater microbial communities from Monterey Bay, California, United States - 52D | Environmental | Open in IMG/M |
| 3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
| 3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027406 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027572 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031637 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPaug09P1610mDRAFT_10446602 | 3300000149 | Marine | AAISPIIIALSAAKIMSMNIICSNIMPSSIKVNL* |
| JGI20157J14317_100042211 | 3300001352 | Pelagic Marine | KLAAIKAIIIALSAARIISIKIIWSSIMPSSIKMIE* |
| JGI20157J14317_100701061 | 3300001352 | Pelagic Marine | FGTKLAAIKPIIIALSAAKIMSIKIIWSNIMASSINVIR* |
| JGI20158J14315_100655901 | 3300001355 | Pelagic Marine | IICFLYFGTKLAAIKPIIIALSAAKIISMNIIWSNIIASSIKIFNI* |
| GOS2223_10169614 | 3300001935 | Marine | FAAIKPIMIALSAAKIISIKIIWVKITNSSIKMFL* |
| GOS2244_10093362 | 3300001946 | Marine | CLRCFGAKFAAIKPIMIALSAAKIMSMNIICTSIINCSIKMLI* |
| GOS2218_10080765 | 3300001947 | Marine | FGTKFAAIRPIIIALSAARIISINIICNNMINSSNKVKTFY* |
| GOScombined01_1015314842 | 3300002040 | Marine | TKLAAIRAIIIALSAAKIISIKIICSKIRDSSIKVII* |
| NAP2_11506942 | 3300003476 | Estuarine | GTKFAAIKPIMIALSAARIISIKIICNNIMDCSIKIKIY* |
| Ga0055584_1009791573 | 3300004097 | Pelagic Marine | YFGTKLAAIKPIIIALSAANIMSIKIIWSSIMASSIKIF* |
| Ga0066606_102695661 | 3300004280 | Marine | FFGTKLAAIKPIIIALSAAKMISIKMIWVKIMNSSIKIFL* |
| Ga0073579_10002311 | 3300005239 | Marine | CFLFFGTKLAAIKPIMIALSAAKMMSIKIIWVKIMNSSINIFL* |
| Ga0066856_102954951 | 3300005404 | Marine | PHKIICFLYFGTKLAAIKPIIIALSAAKIISMKIIWSNIMASSIKITK* |
| Ga0076923_1108484 | 3300005735 | Marine | LYFGTKLAAIKPIIIALSAAKIMSMNIIWSKIIASSIKISNI* |
| Ga0078893_103843582 | 3300005837 | Marine Surface Water | PHKMICFLYFGTKLAAIRPIIMALSAAKIISIKIIWSKIMASSIKVR* |
| Ga0078893_104541912 | 3300005837 | Marine Surface Water | INPIIIALSAAKIISMKIIWIIVSDCSSKANLLY* |
| Ga0066373_102452361 | 3300006011 | Marine | GTKLAAIKPMIIALSAAKIISINIIWIKIIDCSIKIPS* |
| Ga0066371_102027721 | 3300006024 | Marine | LCFGTKFAAMSPIIIALSAAKIISINIIWIIIINSSINVID* |
| Ga0075446_102153031 | 3300006190 | Marine | FGTKLAAINPIIIALSAAKMISIKMIWVKIMSSSINLFL* |
| Ga0075447_100494783 | 3300006191 | Marine | CFLFFGTKLAAIKPIIIALSAAKMMSIKIIWVKIMNSSIKVSL* |
| Ga0099963_13000071 | 3300006413 | Marine | AKLAAINPIMIALSAAKIISMKII*TNMSASSNKVCP* |
| Ga0068494_1126081 | 3300006842 | Marine | GTKLAAINPIIIALSAARIMSINIICSKMSDCSIKMLL* |
| Ga0075444_101517512 | 3300006947 | Marine | FLFFGTKLAAINPIIIALSAAKMISIKMIWVKIMSSSINLFL* |
| Ga0079257_13693651 | 3300007325 | Marine | AAIKPIMIALSAAKIISIKMICKSMSDSSNKVILF* |
| Ga0079227_12981273 | 3300007342 | Marine | KFAAIKPIIIALSAAKIISINIIWIIIINSSINVID* |
| Ga0102863_10248273 | 3300007622 | Estuarine | GTKLAAIKPMMIALSAAKIISMNIIWSNIMVSSIKIIE* |
| Ga0111541_102248941 | 3300008097 | Marine | TKLAAIKPIIIALSAARIMSIKIIWDKIKASSIKVVKLY* |
| Ga0102888_10045734 | 3300008995 | Estuarine | GTKLAAIKPMMIALSAAKIISMNIIWSNIMASSIKIVE* |
| Ga0102909_11803091 | 3300009050 | Estuarine | LAAIKPIIIALSAAKIISIKIIWSNIIASSIKISNI* |
| Ga0102815_100645734 | 3300009080 | Estuarine | AIKPIIIALSAAKIMSIKIIWSSIMASSIKISNI* |
| Ga0115551_14465692 | 3300009193 | Pelagic Marine | FLYFGTKLAAIKPIIIALSAAKIISMNIIWSNIIASSIKIFNI* |
| Ga0114993_102591212 | 3300009409 | Marine | FGTKLAAINPIIIALSAAKMISIKMIWVKIMNSSINLFL* |
| Ga0114994_109826132 | 3300009420 | Marine | AAINPIIIALSAAKMISIKMIWVKIMNSSIKIDLYY* |
| Ga0114997_101665533 | 3300009425 | Marine | FGTKLAAIRPIIIALSAAKIISIKIIWVKIINSSIKVFL* |
| Ga0114997_104720021 | 3300009425 | Marine | TKLAAIKPIIIALSAAKMISIKIIWVKIMNSSIKVFL* |
| Ga0115555_10961622 | 3300009476 | Pelagic Marine | AINPIIIALSAAKIISIKIIWSNMSDSSNKVRAYY* |
| Ga0114932_102254032 | 3300009481 | Deep Subsurface | LGTKLAAISPIIIALSAARIISIKIICKSMIDCSIKIP* |
| Ga0115003_103365641 | 3300009512 | Marine | IICFLFLGTKLAAIKPMIMALSAAKIISIKIICARTMDSSIKVNV* |
| Ga0115003_104918412 | 3300009512 | Marine | CFLFFGTKLAAISAIMIALSAARIISIKMIWVKIMNSSIKISV* |
| Ga0115003_108676132 | 3300009512 | Marine | FGTKLAAIKPIIIALSAAKIMSIKIIWVKIMNSSIKVLL* |
| Ga0115101_16397011 | 3300009592 | Marine | TPHKIICFLYFGTKLAAIKPIIIALSAAKIISIKIIWSNIIASSIKIFNI* |
| Ga0115000_102025731 | 3300009705 | Marine | AIRPMIIALSAAKIISIKIIWVKIMNSSIKVLIILNNYKNSMI* |
| Ga0115001_103375213 | 3300009785 | Marine | FFGTKFAAIKPIIIALSAAKIISIKIICSNIIASSIKVFNI* |
| Ga0133547_114583974 | 3300010883 | Marine | FFGTKLAAIKPIIIALSAAKIISIKIIWDKIMNSSIKVSL* |
| Ga0133547_117999512 | 3300010883 | Marine | GTKLEAIKPMIIALSAAKMMSIKIIWVKIMNSSINVFLYY* |
| Ga0129331_10770232 | 3300012524 | Aqueous | YFGTKLAAIKPIIIALSAAKIMSMNIIWSKIIASSIKISNI* |
| Ga0129353_16438254 | 3300012525 | Aqueous | AIKPIIIALSAAKIMSMNIIWSKIIASSIKISNI* |
| Ga0163109_104110201 | 3300012936 | Surface Seawater | AIKPIIIALSAAKIISINMICKSMRDSSNNVISF* |
| Ga0163109_111299562 | 3300012936 | Surface Seawater | LGTKFAAIKPIMIALSAAKIISMKMICKSMSDSSNKVILF* |
| Ga0163111_105238921 | 3300012954 | Surface Seawater | KFAAINPIIIALSAAKIISIKIIWSSMSVSSNKVSI* |
| Ga0163111_111714392 | 3300012954 | Surface Seawater | LFFGAKFAAINPIIIALSAAKIISIKIIWSSMSVSSNKVGI* |
| Ga0163111_116120522 | 3300012954 | Surface Seawater | FLGTKFAAIKPMIMALSAAKIISIKIICDNVSTSSIKVVIYNKL* |
| Ga0180120_100485341 | 3300017697 | Freshwater To Marine Saline Gradient | ATPHKIICFLYFGTKLAAIKPIIIALSAAKIMSMNIIWSKIIASSIKISNI |
| Ga0181383_10089864 | 3300017720 | Seawater | FLYFGTKLEAIKPIIIALSAAKIISMKIIWSNIMASSIKIVE |
| Ga0181383_11211672 | 3300017720 | Seawater | LYFGTKLAAIKPIIIALSAAKIMSMNIIWSNIMASSINVIR |
| Ga0181388_10479631 | 3300017724 | Seawater | PHKIICFLYFGTKLAAIKPIIIALSAAKIISMNIIWSNIIASSIKIFNI |
| Ga0181419_10071934 | 3300017728 | Seawater | LAAIKPMMIALSAAKIISMNIIWSNIMASSIKIVE |
| Ga0181419_10413953 | 3300017728 | Seawater | KKIEVIKLIIITLSVTKIIYINIIWSNIIASSIKISNI |
| Ga0181416_11415571 | 3300017731 | Seawater | LAAIKPIIIALSAAKIISMNIIWSNIMPSSIKVNL |
| Ga0181415_10102521 | 3300017732 | Seawater | PHKIICFLYFGTKLEAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0181421_10661913 | 3300017741 | Seawater | ICFLYFGTKLAAIKPIIIALSAAKIISMNIIWSNITASSIKIFNI |
| Ga0181427_11586152 | 3300017745 | Seawater | FLYFGTKLAAIKPIIIALSAAKIISMNIIWSNIMASSIKIVE |
| Ga0181392_11407902 | 3300017749 | Seawater | FGAKFAAINPIIIALSAAKIISIKIIXISMTVCSNKVVIY |
| Ga0181414_10708952 | 3300017759 | Seawater | XAKLAAIKPIIIALSAAKMISIKIIWTNMITSSNKINL |
| Ga0181422_11425912 | 3300017762 | Seawater | FGTKFEAIKPIIIALSAAKIISIKIIWSNIIASSIKIFNI |
| Ga0181410_11240091 | 3300017763 | Seawater | YFGTKLAAIKPIIIALSAAKIISIKIIWSNITASSIKISNI |
| Ga0187217_13111512 | 3300017770 | Seawater | GKIICFLYFGTKLAAIKPIIIALSAAKIISMNMICSNITASSIKIFNI |
| Ga0181425_10218431 | 3300017771 | Seawater | ELAAIKPIIIALSAAKIMSIKIIWSNIMASSINVIR |
| Ga0181430_11330562 | 3300017772 | Seawater | FGTKLAAISPIIMALSAAKIISIKIIWSSIMASSIKVY |
| Ga0181395_11140471 | 3300017779 | Seawater | AKFAAIKPIIIALSAAKIISMKTICNSMSDSSNKVQI |
| Ga0181423_10203791 | 3300017781 | Seawater | LAAIKPIIIALSAAKIISMNIIWSNIIASSIKIFNI |
| Ga0181423_11415132 | 3300017781 | Seawater | YFGTKLAAIKPIIIALSAAKIISMKIIWSNIMVSSIKIIK |
| Ga0181379_10925521 | 3300017783 | Seawater | FGTKLAAIKPIIIALSAAKIISMNIIWSNIMASSIKIFNI |
| Ga0181379_11196081 | 3300017783 | Seawater | YFGTKLAAIKPIIIALSAAKIMSMNIIWSKIIASSIKISNI |
| Ga0181424_104539642 | 3300017786 | Seawater | FFGTKLAAIRPMIIALSAARIMSIKIIWDNIKASSIKVITYNKL |
| Ga0181600_105589172 | 3300018036 | Salt Marsh | FLFLGAKLAAINPIIIALSAAKIMSIKMIWSSMRVSSNKIVI |
| Ga0194029_10083531 | 3300019751 | Freshwater | HKIICFLYFGTKLAAIKPIIIALSAAKIISMNIIWSKIIASSIKISNI |
| Ga0206125_101178472 | 3300020165 | Seawater | FGTKLAAIKPIIMALSAAKMISIKMIWVKIMNSCNTISIIYYSFKKISF |
| Ga0206130_103500591 | 3300020187 | Seawater | TKLAAINPIIIALSAAKIISIKMIWVKIMNSSIKIFL |
| Ga0211492_10178471 | 3300020238 | Marine | IICFLFLGTKLAAIKPIIIALSAARIISIKIICSKMRDSSIKMIV |
| Ga0211606_10808462 | 3300020278 | Marine | KFDAISPIIMALSAAKIISINIICVIITSSSTKVHY |
| Ga0211621_10175232 | 3300020289 | Marine | LAAIKPIIIALSAAKIISIKIIXSNMSESSNKVDA |
| Ga0211474_10394593 | 3300020296 | Marine | FFGTKFAAINPIIIALSAARIISIKIIXDNIKASSINLIYF |
| Ga0211657_10569542 | 3300020298 | Marine | FFGTKLAAINPIIIALSAAKTISINIIXANIMNCSINVA |
| Ga0211487_11109562 | 3300020316 | Marine | KFAAIKPMIIALSAAKIISIKIIXTNMSASSNKMSL |
| Ga0211517_10664182 | 3300020319 | Marine | LFFGTKFAAINPIIIALSAARIISIKIIXDNIKASSINLIYF |
| Ga0211572_10473631 | 3300020330 | Marine | LGTKLAAINPIIIALSAARIISIKIICSKINDCSIKMNL |
| Ga0211511_11400302 | 3300020349 | Marine | LGTKLAAIKPIIIALSAARIISIKIICNKIMDCSIKIKIY |
| Ga0211505_11368401 | 3300020352 | Marine | FGTKLAAIKPIIIALSAAKIISMNMICSNITASSIKIFNI |
| Ga0211682_101962941 | 3300020376 | Marine | GTKLAAISPIMIALSAAKIISINIIWVRIMNSSIKINVYY |
| Ga0211682_102565121 | 3300020376 | Marine | TKFAAIKPMIIALSAAKMMSIKIIWVKIMNSSIKIIL |
| Ga0211686_102540962 | 3300020382 | Marine | FLFFGTKLAAIKPIIIALSAAKIMSIKIIWVKIMNSSIKVLL |
| Ga0211686_104616852 | 3300020382 | Marine | FLFFGTKLAAIKPIIIALSAAKIMSIKIIWVKIMNSSIKMLL |
| Ga0211677_103656452 | 3300020385 | Marine | AAIKPIMIALSAAKIMSMNIIWSNIMASSIKIFNI |
| Ga0211705_101814092 | 3300020395 | Marine | FGTKFAAIKPIIIALSAAKIISINIICSKIKDSSINLVNIIVII |
| Ga0211668_101032801 | 3300020406 | Marine | AINPIIIALSAAKIISINIIXVNITSSSIKINLYYKKKIIQS |
| Ga0211512_101509673 | 3300020419 | Marine | TKFAAIRPIIIALSAARIISMKIIWDNIKASSINFKFLF |
| Ga0211554_101828333 | 3300020431 | Marine | AAIKPIIIALSAAKIISINMICKSMRDSSNNVISF |
| Ga0211564_106353702 | 3300020445 | Marine | LFFGAKFAAIKPIIIALSAAKIISINIIWIIIINSSINVID |
| Ga0211473_103298011 | 3300020451 | Marine | CLGAKFAAIKPIMIALSAAKIMSMNIICTSITNCSIKVSL |
| Ga0211545_103157861 | 3300020452 | Marine | FGTKLAAIKPIIIALSAAKIISMNIIWSNIMPSSIKIVE |
| Ga0211546_101166543 | 3300020462 | Marine | TKFAAIKPIIIALSAAKIISIKIICNNIKDCSIKVDL |
| Ga0211546_103025113 | 3300020462 | Marine | FAAIKPIIIALSAARIISIKIICNKIMDCSIKIKLY |
| Ga0211546_105651142 | 3300020462 | Marine | KFAAIKPIIIALSAARIMSIKIICDKIIASSINVLNYIRKF |
| Ga0211694_102810962 | 3300020464 | Marine | LFFGTKLEAIKPIIMALSAAKMISIKMICSKIRDSSIKIPI |
| Ga0211694_105181982 | 3300020464 | Marine | LFLGTKLAAIKPIMIALSAAKIISMKIICSSISNSSNKVRL |
| Ga0211475_100168486 | 3300020468 | Marine | TKLAAIRPIIMALSAAKIISIKIIWSKIMASSIKVY |
| Ga0211475_102146811 | 3300020468 | Marine | GTKFEAIKPIIIALSAAKIISIKMICNSMSDSSNNVIIF |
| Ga0211577_100141971 | 3300020469 | Marine | TPHKIICFLYFGTKLAAIKPIIIALSAAKIISMNIIWSNIMPSSIKIVK |
| Ga0211577_101166231 | 3300020469 | Marine | FLYFGTKLAAIKPIIIALSAAKIMSMNIIWSKIIASSIKISNI |
| Ga0211577_104316173 | 3300020469 | Marine | GTKFAAIKPIIIALSAARIISIKTICNSMSDSSNNLAIY |
| Ga0211579_100559251 | 3300020472 | Marine | GTKFDAIKPIIIALSAAKIISMNTIWSKIRDSSNKVKI |
| Ga0211585_101444533 | 3300020477 | Marine | GTKFEAMRPMIIALSAAKIISMNIICVKIIISSIKIYVFYLKF |
| Ga0213862_100742502 | 3300021347 | Seawater | IICFLYFGTKLAAIRPIIMALSAAKIISIKIIWSKIMASSIKVY |
| Ga0213869_100993731 | 3300021375 | Seawater | HKIICCLFFGAKFAAINPIIIALSAAKIISIKIIWSSMRVSSNKVDT |
| Ga0213869_103397072 | 3300021375 | Seawater | LFLGTKLAAIKPIIMALSAAKMISIKIIXVKIINSSIKVFL |
| Ga0213868_100406385 | 3300021389 | Seawater | GTKLAAIKPIIIALSAAKIMSIKIIWSSIMASSINVIR |
| Ga0213868_101712853 | 3300021389 | Seawater | GTKLAAIKPIIIALSAAKIISMNMIWSNIMASSINVFR |
| Ga0222717_101900542 | 3300021957 | Estuarine Water | FLFLGTKLAAIKPMMIALSAAKIISINIIWVKIMSSSINIFL |
| Ga0222717_106149912 | 3300021957 | Estuarine Water | FGTKFAAIKPIMIALSAAKIMSIKTIXDKIINSSNNIYL |
| Ga0222715_101136681 | 3300021960 | Estuarine Water | TKLAAIKPIIIALSAAKIMSMNIIWSKIIASSIKISNI |
| Ga0222715_101961112 | 3300021960 | Estuarine Water | HNIICFLFFGTKLAAIKPMIIALSAAKMISINIIWVKIMSSSINIFL |
| Ga0222715_102960571 | 3300021960 | Estuarine Water | LAAIKPIIIALSAAKIISMNMICSNITASSIKIFNI |
| Ga0228684_10456191 | 3300023704 | Seawater | TKLAAIKPIIIALSAAKIISMNMICSNITASSIKIFNI |
| Ga0228666_10218144 | 3300024221 | Seawater | IICFLYFGTKLAAIKPIIIALSAAKIISIKIIWSNIIASSIKISNI |
| Ga0228667_10841192 | 3300024226 | Seawater | TKLAAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0233402_10198261 | 3300024229 | Seawater | LYFGTKLAAIKPIIIALSAAKIISMNMICSNITASSIKIFNI |
| Ga0228665_10140063 | 3300024235 | Seawater | CLLYFGTKLEAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0228665_10469303 | 3300024235 | Seawater | KLAAIKPIIIALSAAKIISMNMICSNITASSIKIFNI |
| Ga0228655_10294181 | 3300024236 | Seawater | ATPHKIICLLYFGTKLAAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0228653_10035566 | 3300024237 | Seawater | HKIICFLYFGTKLEAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0228673_10261621 | 3300024242 | Seawater | FLYFGTKLAAIKPIIIALSAAKIISMNMICSNITASSIKIFNI |
| (restricted) Ga0233446_10169571 | 3300024256 | Seawater | LFFGTKLAAINPMIIALSAAKMISIKMIWVKIMNSSIKSFL |
| (restricted) Ga0233439_101375513 | 3300024261 | Seawater | ATPHKIICFLYFGTKLAAIKPIIIALSAAKIISMNMIWSNIMASSINVIR |
| Ga0228664_10048211 | 3300024294 | Seawater | YFGTKLAAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0228657_10156763 | 3300024314 | Seawater | PHKIICLLYFGTKLAAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0228626_10069804 | 3300024321 | Seawater | LYFGTKLAAIKPIIIALSAAKIISMNIIWSNIMASSIKIS |
| Ga0228656_10121761 | 3300024322 | Seawater | TKLEAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0244776_101319031 | 3300024348 | Estuarine | KLAAIKPIMIALSAANIISIKIIXVKIINSSIKIF |
| Ga0228628_10934501 | 3300024359 | Seawater | KIICFLYFGTKLAAIKPIIIALSAAKIISMNIIWSNIIASSIKIFNI |
| Ga0208148_10129371 | 3300025508 | Aqueous | KLAAINPIIIALSAAKMISIKMIWVKIMNSSINIFL |
| Ga0209556_10044728 | 3300025547 | Marine | FFGTKLAAINPIIIALSAAKMISIKMIWVKIMNSSIKSFL |
| Ga0209775_10520592 | 3300025663 | Marine | QRIICFLFFGTKLAAIKPIIIALSAAKMISIKMIWVKIMNSSIKIFL |
| Ga0209306_10114131 | 3300025680 | Pelagic Marine | CFLYFGTKLAAIKPIIIALSAAKIMSIKIIWSNIMASSINVIR |
| Ga0209095_10523303 | 3300025685 | Pelagic Marine | FGTKFAAINPMITALSAAKIISIKIIWVKITSSSIKIFL |
| Ga0209505_11063983 | 3300025690 | Pelagic Marine | EAIKPIIIALSAAKIISIKIIWSNIIASSIKISNI |
| Ga0209715_10129481 | 3300025699 | Pelagic Marine | IICFLYFGTKLAAIKPIIIALSAAKIMSIKIIWSSIMASSIKISNI |
| Ga0209305_10222164 | 3300025712 | Pelagic Marine | KIICFLYFGTKLAAIKPIIIALSAAKIMSIKIIWSNIMASSINVIR |
| Ga0209199_10477455 | 3300025809 | Pelagic Marine | YFGTKLAAIKPIIIALSAAKIMSIKIIWSSIMASSIKISNI |
| Ga0209600_10142425 | 3300025821 | Pelagic Marine | ATPHKIICFLYFGTKLAAIKPIIIALSAAKIMSIKIIWSNIMASSINVIR |
| Ga0209832_10140935 | 3300025830 | Pelagic Marine | PATPHKIICFLYFGTKLAAIKPIIIALSAAKIMSIKIIWSNIMASSINVIR |
| Ga0209119_10572801 | 3300025860 | Pelagic Marine | IICFLFFGTKLAAISPIIIALSAAKMISIKMIWVKIMNSSINIFL |
| Ga0209666_11202473 | 3300025870 | Marine | FLFFGTKFAAIKPIIIALSAAKIISIKTIXDKIMRSSNKVFL |
| Ga0209534_100996401 | 3300025880 | Pelagic Marine | IICFLYFGTKFEAIKPIIIALSAAKIISIKIIWSNIIASSIKISNI |
| Ga0209309_100620784 | 3300025881 | Pelagic Marine | FLYFGTKLAAIKPIIIALSAAKIISMNMIWSNIMASSINVIR |
| Ga0209309_101451681 | 3300025881 | Pelagic Marine | YFGTKLAAIKPIIIALSAAKIISMNMIWSNIMASSINVFR |
| Ga0209632_104882572 | 3300025886 | Pelagic Marine | FAAIRPIIIALSAAKIISIKIICNNIMVSSIKIFNI |
| Ga0209631_1000549614 | 3300025890 | Pelagic Marine | GTKLAAINPIIIALSAAKMISIKMIWVKIMNSCNTISIIYYSFKKISF |
| Ga0209631_101242003 | 3300025890 | Pelagic Marine | HKIICFLYFGTKLAAIKPIIIALSAAKIISMNIIWSNIIASSIKIFNI |
| Ga0209631_101573841 | 3300025890 | Pelagic Marine | HKIICFLYFGTKLAAIKPIIIALSAAKIISMNMIWSNIMASSINVIR |
| Ga0209630_100459591 | 3300025892 | Pelagic Marine | PHKIICFLYFGTKLAAIKPIIIALSAANIMSIKIIWSSIMASSIKIF |
| Ga0209630_104515942 | 3300025892 | Pelagic Marine | GTKLAAIKPIIMALSAAKMISIKIIXVKIINSSIKVFL |
| Ga0209335_100935291 | 3300025894 | Pelagic Marine | IKLAAIKPIIIALSAAKIMSIKIIWVKIISSSNTFCFKY |
| Ga0209425_101655221 | 3300025897 | Pelagic Marine | KIICFLYFGTKLAAIKPIIIALSAAKIISMNMIWSNIMASSINVIR |
| Ga0208261_11377871 | 3300026076 | Marine | FFGTKLEAINPIIIALSAAKIISMNIIXIKIMACSINILLF |
| Ga0207993_10348023 | 3300026270 | Marine | KLAAINPIIIALSAAKIMSIKIIWSSMRVSSNKIVI |
| Ga0207993_10423193 | 3300026270 | Marine | FGTKLAAINPIIIALSAARIISINIICSKMSDCSIKMLL |
| Ga0247598_10864283 | 3300026466 | Seawater | LYFGTKLAAIKPIIIALSAAKIISIKIIWSNIIASSIKIFNI |
| Ga0228641_10125581 | 3300026491 | Seawater | LYFGTKLAAIKPIIIALSAAKIISIKIIWSNIIASSIKISNI |
| Ga0228647_10345762 | 3300026505 | Seawater | ICLLYFGTKLAAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0208941_10018661 | 3300027077 | Marine | LAAIKPMMIALSAARIISMNIIWSNIMASSINVIR |
| Ga0208965_10994932 | 3300027406 | Marine | CFLYFGTKLEAIKPIIIALSAAKIISMKIIWSNIMASSIKIIK |
| Ga0208964_10194363 | 3300027572 | Marine | CFLYFGTKLAAIKPMMIALSAARIISMNIIWSNIMASSINVIR |
| Ga0209383_10383081 | 3300027672 | Marine | IICFLFFGTKLAAIKPIIIALSAAKMMSIKIIWVKIMNSSIKVSL |
| Ga0209710_10830742 | 3300027687 | Marine | GTKLAAINPIIIALSAAKMISIKIIWVKIMNSCNTISNI |
| Ga0209710_11981292 | 3300027687 | Marine | LFFGTKLAAIKPIIIALSAAKIISIKIIWVKIMNSSINVIL |
| Ga0209036_12052772 | 3300027702 | Marine | FAAISPIIMALSAAKIISIKIICVKIINCSIKINNI |
| Ga0209192_100348371 | 3300027752 | Marine | FFGTKLAAIKPIIIALSAAKMISIKIIWVKIMNSSIKIYL |
| Ga0209192_100682903 | 3300027752 | Marine | IICFIFLGTKLAAIKPIIIALSAAKIMSINIIWVKIMNSSIKVFYNIKNL |
| Ga0209192_100974052 | 3300027752 | Marine | PQRIICFLFFGTKLAAINPIIIALSAAKMISIKMIWVKIMNSSINLFL |
| Ga0208671_101635651 | 3300027757 | Estuarine | KLAAIKPIIIALSAAKIMSIKIIWSSIMASSIKISNI |
| Ga0209709_100269765 | 3300027779 | Marine | ICFLFFGTKLAAIKPIIIALSAAKMISIKIIWVKIMNSSIKVLL |
| Ga0209709_100892011 | 3300027779 | Marine | IICFLFFGTKLAAIKPIIMALSAAKMISIKIIWVKIMNSSIKIFL |
| Ga0209709_101557661 | 3300027779 | Marine | FLFFGTKLAAIKPMIIALSAAKIISIKIIWVKIINSSIKVFYNIKNL |
| Ga0209830_100144671 | 3300027791 | Marine | LFFGTKLAAINPIIIALSAAKMISIKIIWVKIMNSCNTISNI |
| Ga0209091_104686341 | 3300027801 | Marine | FGTKFAAIKPIIIALSAAKIISIKIIXSNIMDSSIKVIL |
| Ga0209359_101521821 | 3300027830 | Marine | KFAAISPIMIALSAAKIISIKIICVKIINCSIKINNI |
| Ga0209403_100225071 | 3300027839 | Marine | IICFLFFGTKLAAIKPIIIALSAAKIISMNIIWVKIMNSCNTISNI |
| Ga0209402_102042312 | 3300027847 | Marine | KIICLLFFGTKLAAIKPIITALSAAKIISIKIIWAKIMDCSIKVHL |
| Ga0209503_103085991 | 3300027859 | Marine | FAAIKPIIIALSAAKIISIKIIXISMINSSNNTNL |
| Ga0228645_10785771 | 3300028128 | Seawater | KLAAIKPIIIALSAAKIISIKIIWSNIIASSIKISNI |
| Ga0228634_10118104 | 3300028129 | Seawater | GTKLAAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0228634_11115932 | 3300028129 | Seawater | GTKLEAIKPIIIALSAAKIISMKIIWSNIMASSIKITK |
| Ga0228608_10168021 | 3300028136 | Seawater | LYFGTKLAAIKPIIIALSAAKIISMKIIWSNIMASSINVIR |
| Ga0257106_12452981 | 3300028194 | Marine | FGTKFAAINPIIIALSAAKMISIKMIWVKIMNSSINIFL |
| Ga0256417_11147592 | 3300028233 | Seawater | GTKLAAIKPIIIALSAAKIISMNIIWSNIMASSIKIVE |
| Ga0308010_13111681 | 3300031510 | Marine | GTKLAAIKPIIIALSAAKIISIKIIWVKIMNSSIKVFYIIENLQ |
| Ga0307488_104774642 | 3300031519 | Sackhole Brine | FLFFGTKLAAINPIIIALSAAKMISIKIIWVKIMNSCNTISNI |
| Ga0308014_10159704 | 3300031628 | Marine | LAAINPIIIALSAAKMISMKMIWVKIMNSSINLFLYY |
| Ga0308004_102751951 | 3300031630 | Marine | FFGTKLAAIKPMIIALSAAKIISIKIIWVKIINSSIKINL |
| Ga0302138_102462822 | 3300031637 | Marine | LAAIKPIIIALSAAKIMSIKIIWVKIMNSSIKMLIILKI |
| Ga0307986_101407161 | 3300031659 | Marine | FGTKLAAINPIIIALSAANMMSIKMIWVKIMNSSIKVYL |
| Ga0307986_103354372 | 3300031659 | Marine | FFGTKLAAIKPIMIALSAAKIISIKMIWVKIINSSINIFL |
| Ga0307995_11517481 | 3300031696 | Marine | LFFGTKLAAISPIIIALSAAKIISINIIWVKIRNSSIKIDV |
| Ga0307998_10441623 | 3300031702 | Marine | GTKLAAIKPIIMALSAAKMISIKMIWVKIMNSCNTISIIYYSFKKISF |
| Ga0308013_100891772 | 3300031721 | Marine | TKLAAISPIMIALSAAKIISINIIWVRIMNSSIKINAYY |
| Ga0315326_110217602 | 3300031775 | Seawater | FLFFGTKLAAIKPMIIALSAAKMISINIIWVKIMSSSINIFL |
| Ga0315316_101866091 | 3300032011 | Seawater | GTKFAAIKPIMIALSAAKIISIKIIWSSMSVSSNNI |
| Ga0315315_101933101 | 3300032073 | Seawater | PHKIIFFLFFGTKFAAIKPIIIALSAAKIISIKIIWLSIMDCSMKVKIV |
| Ga0315321_108587942 | 3300032088 | Seawater | LAAIKPIIIALSAAKIMSMNIIWSKIIASSIKISNI |
| Ga0315336_11447642 | 3300032132 | Seawater | FGTKFAAIKPIIMALSAAKIISINIIXVKIINSSIKMF |
| ⦗Top⦘ |