| Basic Information | |
|---|---|
| Family ID | F023093 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 211 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 211 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.16 % |
| % of genes from short scaffolds (< 2000 bps) | 80.09 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.768 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (18.957 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.872 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.502 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 30.43% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 211 Family Scaffolds |
|---|---|---|
| PF14743 | DNA_ligase_OB_2 | 14.22 |
| PF01464 | SLT | 0.47 |
| PF12684 | DUF3799 | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.56 % |
| Unclassified | root | N/A | 28.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10029374 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300000756|JGI12421J11937_10058491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1211 | Open in IMG/M |
| 3300002835|B570J40625_100007922 | Not Available | 19531 | Open in IMG/M |
| 3300002835|B570J40625_100196480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2195 | Open in IMG/M |
| 3300003277|JGI25908J49247_10158047 | Not Available | 527 | Open in IMG/M |
| 3300003394|JGI25907J50239_1032042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1121 | Open in IMG/M |
| 3300003394|JGI25907J50239_1056473 | Not Available | 791 | Open in IMG/M |
| 3300003404|JGI25920J50251_10117228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 598 | Open in IMG/M |
| 3300003404|JGI25920J50251_10146448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 515 | Open in IMG/M |
| 3300004481|Ga0069718_10122065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1606 | Open in IMG/M |
| 3300005581|Ga0049081_10087687 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
| 3300005581|Ga0049081_10129090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 932 | Open in IMG/M |
| 3300005584|Ga0049082_10002150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 6285 | Open in IMG/M |
| 3300005585|Ga0049084_10064593 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1352 | Open in IMG/M |
| 3300005585|Ga0049084_10192097 | Not Available | 699 | Open in IMG/M |
| 3300005662|Ga0078894_10447864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
| 3300005805|Ga0079957_1150336 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300006037|Ga0075465_10037176 | Not Available | 1006 | Open in IMG/M |
| 3300006641|Ga0075471_10262859 | Not Available | 885 | Open in IMG/M |
| 3300006802|Ga0070749_10049702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2556 | Open in IMG/M |
| 3300006802|Ga0070749_10183420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1204 | Open in IMG/M |
| 3300006802|Ga0070749_10259581 | Not Available | 982 | Open in IMG/M |
| 3300006802|Ga0070749_10453516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 702 | Open in IMG/M |
| 3300006805|Ga0075464_10051538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 2271 | Open in IMG/M |
| 3300006805|Ga0075464_10145793 | Not Available | 1388 | Open in IMG/M |
| 3300006805|Ga0075464_10152115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1359 | Open in IMG/M |
| 3300006805|Ga0075464_10199716 | Not Available | 1187 | Open in IMG/M |
| 3300006805|Ga0075464_10718171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 619 | Open in IMG/M |
| 3300006920|Ga0070748_1116394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1010 | Open in IMG/M |
| 3300006920|Ga0070748_1194066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 744 | Open in IMG/M |
| 3300007547|Ga0102875_1214358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 594 | Open in IMG/M |
| 3300007618|Ga0102896_1122869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 838 | Open in IMG/M |
| 3300007639|Ga0102865_1048503 | Not Available | 1256 | Open in IMG/M |
| 3300007661|Ga0102866_1128514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 637 | Open in IMG/M |
| 3300007708|Ga0102859_1004756 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 3207 | Open in IMG/M |
| 3300007972|Ga0105745_1322387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 508 | Open in IMG/M |
| 3300007973|Ga0105746_1176784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 725 | Open in IMG/M |
| 3300008114|Ga0114347_1089514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1214 | Open in IMG/M |
| 3300008114|Ga0114347_1097450 | Not Available | 1144 | Open in IMG/M |
| 3300008263|Ga0114349_1111286 | Not Available | 1172 | Open in IMG/M |
| 3300008266|Ga0114363_1073700 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300008266|Ga0114363_1187975 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300008266|Ga0114363_1192877 | Not Available | 634 | Open in IMG/M |
| 3300008267|Ga0114364_1064866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1663 | Open in IMG/M |
| 3300008267|Ga0114364_1125086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 756 | Open in IMG/M |
| 3300008450|Ga0114880_1004524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7437 | Open in IMG/M |
| 3300008450|Ga0114880_1069864 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1429 | Open in IMG/M |
| 3300008450|Ga0114880_1154972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300009151|Ga0114962_10023240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 4343 | Open in IMG/M |
| 3300009152|Ga0114980_10062981 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 2237 | Open in IMG/M |
| 3300009152|Ga0114980_10195950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1189 | Open in IMG/M |
| 3300009152|Ga0114980_10228946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1088 | Open in IMG/M |
| 3300009152|Ga0114980_10334049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 876 | Open in IMG/M |
| 3300009158|Ga0114977_10227878 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300009159|Ga0114978_10746383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 555 | Open in IMG/M |
| 3300009165|Ga0105102_10121946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1245 | Open in IMG/M |
| 3300009165|Ga0105102_10713618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 564 | Open in IMG/M |
| 3300009169|Ga0105097_10113281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1485 | Open in IMG/M |
| 3300009180|Ga0114979_10163486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1360 | Open in IMG/M |
| 3300009184|Ga0114976_10106274 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1599 | Open in IMG/M |
| 3300009419|Ga0114982_1038962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1523 | Open in IMG/M |
| 3300010160|Ga0114967_10450512 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 635 | Open in IMG/M |
| 3300010354|Ga0129333_10247286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1609 | Open in IMG/M |
| 3300010354|Ga0129333_10680641 | Not Available | 886 | Open in IMG/M |
| 3300010354|Ga0129333_11513675 | Not Available | 549 | Open in IMG/M |
| 3300010885|Ga0133913_11610229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1638 | Open in IMG/M |
| 3300010885|Ga0133913_12250845 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1341 | Open in IMG/M |
| 3300010885|Ga0133913_12423983 | Not Available | 1282 | Open in IMG/M |
| 3300011183|Ga0136713_1046710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 572 | Open in IMG/M |
| 3300012017|Ga0153801_1020889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
| 3300012352|Ga0157138_1003450 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 2691 | Open in IMG/M |
| 3300012665|Ga0157210_1016397 | Not Available | 1230 | Open in IMG/M |
| 3300012666|Ga0157498_1005042 | Not Available | 2182 | Open in IMG/M |
| 3300013004|Ga0164293_10859072 | Not Available | 573 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10027095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5676 | Open in IMG/M |
| 3300013372|Ga0177922_10523006 | Not Available | 600 | Open in IMG/M |
| 3300013372|Ga0177922_11004047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 540 | Open in IMG/M |
| 3300013372|Ga0177922_11217556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 584 | Open in IMG/M |
| 3300013372|Ga0177922_11337753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1372 | Open in IMG/M |
| 3300015050|Ga0181338_1033435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 778 | Open in IMG/M |
| 3300017701|Ga0181364_1068680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 543 | Open in IMG/M |
| 3300017716|Ga0181350_1023873 | Not Available | 1703 | Open in IMG/M |
| 3300017716|Ga0181350_1059297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1000 | Open in IMG/M |
| 3300017723|Ga0181362_1089087 | Not Available | 619 | Open in IMG/M |
| 3300017723|Ga0181362_1106294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 555 | Open in IMG/M |
| 3300017736|Ga0181365_1027552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1434 | Open in IMG/M |
| 3300017736|Ga0181365_1112487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 655 | Open in IMG/M |
| 3300017754|Ga0181344_1165733 | Not Available | 627 | Open in IMG/M |
| 3300017766|Ga0181343_1001804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8355 | Open in IMG/M |
| 3300017766|Ga0181343_1069185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
| 3300017777|Ga0181357_1062103 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300017777|Ga0181357_1149139 | Not Available | 863 | Open in IMG/M |
| 3300017785|Ga0181355_1185636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 824 | Open in IMG/M |
| 3300019784|Ga0181359_1136539 | Not Available | 858 | Open in IMG/M |
| 3300020157|Ga0194049_1125099 | Not Available | 691 | Open in IMG/M |
| 3300020159|Ga0211734_10533791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
| 3300020159|Ga0211734_11042348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 718 | Open in IMG/M |
| 3300020160|Ga0211733_11070294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 743 | Open in IMG/M |
| 3300020161|Ga0211726_10585536 | All Organisms → Viruses → Predicted Viral | 2302 | Open in IMG/M |
| 3300020162|Ga0211735_10364998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1406 | Open in IMG/M |
| 3300020172|Ga0211729_10361364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 589 | Open in IMG/M |
| 3300020183|Ga0194115_10029427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3934 | Open in IMG/M |
| 3300020524|Ga0208858_1015787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1204 | Open in IMG/M |
| 3300020571|Ga0208723_1010179 | Not Available | 1616 | Open in IMG/M |
| 3300021091|Ga0194133_10193611 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1371 | Open in IMG/M |
| 3300021325|Ga0210301_1277207 | Not Available | 746 | Open in IMG/M |
| 3300021519|Ga0194048_10094043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1158 | Open in IMG/M |
| 3300021952|Ga0213921_1001616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5689 | Open in IMG/M |
| 3300021961|Ga0222714_10021972 | All Organisms → cellular organisms → Bacteria | 4955 | Open in IMG/M |
| 3300021961|Ga0222714_10099978 | Not Available | 1838 | Open in IMG/M |
| 3300021961|Ga0222714_10108277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1742 | Open in IMG/M |
| 3300021961|Ga0222714_10125919 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300021961|Ga0222714_10164859 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1313 | Open in IMG/M |
| 3300021961|Ga0222714_10187412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1205 | Open in IMG/M |
| 3300021961|Ga0222714_10189575 | Not Available | 1196 | Open in IMG/M |
| 3300021962|Ga0222713_10066848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2674 | Open in IMG/M |
| 3300021962|Ga0222713_10142886 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300021962|Ga0222713_10267669 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300021963|Ga0222712_10215783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
| 3300022190|Ga0181354_1107438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300022190|Ga0181354_1126829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 816 | Open in IMG/M |
| 3300022190|Ga0181354_1135077 | Not Available | 783 | Open in IMG/M |
| 3300022190|Ga0181354_1238802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 523 | Open in IMG/M |
| 3300022747|Ga0228703_1009932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 3604 | Open in IMG/M |
| 3300024289|Ga0255147_1015427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1633 | Open in IMG/M |
| 3300024343|Ga0244777_10011740 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 5558 | Open in IMG/M |
| 3300024346|Ga0244775_10176275 | Not Available | 1799 | Open in IMG/M |
| 3300024505|Ga0255150_1001970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 4026 | Open in IMG/M |
| 3300024507|Ga0255176_1095923 | Not Available | 507 | Open in IMG/M |
| 3300025451|Ga0208426_1047729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 660 | Open in IMG/M |
| 3300025896|Ga0208916_10079125 | Not Available | 1375 | Open in IMG/M |
| 3300025896|Ga0208916_10344072 | Not Available | 650 | Open in IMG/M |
| 3300027079|Ga0255188_1065867 | Not Available | 655 | Open in IMG/M |
| 3300027141|Ga0255076_1014002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1530 | Open in IMG/M |
| 3300027210|Ga0208802_1009565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1311 | Open in IMG/M |
| 3300027229|Ga0208442_1063364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 620 | Open in IMG/M |
| 3300027320|Ga0208923_1012734 | All Organisms → Viruses → Predicted Viral | 1473 | Open in IMG/M |
| 3300027586|Ga0208966_1013655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2409 | Open in IMG/M |
| 3300027621|Ga0208951_1045105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1300 | Open in IMG/M |
| 3300027693|Ga0209704_1091405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 860 | Open in IMG/M |
| 3300027697|Ga0209033_1068042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1230 | Open in IMG/M |
| 3300027732|Ga0209442_1160956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 857 | Open in IMG/M |
| 3300027733|Ga0209297_1005188 | All Organisms → cellular organisms → Bacteria | 6728 | Open in IMG/M |
| 3300027733|Ga0209297_1027005 | All Organisms → cellular organisms → Bacteria | 2691 | Open in IMG/M |
| 3300027734|Ga0209087_1065689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1613 | Open in IMG/M |
| 3300027736|Ga0209190_1104147 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
| 3300027747|Ga0209189_1059693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1814 | Open in IMG/M |
| 3300027754|Ga0209596_1043117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 2420 | Open in IMG/M |
| 3300027759|Ga0209296_1121946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1212 | Open in IMG/M |
| 3300027764|Ga0209134_10021503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2045 | Open in IMG/M |
| 3300027764|Ga0209134_10125468 | Not Available | 884 | Open in IMG/M |
| 3300027772|Ga0209768_10112084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1326 | Open in IMG/M |
| 3300027772|Ga0209768_10116381 | Not Available | 1293 | Open in IMG/M |
| 3300027782|Ga0209500_10042311 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
| 3300027785|Ga0209246_10051122 | Not Available | 1593 | Open in IMG/M |
| 3300027785|Ga0209246_10053140 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300027785|Ga0209246_10057065 | Not Available | 1509 | Open in IMG/M |
| 3300027785|Ga0209246_10196292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 789 | Open in IMG/M |
| 3300027798|Ga0209353_10180660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 931 | Open in IMG/M |
| 3300027798|Ga0209353_10351305 | Not Available | 615 | Open in IMG/M |
| 3300027804|Ga0209358_10002720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 13310 | Open in IMG/M |
| 3300027804|Ga0209358_10029289 | All Organisms → cellular organisms → Bacteria | 3399 | Open in IMG/M |
| 3300027808|Ga0209354_10049665 | Not Available | 1690 | Open in IMG/M |
| 3300027899|Ga0209668_10594434 | Not Available | 739 | Open in IMG/M |
| 3300027900|Ga0209253_10118866 | Not Available | 2157 | Open in IMG/M |
| 3300027900|Ga0209253_10346133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1142 | Open in IMG/M |
| 3300027973|Ga0209298_10227326 | Not Available | 752 | Open in IMG/M |
| 3300028025|Ga0247723_1105686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 704 | Open in IMG/M |
| 3300029933|Ga0119945_1035314 | Not Available | 557 | Open in IMG/M |
| 3300031707|Ga0315291_10365687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1385 | Open in IMG/M |
| 3300031758|Ga0315907_10067895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3095 | Open in IMG/M |
| 3300031758|Ga0315907_10225473 | Not Available | 1562 | Open in IMG/M |
| 3300031758|Ga0315907_10242457 | Not Available | 1497 | Open in IMG/M |
| 3300031758|Ga0315907_10369130 | Not Available | 1163 | Open in IMG/M |
| 3300031784|Ga0315899_10935207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 778 | Open in IMG/M |
| 3300031857|Ga0315909_10124254 | Not Available | 2174 | Open in IMG/M |
| 3300031857|Ga0315909_10297930 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
| 3300032050|Ga0315906_10163216 | Not Available | 2138 | Open in IMG/M |
| 3300032053|Ga0315284_11640710 | Not Available | 673 | Open in IMG/M |
| 3300032516|Ga0315273_10630071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1419 | Open in IMG/M |
| 3300033993|Ga0334994_0013632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 5519 | Open in IMG/M |
| 3300033993|Ga0334994_0178853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300033994|Ga0334996_0178877 | Not Available | 1153 | Open in IMG/M |
| 3300034013|Ga0334991_0054512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2069 | Open in IMG/M |
| 3300034050|Ga0335023_0057522 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300034061|Ga0334987_0585711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 661 | Open in IMG/M |
| 3300034062|Ga0334995_0023282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 5469 | Open in IMG/M |
| 3300034062|Ga0334995_0297878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
| 3300034066|Ga0335019_0312308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 983 | Open in IMG/M |
| 3300034071|Ga0335028_0030622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3715 | Open in IMG/M |
| 3300034092|Ga0335010_0090041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2070 | Open in IMG/M |
| 3300034093|Ga0335012_0052222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2360 | Open in IMG/M |
| 3300034093|Ga0335012_0182684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1122 | Open in IMG/M |
| 3300034093|Ga0335012_0605253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 506 | Open in IMG/M |
| 3300034101|Ga0335027_0834469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 530 | Open in IMG/M |
| 3300034102|Ga0335029_0125706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1781 | Open in IMG/M |
| 3300034102|Ga0335029_0519635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 686 | Open in IMG/M |
| 3300034105|Ga0335035_0180061 | Not Available | 1314 | Open in IMG/M |
| 3300034109|Ga0335051_0354167 | Not Available | 702 | Open in IMG/M |
| 3300034110|Ga0335055_0006053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 5778 | Open in IMG/M |
| 3300034110|Ga0335055_0317053 | Not Available | 661 | Open in IMG/M |
| 3300034110|Ga0335055_0425825 | Not Available | 543 | Open in IMG/M |
| 3300034116|Ga0335068_0349335 | Not Available | 721 | Open in IMG/M |
| 3300034116|Ga0335068_0506023 | Not Available | 558 | Open in IMG/M |
| 3300034200|Ga0335065_0514187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 713 | Open in IMG/M |
| 3300034272|Ga0335049_0031428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3974 | Open in IMG/M |
| 3300034272|Ga0335049_0404274 | Not Available | 893 | Open in IMG/M |
| 3300034283|Ga0335007_0216459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300034283|Ga0335007_0286550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1087 | Open in IMG/M |
| 3300034356|Ga0335048_0150723 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C10FEB | 1332 | Open in IMG/M |
| 3300034356|Ga0335048_0308520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 818 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.21% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.21% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.74% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.79% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.32% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.37% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.42% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.42% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.95% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.95% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.95% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.47% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.47% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.47% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.47% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.47% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.47% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027079 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027229 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100293744 | 3300000756 | Freshwater And Sediment | VPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| JGI12421J11937_100584913 | 3300000756 | Freshwater And Sediment | PIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| B570J40625_1000079221 | 3300002835 | Freshwater | KPDGSIGASAAVIVAGVPIAALSIGKKLTVGGKVVRITSQTHKTLSAWITLVVIDDNQ* |
| B570J40625_1001964801 | 3300002835 | Freshwater | GASAALLSSGAPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| JGI25908J49247_101580472 | 3300003277 | Freshwater Lake | ASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDXNQ* |
| JGI25907J50239_10320421 | 3300003394 | Freshwater Lake | PDGSTGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ* |
| JGI25907J50239_10564731 | 3300003394 | Freshwater Lake | LSAGVPIASLGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ* |
| JGI25920J50251_101172281 | 3300003404 | Freshwater Lake | GSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ* |
| JGI25920J50251_101464481 | 3300003404 | Freshwater Lake | GSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWVTLIVIDDNQ* |
| Ga0069718_101220653 | 3300004481 | Sediment | ASAAIIASGAVIPSLAQGKKIVAGGKTVRITTQTYKPGSAWVTLVVIDDNQ* |
| Ga0049081_100876873 | 3300005581 | Freshwater Lentic | IGKKIVAGGKALRITGQTYKPASAWITLVVIDDNQ* |
| Ga0049081_101290901 | 3300005581 | Freshwater Lentic | GQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0049082_1000215011 | 3300005584 | Freshwater Lentic | GQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ* |
| Ga0049084_100645931 | 3300005585 | Freshwater Lentic | GKKIVAGGKTVRINSQTFKPGSAWITLVVMDDSQ* |
| Ga0049084_101920971 | 3300005585 | Freshwater Lentic | AALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ* |
| Ga0078894_104478642 | 3300005662 | Freshwater Lake | GASAAVISSGSPIASLAIGKKIVAGGKTLRITGQTYKPGSAWVTLVVIDDNQ* |
| Ga0079957_11503361 | 3300005805 | Lake | SGGSPIASLGQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ* |
| Ga0075465_100371762 | 3300006037 | Aqueous | IASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0075471_102628591 | 3300006641 | Aqueous | GSIGASAATLSGGVPIASLAQGKRIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0070749_100497021 | 3300006802 | Aqueous | AQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0070749_101834203 | 3300006802 | Aqueous | ASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0070749_102595812 | 3300006802 | Aqueous | GASAAIIASGAVIPSLAQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ* |
| Ga0070749_104535162 | 3300006802 | Aqueous | SLAQGKKIVAGGKTVRITTQSYKPGSAWVTLVVIDDNQ* |
| Ga0075464_100515384 | 3300006805 | Aqueous | ASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0075464_101457931 | 3300006805 | Aqueous | AFAQGKKMTIGGRGVRITTQTYKPNSAWVTLIVIDDNQ* |
| Ga0075464_101521151 | 3300006805 | Aqueous | AGAPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0075464_101997163 | 3300006805 | Aqueous | GSSAALLSGGVPIASLAQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ* |
| Ga0075464_107181712 | 3300006805 | Aqueous | LGQGKKIVAGGKTVRITTQTYNPGSAWITLVVIDDNQ* |
| Ga0070748_11163942 | 3300006920 | Aqueous | GVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0070748_11940661 | 3300006920 | Aqueous | SLPDGSIGASTAIIVGGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWVTLIVIDDNQ* |
| Ga0102875_12143582 | 3300007547 | Estuarine | SLAQGKKIVAGGKTVRITSQTYKPASAWVTLVVIDDNQ* |
| Ga0102896_11228691 | 3300007618 | Estuarine | LAQGKKIVAGGKTVRITSQTYKPASAWVTLVVIDDNQ* |
| Ga0102865_10485031 | 3300007639 | Estuarine | AQGKKIVAGGKTVRITTQTHKPASAWITLLVIDDNQ* |
| Ga0102866_11285141 | 3300007661 | Estuarine | MGASAALLSAGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0102859_10047566 | 3300007708 | Estuarine | SNGSSAALLSAGAPIASLGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ* |
| Ga0105745_13223872 | 3300007972 | Estuary Water | LPDGSNGASAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0105746_11767841 | 3300007973 | Estuary Water | QGKKIVAGGKNVRITTQTHKPASAWITLLVIDDNQ* |
| Ga0114347_10895141 | 3300008114 | Freshwater, Plankton | SGGSPIASLGQGKKIVAGGKTVRITTQTYKPGSAWVTLIVIDDNQ* |
| Ga0114347_10974501 | 3300008114 | Freshwater, Plankton | IISGGSPIASLGQGKKIVAGGKTVRITTQTYKPGSAWVTLIVIDDNQ* |
| Ga0114349_11112861 | 3300008263 | Freshwater, Plankton | SLGQGKKIVAGGKTVRITTQTYKPGSAWVTLIVIDDNQ* |
| Ga0114363_10737003 | 3300008266 | Freshwater, Plankton | ASAAVISAGAPIASLAIGKKIVAGGKTLRITGQTYKPASAWITLVVIDDNQ* |
| Ga0114363_11879753 | 3300008266 | Freshwater, Plankton | IGASAAIIASGAVIPSLGQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ* |
| Ga0114363_11928772 | 3300008266 | Freshwater, Plankton | IGASAAIIASGAVIPSLGQGKKIVAGGKTVRITTQTYKPGSAWVTLVVIDDNQ* |
| Ga0114364_10648661 | 3300008267 | Freshwater, Plankton | GKKIVAGGKTLRITGQTYKPGSAWLTLVVIDDNQ* |
| Ga0114364_11250861 | 3300008267 | Freshwater, Plankton | QGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0114880_100452412 | 3300008450 | Freshwater Lake | AVISSGAPIASLAIGKKIVAGGKTLRITGQTYKPGSAWLTLVVIDDNQ* |
| Ga0114880_10698641 | 3300008450 | Freshwater Lake | GLGIGKRLTVGGKVVRINSQTYKPASAWITLVVIDADQ* |
| Ga0114880_11549721 | 3300008450 | Freshwater Lake | AVISSGAPIASLAIGKKIVAGGKTLRITGQTYKPGSAWVTLVVIDDNQ* |
| Ga0114962_100232407 | 3300009151 | Freshwater Lake | APIANFAIGKKLVVGGRHLRINGRTYKPGSAWITLVVIDDTQ* |
| Ga0114980_100629814 | 3300009152 | Freshwater Lake | LGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0114980_101959501 | 3300009152 | Freshwater Lake | QGKKIVAGGRDVRITSQTYKPGAAWVTLIVIDDNQ* |
| Ga0114980_102289461 | 3300009152 | Freshwater Lake | SAALLSGGIPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0114980_103340491 | 3300009152 | Freshwater Lake | SAALLSGGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0114977_102278782 | 3300009158 | Freshwater Lake | GIPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0114978_107463831 | 3300009159 | Freshwater Lake | SGGLPIASLGQGKKIVVGGKTVRITTQTYKPASAWVTLLVIDDNQ* |
| Ga0105102_101219461 | 3300009165 | Freshwater Sediment | LAQGKKIVAGGKTVRITTQTYKPGSAWVTLVVIDDNQ* |
| Ga0105102_107136181 | 3300009165 | Freshwater Sediment | IASLAQGKKIVAGGKTVRITSQTYKPGSAWVTLVVIDDNQ* |
| Ga0105097_101132813 | 3300009169 | Freshwater Sediment | DGSNGASAAVIVAGVPIAALGIGKKLTVGGKVVRITSQTHKTLSAWITLVVIDDNQ* |
| Ga0114979_101634863 | 3300009180 | Freshwater Lake | TGSSAALLSGGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0114976_101062743 | 3300009184 | Freshwater Lake | ASLAIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ* |
| Ga0114982_10389621 | 3300009419 | Deep Subsurface | AQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ* |
| Ga0114967_104505121 | 3300010160 | Freshwater Lake | IGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ* |
| Ga0129333_102472861 | 3300010354 | Freshwater To Marine Saline Gradient | SLGQGKKIVAGGKTVRITTQTYKPGSAWVTLVVIDDNQ* |
| Ga0129333_106806411 | 3300010354 | Freshwater To Marine Saline Gradient | AATLSGGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0129333_115136751 | 3300010354 | Freshwater To Marine Saline Gradient | SLPDGSNGSSAAVISGGAPIASLAIGKKIVAGGKTLRITGQTYKPASAWVTLVVIDDNQ* |
| Ga0133913_116102291 | 3300010885 | Freshwater Lake | PDGSNGASAALLSAGVPIASLGIGKKIVAGGKTVRINSQTFKPGSAWITLVVMDDSQ* |
| Ga0133913_122508451 | 3300010885 | Freshwater Lake | LAIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ* |
| Ga0133913_124239831 | 3300010885 | Freshwater Lake | LSAGLPIASLAIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ* |
| Ga0136713_10467102 | 3300011183 | Freshwater | SSGAPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ* |
| Ga0153801_10208893 | 3300012017 | Freshwater | SLAIGKKIVAGGKALRITGQTYKPASAWITLVVIDDNQ* |
| Ga0157138_10034506 | 3300012352 | Freshwater | SGGVPIPSLGIGKKLTVGGKVVRITSQTHKTASAWITLVVIDDSQ* |
| Ga0157210_10163973 | 3300012665 | Freshwater | AALLSSGAPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLLVIDDNQ* |
| Ga0157498_10050424 | 3300012666 | Freshwater, Surface Ice | GSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ* |
| Ga0164293_108590721 | 3300013004 | Freshwater | GSIGASAATLSGGVPIASLGQGKKIVAGGKTVRVTTQTYKPGSAWITLVVIDDNQ* |
| (restricted) Ga0172373_1002709510 | 3300013131 | Freshwater | GLGKKIVAGGKNLRVTGQTYKPGSAWVTLLVVHEDQ* |
| Ga0177922_105230062 | 3300013372 | Freshwater | SLAQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ* |
| Ga0177922_110040472 | 3300013372 | Freshwater | SNGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ* |
| Ga0177922_112175561 | 3300013372 | Freshwater | SLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ* |
| Ga0177922_113377531 | 3300013372 | Freshwater | PIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ* |
| Ga0181338_10334351 | 3300015050 | Freshwater Lake | GKKIVAGGLNVRITTQTHKPASAWITLLVIDDNQ* |
| Ga0181364_10686802 | 3300017701 | Freshwater Lake | GSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0181350_10238733 | 3300017716 | Freshwater Lake | SNGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0181350_10592971 | 3300017716 | Freshwater Lake | DGSTGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0181362_10890871 | 3300017723 | Freshwater Lake | GSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWSSLAS |
| Ga0181362_11062942 | 3300017723 | Freshwater Lake | NGSSAALLSAGVPIASLAQGKKIVAGGKNVRITTQTHKPASAWITLLVIDDNQ |
| Ga0181365_10275521 | 3300017736 | Freshwater Lake | SSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0181365_11124872 | 3300017736 | Freshwater Lake | AGVPIASLAEGKKVVAGRKTVHTTTQTHKPGSAWITLVVIDDNQ |
| Ga0181344_11657332 | 3300017754 | Freshwater Lake | VPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0181343_100180414 | 3300017766 | Freshwater Lake | ASAAVISSGSPIASLAIGKKIVAGGKTLRITGQTYKPGSAWLTLVVIDDNQ |
| Ga0181343_10691852 | 3300017766 | Freshwater Lake | GAPIASLAIGKKIVAGGKALRITGQTYKPASAWITLVVIDDNQ |
| Ga0181357_10621033 | 3300017777 | Freshwater Lake | PDGSNGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0181357_11491392 | 3300017777 | Freshwater Lake | SSAALLAAGVPIASLAQGKKIVAGGKTVRITTQTHKPASAWITLLVIDDNQ |
| Ga0181355_11856361 | 3300017785 | Freshwater Lake | IASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0181359_11365392 | 3300019784 | Freshwater Lake | AGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0194049_11250991 | 3300020157 | Anoxic Zone Freshwater | SNLPIASLAIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ |
| Ga0211734_105337911 | 3300020159 | Freshwater | IASLAIGKKIVAGGKTLRITGQTYKPASAWVSLVVIDDNQ |
| Ga0211734_110423482 | 3300020159 | Freshwater | GSPIPSLAQGKKIVAGGKNVRITTQTYKPASAWITLVVIDDNQ |
| Ga0211733_110702941 | 3300020160 | Freshwater | AWSLPDGSNGASAATVGGGVVIAALGQGKKIVAGGRTVRITTQTHKPGSAWITLVVIDDN |
| Ga0211726_105855364 | 3300020161 | Freshwater | SGAVIPSLAQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ |
| Ga0211735_103649981 | 3300020162 | Freshwater | GVPIASLGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0211729_103613641 | 3300020172 | Freshwater | GAVIPSLGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0194115_100294271 | 3300020183 | Freshwater Lake | SSGAPVASLAIGKKIVAGGKNLRVTGQTHKPGSAWVTLMVVHEDQ |
| Ga0208858_10157873 | 3300020524 | Freshwater | PIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0208723_10101793 | 3300020571 | Freshwater | GQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0194133_101936113 | 3300021091 | Freshwater Lake | AIGKKIVAGGKNLRVTGQTHKPGSAWVTLMVVHEDQ |
| Ga0210301_12772071 | 3300021325 | Estuarine | GVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0194048_100940433 | 3300021519 | Anoxic Zone Freshwater | AQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0213921_100161610 | 3300021952 | Freshwater | ASLAIGKKIVAGGKDLRITGQTYKPGSAWVTLVVVDDNQ |
| Ga0222714_100219728 | 3300021961 | Estuarine Water | SLAQRKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0222714_100999783 | 3300021961 | Estuarine Water | SPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0222714_101082771 | 3300021961 | Estuarine Water | LAQGKKIVAGGKTVRITTQTYKPGSAWVTLVVIDDNQ |
| Ga0222714_101259193 | 3300021961 | Estuarine Water | PIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0222714_101648593 | 3300021961 | Estuarine Water | DGSVGASAATLSGGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0222714_101874122 | 3300021961 | Estuarine Water | SQPGGSTGASAATLSGGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0222714_101895751 | 3300021961 | Estuarine Water | SAAPLSGGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0222713_100668481 | 3300021962 | Estuarine Water | SLPDGSNGASAAVISSGAPIASLAIGKKIVAGGKTLRITGQTYKPGSAWVTLVVIDDNQ |
| Ga0222713_101428864 | 3300021962 | Estuarine Water | PIASLAQGKKIVAGGKNVRITTQTYKPGSAWITLLVIDDNQ |
| Ga0222713_102676691 | 3300021962 | Estuarine Water | PIASLGQGKKIVAGGKTVRITTQTYKPGSAWVTLVVIDDNQ |
| Ga0222712_102157831 | 3300021963 | Estuarine Water | IGKKIVAGGKTLRITGQTYKPGSAWVTLVVIDDNQ |
| Ga0181354_11074381 | 3300022190 | Freshwater Lake | IGKKIVAGGKTLRITGQTYKPASAWITLVVIDDNQ |
| Ga0181354_11268292 | 3300022190 | Freshwater Lake | SLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0181354_11350772 | 3300022190 | Freshwater Lake | LSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0181354_12388021 | 3300022190 | Freshwater Lake | GSLAQGKKIVAGGLNVRITTQTHKPASAWITLLVIDDNQ |
| Ga0228703_10099326 | 3300022747 | Freshwater | FGKKIVAGGKTVRVNSVTYKPGSAWITLVVIDDNQ |
| Ga0255147_10154274 | 3300024289 | Freshwater | IASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0244777_1001174010 | 3300024343 | Estuarine | TAIIVSGSPIASLAQGKKIVAGGKTVRITSQTYKPASAWVTLVVIDDNQ |
| Ga0244775_101762751 | 3300024346 | Estuarine | GQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0255150_10019701 | 3300024505 | Freshwater | IPSLGIGKKLTVGGKVVRITSQTHKTASAWITLVVIDDSQ |
| Ga0255176_10959232 | 3300024507 | Freshwater | SLGIGKKLTVGGKVVRITSQTHKTASAWITLVVIDDSQ |
| Ga0208426_10477292 | 3300025451 | Aqueous | IASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0208916_100791253 | 3300025896 | Aqueous | QGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0208916_103440721 | 3300025896 | Aqueous | IASGAVIPSLAQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ |
| Ga0255188_10658671 | 3300027079 | Freshwater | NGASGAIISGGAPVASLGIGKKIVAGGKNLRVTGQTYKPGSAWVTLLVIHEDQ |
| Ga0255076_10140023 | 3300027141 | Freshwater | AQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0208802_10095651 | 3300027210 | Estuarine | ASLGQGKKIVAGGLNVRITTQTHKPASAWITLLVIDDNQ |
| Ga0208442_10633642 | 3300027229 | Estuarine | AQGKKIVAGGKTVRITSQTYKPASAWVTLVVIDDNQ |
| Ga0208923_10127343 | 3300027320 | Estuarine | DGSNGSSAALLSAGAPIASLGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0208966_10136551 | 3300027586 | Freshwater Lentic | GQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0208951_10451051 | 3300027621 | Freshwater Lentic | ASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0209704_10914051 | 3300027693 | Freshwater Sediment | VSGSPIASLAQGKKIVAGGKTVRITTQTYKSGSAWVTLVVIDDNQ |
| Ga0209033_10680423 | 3300027697 | Freshwater Lake | ISGGSPIASLGQGKKIVAGGKTVRITTQTYKPGSAWVTLIVIDDNQ |
| Ga0209442_11609561 | 3300027732 | Freshwater Lake | PIASLAQGKKIVAGGLNVRITTQTHKPASAWITLLVIDDNQ |
| Ga0209297_10051881 | 3300027733 | Freshwater Lake | SLGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0209297_10270055 | 3300027733 | Freshwater Lake | AGIPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0209087_10656893 | 3300027734 | Freshwater Lake | ASLAIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ |
| Ga0209190_11041473 | 3300027736 | Freshwater Lake | GSNGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0209189_10596934 | 3300027747 | Freshwater Lake | IASLAIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ |
| Ga0209596_10431171 | 3300027754 | Freshwater Lake | GASAALLSGGVPIASLGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0209296_11219461 | 3300027759 | Freshwater Lake | PIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0209134_100215034 | 3300027764 | Freshwater Lake | GSNGSSAPLLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0209134_101254682 | 3300027764 | Freshwater Lake | IASLAQGKKIVAGGKTVRITTQTHKPASAWITLLVIDDNQ |
| Ga0209768_101120843 | 3300027772 | Freshwater Lake | LLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0209768_101163811 | 3300027772 | Freshwater Lake | SNGSSAALLSAGVPIASLAQGKKIVAGGKNVRITTQTHKPASAWITLLVIDDNQ |
| Ga0209500_100423114 | 3300027782 | Freshwater Lake | DGSTGSSAALLSAGIPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0209246_100511221 | 3300027785 | Freshwater Lake | NGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0209246_100531401 | 3300027785 | Freshwater Lake | ALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0209246_100570653 | 3300027785 | Freshwater Lake | VPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0209246_101962921 | 3300027785 | Freshwater Lake | GVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0209353_101806602 | 3300027798 | Freshwater Lake | LGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0209353_103513051 | 3300027798 | Freshwater Lake | LLAAGVPIASLAQGKKIVAGGKTVRITTQTHKPASAWITLLVIDDNQ |
| Ga0209358_100027201 | 3300027804 | Freshwater Lake | QGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0209358_100292891 | 3300027804 | Freshwater Lake | LLSGGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0209354_100496653 | 3300027808 | Freshwater Lake | DGSNGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTHKPGSAWITLVVIDDNQ |
| Ga0209668_105944341 | 3300027899 | Freshwater Lake Sediment | SVIPSLAQGKKIVAGGRDVRITTQTYKPGSAWVTLLVIDDNQ |
| Ga0209253_101188664 | 3300027900 | Freshwater Lake Sediment | ASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0209253_103461332 | 3300027900 | Freshwater Lake Sediment | LLSSGAPIAGLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0209298_102273261 | 3300027973 | Freshwater Lake | LAIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ |
| Ga0247723_11056861 | 3300028025 | Deep Subsurface Sediment | LGQGKKIVAGGKTVRITTQTYKPASAWITLVVIDDNQ |
| Ga0119945_10353141 | 3300029933 | Aquatic | GAVIPSLGQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ |
| Ga0315291_103656871 | 3300031707 | Sediment | ASDGRTGASAALLSAGLPIASLAIGKKITAGGKSVRITSQTYKPGSAWIILVVIDDNQ |
| Ga0315907_100678956 | 3300031758 | Freshwater | ASAAIISGGSPIASLGQGKKIVAGGKTVRITTQTYKPGSAWVTLIVIDDNQ |
| Ga0315907_102254731 | 3300031758 | Freshwater | AVIPSLGQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ |
| Ga0315907_102424573 | 3300031758 | Freshwater | TGASAAVISSGAPIASLAIGKKIVAGGKTLRITGQTYKPGSAWVTLVVIDDNQ |
| Ga0315907_103691301 | 3300031758 | Freshwater | AAIISGGSPIASLGQGKKIVAGGKTVRITTQTYKPGSAWVTLIVIDDNQ |
| Ga0315899_109352072 | 3300031784 | Freshwater | AGVPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0315909_101242541 | 3300031857 | Freshwater | SGAVIPSLGQGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ |
| Ga0315909_102979303 | 3300031857 | Freshwater | APIASLAIGKKIVAGGKTLRITGQTYKPASAWITLVVIDDNQ |
| Ga0315906_101632164 | 3300032050 | Freshwater | QGKKIVAGGKTVRITTQTYKPGSAWVTLLVIDDNQ |
| Ga0315284_116407101 | 3300032053 | Sediment | SGATLAAGVPIAGLGIGKRLTVGGKVVRINSQTYKPASAWITLVVIDADQ |
| Ga0315273_106300711 | 3300032516 | Sediment | SAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0334994_0013632_5313_5474 | 3300033993 | Freshwater | MGASAALLSAGAPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0334994_0178853_1_117 | 3300033993 | Freshwater | SLAIGKKIVAGGKALRITGQTYKPASAWITLVVIDDNQ |
| Ga0334996_0178877_28_189 | 3300033994 | Freshwater | MGASAALLSSGAPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLLVIDDNQ |
| Ga0334991_0054512_3_164 | 3300034013 | Freshwater | NGSSAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0335023_0057522_2073_2201 | 3300034050 | Freshwater | VPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLLVIDDNQ |
| Ga0334987_0585711_1_123 | 3300034061 | Freshwater | IASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0334995_0023282_2_115 | 3300034062 | Freshwater | LAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0334995_0297878_2_148 | 3300034062 | Freshwater | AVISAGAPIASLAIGKKIVAGGKALRITGQTYKPASAWITLVVIDDNQ |
| Ga0335019_0312308_3_179 | 3300034066 | Freshwater | QPDGSIGASAALLSAGVPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335028_0030622_3561_3713 | 3300034071 | Freshwater | SAALLSGGVPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335010_0090041_1_162 | 3300034092 | Freshwater | TGASAALLSSGAPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335012_0052222_1_117 | 3300034093 | Freshwater | SLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0335012_0182684_1011_1121 | 3300034093 | Freshwater | GQGKKIVVGGKTVRIITQTYKPASAWLTLIVIDDNQ |
| Ga0335012_0605253_371_505 | 3300034093 | Freshwater | SGAPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335027_0834469_2_163 | 3300034101 | Freshwater | MGASAALLSGGVPIASLGQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335029_0125706_3_155 | 3300034102 | Freshwater | SAALLSGGVPIASLGQGKKIVAGGKNVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0335029_0519635_2_172 | 3300034102 | Freshwater | DGSTGASTAIIVGGSPIASLAQGKKIVAGGKNVRITTQTYKPGSAWVTLVVIDDNQ |
| Ga0335035_0180061_1072_1233 | 3300034105 | Freshwater | MGASAALLSAGVPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLLVIDDNQ |
| Ga0335051_0354167_548_700 | 3300034109 | Freshwater | SAALLSSGAPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0335055_0006053_2_115 | 3300034110 | Freshwater | LGQGKKIVAGGKTVRITTQTYKPASAWITLFVIDDNQ |
| Ga0335055_0317053_480_659 | 3300034110 | Freshwater | SQPDGSIGASAALLSSGAPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335055_0425825_427_543 | 3300034110 | Freshwater | SLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0335068_0349335_1_126 | 3300034116 | Freshwater | PIASLGQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335068_0506023_62_223 | 3300034116 | Freshwater | MGASAALLSAGVPIASLGQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0335065_0514187_512_640 | 3300034200 | Freshwater | VPIASLAQGKKIVTGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335049_0031428_3863_3973 | 3300034272 | Freshwater | GQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| Ga0335049_0404274_2_124 | 3300034272 | Freshwater | IASLGQGKKIVAGGKTVRITSQTYKPGSAWITLLVIDDNQ |
| Ga0335007_0216459_1_168 | 3300034283 | Freshwater | GSNGASAAVISAGAPIASLAIGKKIVAGGKALRITGQTYKPASAWITLVVIDDNQ |
| Ga0335007_0286550_950_1087 | 3300034283 | Freshwater | SSGAPIASLAQGKKIVAGGKTVRITTQTYKPGSAWITLVVIDDNQ |
| Ga0335048_0150723_1209_1331 | 3300034356 | Freshwater | IASLAQGKKIVAGGKTVRITSQTYKPGSAWITLLVIDDNQ |
| Ga0335048_0308520_666_818 | 3300034356 | Freshwater | SAALLSAGAPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ |
| ⦗Top⦘ |