Metagenome / Metatranscriptome Family F023052

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F023052
Family Type	Metagenome / Metatranscriptome
Number of Sequences	211
Average Sequence Length	39 residues
Representative Sequence	MFIAWVVLDGSAKTVVGYAIIGTLVAWAITYPLRNPKDED
Number of Associated Samples	148
Number of Associated Scaffolds	211

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	23.33 %
% of genes near scaffold ends (potentially truncated)	70.62 %
% of genes from short scaffolds (< 2000 bps)	81.04 %
Associated GOLD sequencing projects	136
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (54.028 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (21.327 % of family members)
Environment Ontology (ENVO)	Unclassified (57.820 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (60.190 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 211 Family Scaffolds
PF05257	CHAP	18.48
PF02467	Whib	4.74
PF13539	Peptidase_M15_4	3.32
PF13578	Methyltransf_24	1.90
PF12705	PDDEXK_1	1.90
PF13481	AAA_25	0.95
PF03237	Terminase_6N	0.95
PF10030	DUF2272	0.47
PF13362	Toprim_3	0.47
PF01551	Peptidase_M23	0.47
PF07508	Recombinase	0.47
PF13640	2OG-FeII_Oxy_3	0.47
PF00085	Thioredoxin	0.47
PF04232	SpoVS	0.47

COG ID	Name	Functional Category	% Frequency in 211 Family Scaffolds
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.47
COG2359	Stage V sporulation protein SpoVS, predicted DNA-binding, AlbA superfamily	Function unknown [S]	0.47

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	74.88 %
Unclassified	root	N/A	25.12 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	64.93 %
Unclassified	root	N/A	25.12 %
cellular organisms	root	All Organisms → cellular organisms	9.95 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	54.03 %
Unclassified	root	N/A	25.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.90 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	9.48 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.47 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	54.03 %
Unclassified	root	N/A	25.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.90 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	6.16 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	0.47 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.95 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	54.03 %
Unclassified	root	N/A	25.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.90 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5.69 %
unclassified Euryarchaeota	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota	0.47 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.47 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.95 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	54.03 %
Unclassified	root	N/A	25.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.90 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	5.69 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.47 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.47 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.47 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	48.82 %
Unclassified	root	N/A	25.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.90 %
Methylophilaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae	5.69 %
Idiomarinaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae	0.47 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.47 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.47 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	48.82 %
Unclassified	root	N/A	25.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.90 %
unclassified Methylophilaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae	5.69 %
unclassified Idiomarinaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae	0.47 %
actinobacterium acMicro-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acMicro-4	0.47 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.47 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	48.82 %
Unclassified	root	N/A	25.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.90 %
Methylophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	5.69 %
Idiomarinaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium	0.47 %
actinobacterium acMicro-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acMicro-4	0.47 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.47 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000929\|NpDRAFT_10209242	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1099	Open in IMG/M
3300002351\|B570J29582_1021319	Not Available	605	Open in IMG/M
3300002408\|B570J29032_109676801	All Organisms → Viruses → Predicted Viral	1038	Open in IMG/M
3300002408\|B570J29032_109858709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	1711	Open in IMG/M
3300002835\|B570J40625_100148506	All Organisms → Viruses → Predicted Viral	2684	Open in IMG/M
3300002835\|B570J40625_100380785	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1382	Open in IMG/M
3300003491\|JGI25924J51412_1047300	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	680	Open in IMG/M
3300003616\|JGI25928J51866_1134430	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	510	Open in IMG/M
3300004448\|Ga0065861_1052701	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300004769\|Ga0007748_11622231	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514	Open in IMG/M
3300004795\|Ga0007756_11550842	Not Available	657	Open in IMG/M
3300005416\|Ga0068880_1363437	Not Available	524	Open in IMG/M
3300005418\|Ga0068881_1464275	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1311	Open in IMG/M
3300005527\|Ga0068876_10624416	Not Available	582	Open in IMG/M
3300005528\|Ga0068872_10509843	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	645	Open in IMG/M
3300005580\|Ga0049083_10149582	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	801	Open in IMG/M
3300005581\|Ga0049081_10112303	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1012	Open in IMG/M
3300005581\|Ga0049081_10180655	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763	Open in IMG/M
3300005582\|Ga0049080_10036740	Not Available	1702	Open in IMG/M
3300005582\|Ga0049080_10312333	Not Available	506	Open in IMG/M
3300005662\|Ga0078894_10540960	All Organisms → cellular organisms → Bacteria	1042	Open in IMG/M
3300005662\|Ga0078894_10605863	Not Available	975	Open in IMG/M
3300005662\|Ga0078894_11514350	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	556	Open in IMG/M
3300005805\|Ga0079957_1038028	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3088	Open in IMG/M
3300005941\|Ga0070743_10131059	Not Available	836	Open in IMG/M
3300006875\|Ga0075473_10067433	All Organisms → Viruses → Predicted Viral	1396	Open in IMG/M
3300007212\|Ga0103958_1032861	All Organisms → Viruses → Predicted Viral	3190	Open in IMG/M
3300007363\|Ga0075458_10066957	All Organisms → Viruses → Predicted Viral	1124	Open in IMG/M
3300007545\|Ga0102873_1221374	Not Available	568	Open in IMG/M
3300007546\|Ga0102874_1072365	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1101	Open in IMG/M
3300007547\|Ga0102875_1074046	Not Available	1100	Open in IMG/M
3300007549\|Ga0102879_1024260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	2009	Open in IMG/M
3300007559\|Ga0102828_1070042	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acMicro-4	832	Open in IMG/M
3300007600\|Ga0102920_1299099	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	518	Open in IMG/M
3300007603\|Ga0102921_1012799	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	3112	Open in IMG/M
3300007658\|Ga0102898_1138784	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	569	Open in IMG/M
3300007708\|Ga0102859_1161959	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	659	Open in IMG/M
3300007974\|Ga0105747_1176408	Not Available	698	Open in IMG/M
3300007974\|Ga0105747_1261919	Not Available	580	Open in IMG/M
3300008055\|Ga0108970_11678772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	1099	Open in IMG/M
3300008107\|Ga0114340_1076469	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1394	Open in IMG/M
3300008107\|Ga0114340_1174978	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	758	Open in IMG/M
3300008107\|Ga0114340_1244140	Not Available	555	Open in IMG/M
3300008108\|Ga0114341_10499247	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	550	Open in IMG/M
3300008110\|Ga0114343_1054626	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2911	Open in IMG/M
3300008110\|Ga0114343_1099513	Not Available	1009	Open in IMG/M
3300008111\|Ga0114344_1041697	All Organisms → Viruses → Predicted Viral	3122	Open in IMG/M
3300008113\|Ga0114346_1096245	All Organisms → cellular organisms → Bacteria	1366	Open in IMG/M
3300008113\|Ga0114346_1231615	Not Available	706	Open in IMG/M
3300008114\|Ga0114347_1044257	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3019	Open in IMG/M
3300008116\|Ga0114350_1166829	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	587	Open in IMG/M
3300008117\|Ga0114351_1314197	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	731	Open in IMG/M
3300008259\|Ga0114841_1053945	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5722	Open in IMG/M
3300008261\|Ga0114336_1046931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	2262	Open in IMG/M
3300008450\|Ga0114880_1110726	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1046	Open in IMG/M
3300008957\|Ga0104239_1022766	Not Available	546	Open in IMG/M
3300008996\|Ga0102831_1004145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	5607	Open in IMG/M
3300008996\|Ga0102831_1195436	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	669	Open in IMG/M
3300008999\|Ga0102816_1179726	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	659	Open in IMG/M
3300009085\|Ga0105103_10880310	Not Available	524	Open in IMG/M
3300009154\|Ga0114963_10239785	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1032	Open in IMG/M
3300009155\|Ga0114968_10008448	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7511	Open in IMG/M
3300009155\|Ga0114968_10087785	All Organisms → Viruses → Predicted Viral	1920	Open in IMG/M
3300009158\|Ga0114977_10256887	All Organisms → Viruses → Predicted Viral	1007	Open in IMG/M
3300009158\|Ga0114977_10689257	Not Available	544	Open in IMG/M
3300009159\|Ga0114978_10208060	Not Available	1233	Open in IMG/M
3300009160\|Ga0114981_10664811	Not Available	552	Open in IMG/M
3300009161\|Ga0114966_10213517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	1213	Open in IMG/M
3300009161\|Ga0114966_10219324	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1192	Open in IMG/M
3300009163\|Ga0114970_10662500	Not Available	557	Open in IMG/M
3300009163\|Ga0114970_10725344	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	527	Open in IMG/M
3300009164\|Ga0114975_10082160	All Organisms → Viruses → Predicted Viral	1874	Open in IMG/M
3300009164\|Ga0114975_10172595	Not Available	1230	Open in IMG/M
3300009164\|Ga0114975_10419496	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	728	Open in IMG/M
3300009165\|Ga0105102_10054294	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1771	Open in IMG/M
3300009165\|Ga0105102_10792079	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	539	Open in IMG/M
3300009180\|Ga0114979_10531612	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	677	Open in IMG/M
3300009180\|Ga0114979_10739698	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	554	Open in IMG/M
3300009183\|Ga0114974_10300366	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	945	Open in IMG/M
3300009183\|Ga0114974_10431968	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	749	Open in IMG/M
3300009183\|Ga0114974_10459520	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	720	Open in IMG/M
3300009183\|Ga0114974_10477514	Not Available	702	Open in IMG/M
3300009184\|Ga0114976_10263978	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	930	Open in IMG/M
3300009684\|Ga0114958_10343767	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	726	Open in IMG/M
3300010157\|Ga0114964_10321593	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	733	Open in IMG/M
3300010158\|Ga0114960_10105298	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1565	Open in IMG/M
3300010374\|Ga0114986_1070662	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	630	Open in IMG/M
3300010885\|Ga0133913_10182706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	5596	Open in IMG/M
3300010885\|Ga0133913_10233162	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4894	Open in IMG/M
3300010885\|Ga0133913_10343334	Not Available	3951	Open in IMG/M
3300010885\|Ga0133913_11429502	All Organisms → Viruses → Predicted Viral	1757	Open in IMG/M
3300010885\|Ga0133913_11877999	All Organisms → Viruses → Predicted Viral	1495	Open in IMG/M
3300010885\|Ga0133913_12016892	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1432	Open in IMG/M
3300010885\|Ga0133913_12478503	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1265	Open in IMG/M
3300010885\|Ga0133913_12840116	Not Available	1164	Open in IMG/M
3300011268\|Ga0151620_1023573	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2129	Open in IMG/M
3300012000\|Ga0119951_1027999	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1883	Open in IMG/M
3300012000\|Ga0119951_1083319	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	802	Open in IMG/M
3300012012\|Ga0153799_1058932	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	700	Open in IMG/M
3300012352\|Ga0157138_1007230	Not Available	1850	Open in IMG/M
3300012666\|Ga0157498_1026865	All Organisms → cellular organisms → Bacteria	893	Open in IMG/M
3300012710\|Ga0157550_1232740	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300013004\|Ga0164293_10696931	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	651	Open in IMG/M
3300013004\|Ga0164293_10977481	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	530	Open in IMG/M
3300013014\|Ga0164295_10215636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1435	Open in IMG/M
3300013295\|Ga0170791_10942721	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	556	Open in IMG/M
3300013372\|Ga0177922_11033742	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	928	Open in IMG/M
3300014050\|Ga0119952_1027747	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1776	Open in IMG/M
3300017722\|Ga0181347_1006432	All Organisms → Viruses → Predicted Viral	3875	Open in IMG/M
3300017736\|Ga0181365_1066480	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	892	Open in IMG/M
3300017761\|Ga0181356_1013255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	3106	Open in IMG/M
3300017777\|Ga0181357_1071305	All Organisms → Viruses → Predicted Viral	1336	Open in IMG/M
3300017784\|Ga0181348_1048881	All Organisms → Viruses → Predicted Viral	1735	Open in IMG/M
3300017785\|Ga0181355_1117161	All Organisms → Viruses → Predicted Viral	1092	Open in IMG/M
3300019784\|Ga0181359_1246993	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	544	Open in IMG/M
3300020048\|Ga0207193_1450278	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	855	Open in IMG/M
3300020074\|Ga0194113_10136534	Not Available	2064	Open in IMG/M
3300020160\|Ga0211733_10461238	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1558	Open in IMG/M
3300020172\|Ga0211729_10794317	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	748	Open in IMG/M
3300020172\|Ga0211729_10973126	Not Available	731	Open in IMG/M
3300020172\|Ga0211729_11396790	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1039	Open in IMG/M
3300021961\|Ga0222714_10014807	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6369	Open in IMG/M
3300021963\|Ga0222712_10357907	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	898	Open in IMG/M
3300021963\|Ga0222712_10770094	Not Available	534	Open in IMG/M
3300023179\|Ga0214923_10063963	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2690	Open in IMG/M
3300023184\|Ga0214919_10003921	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	22074	Open in IMG/M
3300024343\|Ga0244777_10412385	Not Available	840	Open in IMG/M
3300024346\|Ga0244775_11008816	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	656	Open in IMG/M
3300024346\|Ga0244775_11161920	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	603	Open in IMG/M
3300025848\|Ga0208005_1000073	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	40181	Open in IMG/M
3300026569\|Ga0255277_1108741	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	692	Open in IMG/M
3300027129\|Ga0255067_1058556	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	550	Open in IMG/M
3300027133\|Ga0255070_1054542	Not Available	616	Open in IMG/M
3300027139\|Ga0255082_1036995	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	779	Open in IMG/M
3300027140\|Ga0255080_1035351	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	789	Open in IMG/M
3300027418\|Ga0208022_1097075	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	611	Open in IMG/M
3300027418\|Ga0208022_1100640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium	596	Open in IMG/M
3300027493\|Ga0255103_1074365	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	570	Open in IMG/M
3300027581\|Ga0209651_1109122	Not Available	774	Open in IMG/M
3300027644\|Ga0209356_1020124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	2262	Open in IMG/M
3300027659\|Ga0208975_1084972	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	933	Open in IMG/M
3300027659\|Ga0208975_1123726	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	736	Open in IMG/M
3300027688\|Ga0209553_1281211	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	511	Open in IMG/M
3300027710\|Ga0209599_10163696	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	594	Open in IMG/M
3300027734\|Ga0209087_1007924	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5563	Open in IMG/M
3300027734\|Ga0209087_1024644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	2926	Open in IMG/M
3300027734\|Ga0209087_1099327	Not Available	1236	Open in IMG/M
3300027734\|Ga0209087_1193993	Not Available	783	Open in IMG/M
3300027741\|Ga0209085_1027883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2688	Open in IMG/M
3300027744\|Ga0209355_1163273	Not Available	942	Open in IMG/M
3300027753\|Ga0208305_10181034	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763	Open in IMG/M
3300027759\|Ga0209296_1052612	All Organisms → Viruses → Predicted Viral	2115	Open in IMG/M
3300027759\|Ga0209296_1055424	Not Available	2046	Open in IMG/M
3300027759\|Ga0209296_1252629	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	724	Open in IMG/M
3300027782\|Ga0209500_10384543	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	569	Open in IMG/M
3300027785\|Ga0209246_10141694	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	945	Open in IMG/M
3300027793\|Ga0209972_10429573	Not Available	555	Open in IMG/M
3300027793\|Ga0209972_10500098	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	500	Open in IMG/M
3300027805\|Ga0209229_10375800	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	619	Open in IMG/M
3300027963\|Ga0209400_1382854	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	511	Open in IMG/M
3300027969\|Ga0209191_1094315	Not Available	1284	Open in IMG/M
3300027969\|Ga0209191_1237385	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	700	Open in IMG/M
3300027974\|Ga0209299_1005053	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6687	Open in IMG/M
3300028025\|Ga0247723_1035892	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1516	Open in IMG/M
3300028025\|Ga0247723_1062924	Not Available	1020	Open in IMG/M
3300028025\|Ga0247723_1106000	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	703	Open in IMG/M
3300028025\|Ga0247723_1113999	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	667	Open in IMG/M
3300028025\|Ga0247723_1116667	Not Available	656	Open in IMG/M
3300028286\|Ga0256331_1138879	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	549	Open in IMG/M
3300031857\|Ga0315909_10052648	All Organisms → Viruses → Predicted Viral	3754	Open in IMG/M
3300031857\|Ga0315909_10297663	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1208	Open in IMG/M
3300031885\|Ga0315285_10240727	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1406	Open in IMG/M
3300031951\|Ga0315904_10489644	Not Available	1088	Open in IMG/M
3300031952\|Ga0315294_10436729	All Organisms → Viruses → Predicted Viral	1214	Open in IMG/M
3300031952\|Ga0315294_10996157	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	699	Open in IMG/M
3300032050\|Ga0315906_10041422	Not Available	4879	Open in IMG/M
3300032050\|Ga0315906_11208966	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	547	Open in IMG/M
3300032053\|Ga0315284_10556227	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1379	Open in IMG/M
3300032053\|Ga0315284_11705291	Not Available	656	Open in IMG/M
3300032092\|Ga0315905_10040337	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4743	Open in IMG/M
3300032093\|Ga0315902_11050403	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	605	Open in IMG/M
3300032116\|Ga0315903_10116184	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2522	Open in IMG/M
3300032116\|Ga0315903_10444513	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1041	Open in IMG/M
3300032116\|Ga0315903_10625849	Not Available	821	Open in IMG/M
3300033992\|Ga0334992_0515311	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	516	Open in IMG/M
3300034020\|Ga0335002_0151539	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1501	Open in IMG/M
3300034050\|Ga0335023_0221829	Not Available	1050	Open in IMG/M
3300034061\|Ga0334987_0085311	All Organisms → Viruses → Predicted Viral	2476	Open in IMG/M
3300034061\|Ga0334987_0137375	All Organisms → Viruses → Predicted Viral	1811	Open in IMG/M
3300034061\|Ga0334987_0265258	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1161	Open in IMG/M
3300034061\|Ga0334987_0509920	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	731	Open in IMG/M
3300034061\|Ga0334987_0698025	Not Available	582	Open in IMG/M
3300034066\|Ga0335019_0201133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium	1289	Open in IMG/M
3300034092\|Ga0335010_0269635	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	994	Open in IMG/M
3300034093\|Ga0335012_0066942	All Organisms → Viruses → Predicted Viral	2049	Open in IMG/M
3300034095\|Ga0335022_0607935	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	551	Open in IMG/M
3300034101\|Ga0335027_0196008	All Organisms → Viruses → Predicted Viral	1439	Open in IMG/M
3300034101\|Ga0335027_0592675	Not Available	676	Open in IMG/M
3300034102\|Ga0335029_0224814	Not Available	1229	Open in IMG/M
3300034104\|Ga0335031_0517363	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	722	Open in IMG/M
3300034106\|Ga0335036_0349706	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	966	Open in IMG/M
3300034109\|Ga0335051_0288769	Not Available	798	Open in IMG/M
3300034110\|Ga0335055_0029348	Not Available	2561	Open in IMG/M
3300034116\|Ga0335068_0241706	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	926	Open in IMG/M
3300034117\|Ga0335033_0346257	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	747	Open in IMG/M
3300034200\|Ga0335065_0452699	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	777	Open in IMG/M
3300034200\|Ga0335065_0568519	Not Available	667	Open in IMG/M
3300034272\|Ga0335049_0385840	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	922	Open in IMG/M
3300034283\|Ga0335007_0029487	Not Available	4311	Open in IMG/M
3300034283\|Ga0335007_0077353	All Organisms → Viruses → Predicted Viral	2509	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.53%
Host-Associated	Host-Associated	0.47%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	96.21%
Terrestrial	Environmental → Terrestrial	3.32%
Plants	Host-Associated → Plants	0.47%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	82.46%
Marine	Environmental → Aquatic → Marine	13.74%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	3.32%
Leaf	Host-Associated → Plants → Leaf	0.47%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	53.55%
Lentic	Environmental → Aquatic → Freshwater → Lentic	18.48%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	7.58%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.74%
River	Environmental → Aquatic → Freshwater → River	3.32%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	3.32%
Coastal	Environmental → Aquatic → Marine → Coastal	2.84%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.84%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.42%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.95%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	0.47%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	50.71%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	17.06%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	7.58%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.74%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	3.32%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	3.32%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.84%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	2.84%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.84%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.42%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.42%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.95%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	0.47%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	21.33%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	15.17%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	12.32%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	7.58%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	6.64%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.21%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.74%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.32%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	3.32%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.37%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	2.37%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.42%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.42%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.42%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.42%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	1.42%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.42%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.95%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.95%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.95%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.47%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.47%
Freshwater, Surface Ice	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice	0.47%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.47%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.47%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.47%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	0.47%
Freshwater And Marine	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine	0.47%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.47%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000929	Marine plume microbial communities from the Columbia River - 15 PSU	Environmental	Open in IMG/M
3300002351	Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003491	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD	Environmental	Open in IMG/M
3300003616	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN	Environmental	Open in IMG/M
3300004448	Marine viral communities from Newfoundland, Canada BC-1	Environmental	Open in IMG/M
3300004769	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004795	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005416	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005418	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300005941	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697	Environmental	Open in IMG/M
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental	Open in IMG/M
3300007212	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects	Environmental	Open in IMG/M
3300007363	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA	Environmental	Open in IMG/M
3300007545	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3	Environmental	Open in IMG/M
3300007546	Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02	Environmental	Open in IMG/M
3300007547	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02	Environmental	Open in IMG/M
3300007549	Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007600	Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3	Environmental	Open in IMG/M
3300007603	Estuarine microbial communities from the Columbia River estuary - metaG 1568-02	Environmental	Open in IMG/M
3300007658	Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008117	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300008957	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT2	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300008999	Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009684	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010374	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011268	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555	Environmental	Open in IMG/M
3300012000	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012352	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37	Environmental	Open in IMG/M
3300012666	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2	Environmental	Open in IMG/M
3300012710	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013014	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG	Environmental	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014050	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300025848	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300026569	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027129	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h	Environmental	Open in IMG/M
3300027133	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h	Environmental	Open in IMG/M
3300027139	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h	Environmental	Open in IMG/M
3300027140	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h	Environmental	Open in IMG/M
3300027418	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)	Environmental	Open in IMG/M
3300027493	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h	Environmental	Open in IMG/M
3300027581	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)	Environmental	Open in IMG/M
3300027644	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027688	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027744	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)	Environmental	Open in IMG/M
3300027753	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027974	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028286	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300034020	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055	Environmental	Open in IMG/M
3300034050	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034109	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158	Environmental	Open in IMG/M
3300034110	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M
3300034117	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
NpDRAFT_102092422	3300000929	Freshwater And Marine	LGMFIAWVVLDGSAKTVVGYAIIGTLIAWAVTYPLRNPKDEE*
B570J29582_10213191	3300002351	Freshwater	LGMFIAWVVLDGSAKTIVGYGIMATTTLWILTSPIRNKEE*
B570J29032_1096768014	3300002408	Freshwater	LGMFIAWVVLDGSAKTIVGYGIIATTALWILTSPARNKEE*
B570J29032_1098587097	3300002408	Freshwater	VVLDGSAKTIVGYGIMATTALWVLTSPIRNKEDK*
B570J40625_1001485061	3300002835	Freshwater	GMFVAWVVLDGSAKTVVGYAIVVTTLLWVVTYKARNPKDDDGNI*
B570J40625_1003807851	3300002835	Freshwater	MFVAWLVLDGSAKTVTGYAIILCTAFWAITYPIRNPKDDE*
JGI25924J51412_10473002	3300003491	Freshwater Lake	MDPQKQWVVLDGSAKTVVGYAIIGTLVAWAVTYPLRNPKDEE*
JGI25928J51866_11344301	3300003616	Freshwater Lake	VLGMFIAWVVLDGSAKTVVGYAIIGTLIAWAITYRLRNPKDDNE*
Ga0065861_10527013	3300004448	Marine	LGMFIAWVVLDGSAKTIVGYAIVGTLFAWAVTYPIRNPKDEE*
Ga0007748_116222311	3300004769	Freshwater Lake	LGMFIAWVVLTGSAKTVVGYAIIGTLIIWAVTYHLRNPKDE*
Ga0007756_115508423	3300004795	Freshwater Lake	TLLGMFIAWVVLDGSAKTIVGYGIMATTALWIITSPIRNRNSE*
Ga0068880_13634372	3300005416	Freshwater Lake	MFIAWVVLDGSAKTVVGYAILFSLGAWAITYPIRNPKEED*
Ga0068881_14642751	3300005418	Freshwater Lake	LGMFIAWVVLDGSAKTVVGYAIVGTLLAWAITYPLRNPKDEE*
Ga0068876_106244161	3300005527	Freshwater Lake	AWLVLDGSAKTIVGYAIIFAMVVWWATYPLRNARDDDE*
Ga0068872_105098431	3300005528	Freshwater Lake	WVVLEGSAKTVVGYAIIATLAVWSITLNIRNMKDE*
Ga0049083_101495823	3300005580	Freshwater Lentic	MFIAWVVLDGSAKDIVGYGIIATTALWIATSPIRNRNSE*
Ga0049081_101123034	3300005581	Freshwater Lentic	LGMFIAWVVLEGSAKTIVGYAIGISLIIWIVTLNLRNLKDE*
Ga0049081_101806553	3300005581	Freshwater Lentic	IAWVVLDGSAKTVVGYAIIGTLAAWAITINIRNMKDE*
Ga0049080_100367403	3300005582	Freshwater Lentic	MFIAWLVLDGSAKTVVGYAIIFAMTVWWATYPIRNSRDDDE*
Ga0049080_103123331	3300005582	Freshwater Lentic	MFIAWVVLDGSAKTVVGYAIAGTLIAWAITYPLRNPKDDD*
Ga0078894_105409601	3300005662	Freshwater Lake	WVVLDGSAKTVVGYAIMATIFAWAVTYPLRNPKDEE*
Ga0078894_106058634	3300005662	Freshwater Lake	GMFIAWVVLDGSAKTIVGYAIIGTLVAWAITYPLRNREDD*
Ga0078894_115143501	3300005662	Freshwater Lake	AWVVLDGSAKTIVGYGIMATTALWIITSPIRNRED*
Ga0079957_10380282	3300005805	Lake	MFIAWVVLDGSAKTIVGYAIVGTLVAWAVTYPLRNPKDEE*
Ga0070743_101310594	3300005941	Estuarine	TLLGMFIAWVVLDGSAKTIVGYAIICTLIAWAVTYPIRNREDK*
Ga0075473_100674331	3300006875	Aqueous	VLDGSAKTVVGYAIAGTLVAWAVTYPLRNPKDEE*
Ga0103958_10328614	3300007212	Freshwater Lake	MFVAWIVLDGSAKDVVGYAIIGTTALWAVTYPLRNPKDEE*
Ga0075458_100669573	3300007363	Aqueous	MFIAWVVLDGSAKTVVGYAIAGTLVAWAVTYPLRNPKDEE*
Ga0102873_12213743	3300007545	Estuarine	VLDGSAKTIVGYAIIGTLIAWAITYPIRNRDDDE*
Ga0102874_10723654	3300007546	Estuarine	FIAWVVLDGSAKTIVGYGIIATTALWILTSPIRNREE*
Ga0102875_10740464	3300007547	Estuarine	GMFIAWVVLDGSAKTIVGYAIIGTLIAWAITYPIRNRDDDE*
Ga0102879_10242609	3300007549	Estuarine	GMFIAWVVLDGSAKTIVGYGIIATTALWIITSPIRNRNEE*
Ga0102828_10700421	3300007559	Estuarine	MFIAWVVLDGSAKTVVGYAIAGTLVAWAITYPLRNPKDEE*
Ga0102920_12990993	3300007600	Estuarine	GMFIAWVVLDGSAKTIVGYAIICTLIAWAITYPIRNRDDE*
Ga0102921_10127991	3300007603	Estuarine	FIAWVVLDGSAKTIVGYAIICTLIAWAITYPIRNRDDE*
Ga0102898_11387841	3300007658	Estuarine	FIAWVVLDGSAKTIVGYAIICTLIAWAITYPIRNREDD*
Ga0102859_11619591	3300007708	Estuarine	MFIAWVVLDGSAKTVVGYAIIGTLFAWAVTYPLRNPK
Ga0105747_11764082	3300007974	Estuary Water	MFIAWVVLDGSAKTIVGWSIIGTLVAWAVTYPIRHREDES*
Ga0105747_12619191	3300007974	Estuary Water	IAWVVLDGSAKTVVGYAIIGTLIVWAITYSIRHKDEE*
Ga0108970_116787726	3300008055	Estuary	WVVLDGSAKTIVGYAIICTLIAWAVTYPIRNREDK*
Ga0114340_10764695	3300008107	Freshwater, Plankton	MFVAWVVLDGSAKTVVGYAIVVTTLVWVVTYKARNPKDDDGNI*
Ga0114340_11749781	3300008107	Freshwater, Plankton	MFIAWVVLDGSAKTVVGYGIIATTALWIITSPIRNRDSE*
Ga0114340_12441402	3300008107	Freshwater, Plankton	MFVAWIVLDGSAKTVVGYAILWSIVVWLLTYPIRNPKDQED*
Ga0114341_104992471	3300008108	Freshwater, Plankton	FIAWVVLEGSAKTVVGYAIILSLIVWSITFKLRQDEDE*
Ga0114343_10546261	3300008110	Freshwater, Plankton	MFIAWVVLDGSAKTVVGYAIVGTIVAWMITYPIRNREED*
Ga0114343_10995131	3300008110	Freshwater, Plankton	AWVVLDGSAKTVVGYGIMLTMTTWILSYPIRNREED*
Ga0114344_10416974	3300008111	Freshwater, Plankton	MFIAWVVLEGSAKTVVGYAIFGSTIIWAVTYNLRNPKDE*
Ga0114346_10962452	3300008113	Freshwater, Plankton	MFIAWLVLDGSAKTVVGYAIVFSMVVWWATYPIRNARDDE*
Ga0114346_12316152	3300008113	Freshwater, Plankton	MFIAWLVLDGSAKTVVGWAIVFSMVVWWATYPIRNARDDE*
Ga0114347_10442575	3300008114	Freshwater, Plankton	MFIAWVVLEGSAKTIVGYAIGISLIIWIVTLNLRNLKDE*
Ga0114350_11668291	3300008116	Freshwater, Plankton	WVVLEGSAKAVVGYFIVITFVAHAVTFRLRNPKE*
Ga0114351_13141973	3300008117	Freshwater, Plankton	VVLDGSAKTVVGYAIVGTFVAWAVTYPLRNPKEE*
Ga0114841_10539459	3300008259	Freshwater, Plankton	MFIAWVVLEGSAKTVVGYAIGISLIIWIVTLNLRNLKDE*
Ga0114336_10469311	3300008261	Freshwater, Plankton	AWVVLDGSAKTIVGYGIMATTALWIITSPIRNRNED*
Ga0114880_11107264	3300008450	Freshwater Lake	WVVLEGSAKTVVGYAIIVTLVVWAVTLNIRNMKDE*
Ga0104239_10227661	3300008957	Freshwater	FIAWVVLDGSAKNVVGYAILGTIAIWAITYPLRNREEE*
Ga0102831_10041451	3300008996	Estuarine	LGMFIAWVVLDGSAKTIVGYAIICTLIAWAVTYPIRNREDK*
Ga0102831_11954363	3300008996	Estuarine	WVVLDGSAKTIVGYGIMATTALWIITSPIRNRED*
Ga0102816_11797262	3300008999	Estuarine	MFIAWVVLDGSAKTIVGYAIICTLIAWAITYPIRNREDK*
Ga0105103_108803102	3300009085	Freshwater Sediment	MFIAWVVLDGSAKDVVGYAIVGTLIAWAVTYRLRNPKDEE*
Ga0114963_102397853	3300009154	Freshwater Lake	MFIAWVVLDGSAKTIVGYAIIGTLIAWAITYPLRNPKDDE*
Ga0114968_100084489	3300009155	Freshwater Lake	MFIAWVVLTGSAKTVVGYAIILTLIVWAVTYPLRNSNDE*
Ga0114968_100877852	3300009155	Freshwater Lake	MFIAWVVLTGSAKTVVGYAIILTLVVWAVTYPLRNGGNE*
Ga0114977_102568872	3300009158	Freshwater Lake	MFIAWVVLTGSAKTVVGYAIVLTLIVWAVTYPLRNGGDE*
Ga0114977_106892571	3300009158	Freshwater Lake	LLGMFIAWVVLDGSAKTIVGYGIIATMVLWILTGPIRNREE*
Ga0114978_102080604	3300009159	Freshwater Lake	LIAWVVLDGSAKVVVGYGIFATPILWTLTSPIRNREE*
Ga0114981_106648112	3300009160	Freshwater Lake	LLGMFIAWVVLDGSAKTIVGYGIIATTTLWILTSPIRNREE*
Ga0114966_102135171	3300009161	Freshwater Lake	MFIAWVVLDGSAKTIVGYAIICTLIAWAVTYPIRNRDDD*
Ga0114966_102193244	3300009161	Freshwater Lake	GMFIAWVVLDGSAKTIVGYAIIGTLIAWAVTYPLRNRED*
Ga0114970_106625003	3300009163	Freshwater Lake	GMFIAWVVLDGSAKTVVGYAIWGTMFLWAVTYRFRNPKDEE*
Ga0114970_107253443	3300009163	Freshwater Lake	GMFIAWVVLDGSAKTIVGYAIVGTLVMWAITYPLRNRE*
Ga0114975_100821606	3300009164	Freshwater Lake	LGMFIAWVVLDGSAKTVVGYAITGTLVGWAVTYRLRNPKDE*
Ga0114975_101725954	3300009164	Freshwater Lake	GMFIAWVVLDGSAKVVVGYGIFATTIIWILTSPIRNREE*
Ga0114975_104194961	3300009164	Freshwater Lake	MFIAWVVLDGSAKTIVGYAIICTLVAWAVTYPIRNREDK*
Ga0105102_100542945	3300009165	Freshwater Sediment	VAWVVLDGSAKTVVGYAIVVTTLLWVVTYKARNPKDE*
Ga0105102_107920793	3300009165	Freshwater Sediment	GMFIAWVVLEGSAKTVVGYAIIICLIVWVTTFSIRNLGDDE*
Ga0114979_105316122	3300009180	Freshwater Lake	MFIAWVVLDGSAKTVVGYAIGGTLICWAITYPLRNPKDE*
Ga0114979_107396983	3300009180	Freshwater Lake	AYVVLDGSAKQIVGVAIMATMFAWAITYPIRNKDWKDDE*
Ga0114974_103003663	3300009183	Freshwater Lake	LGMFIAWVVLDGSAKQVVGVAIFATLFFWAVTYPIRNPMDKDE*
Ga0114974_104319681	3300009183	Freshwater Lake	LLGMFIAWVVLDGSAKTVVGYAIVGTLVAWAVTYPLRNPKDEE*
Ga0114974_104595202	3300009183	Freshwater Lake	MFIAWVVLTGSAKTVVGYAIVLTLIVWAVTYRLRNPKEDDE*
Ga0114974_104775141	3300009183	Freshwater Lake	GMFIAWVVLDGSAKTIVGYGIIATMVLWILTGPIRNREE*
Ga0114976_102639783	3300009184	Freshwater Lake	AWVVLDGSAKQVVGVAIFATLFFWAVTYPIRNPMDKDE*
Ga0114958_103437672	3300009684	Freshwater Lake	MFIAWVVLDGSAKTVVGYAIVCTLFAWAITYPLRNPKDEE*
Ga0114964_103215931	3300010157	Freshwater Lake	VVLDGSAKTIVGYAIIGTLLAWAITYPIRNPKDEE*
Ga0114960_101052983	3300010158	Freshwater Lake	MGIAWVVLDGSAKTVVGYAIVGTLVVWAITYPLRNPRDE*
Ga0114986_10706621	3300010374	Deep Subsurface	LGMFIAWVVLDGSAKTVVGYAIVGTLLAWAVTYPLRNPKDDE*
Ga0133913_101827061	3300010885	Freshwater Lake	TLLGMFIAWVVLDGSAKTIVGYAIICTLIAWAITYPIRNRDDE*
Ga0133913_1023316210	3300010885	Freshwater Lake	TLLGMFIAWVVLDGSAKTIVGYAIASTLVIWAVTYGFRNSGDDE*
Ga0133913_103433342	3300010885	Freshwater Lake	MFIAWVVLDGSAKTIVGYGIMATTALWVITSPIRNRDLE*
Ga0133913_114295022	3300010885	Freshwater Lake	MFIAWVVLTGSAKTVVGYAIILTLVVWAITYQLRNGDNE*
Ga0133913_118779991	3300010885	Freshwater Lake	LGMFVAWVVLDGSAKTVVGYAIGVTTLIWVVTYRARNPKDEDGNI*
Ga0133913_120168921	3300010885	Freshwater Lake	MFIAWVVLDGSAKTIVGYAIVGTLIAWAVTYPLRNRED*
Ga0133913_124785033	3300010885	Freshwater Lake	WVVLDGSAKTVVGYAIILCSVLWVATFPLRNSEEE*
Ga0133913_128401162	3300010885	Freshwater Lake	MFIAWVVLDGSAKTVVGYAIGGTLIAWAITYPLRNPKDEE*
Ga0151620_10235732	3300011268	Freshwater	MFIAWVVLDGSAKTVVGYAIIGTLFAWAVTYPLRNPKDEE*
Ga0119951_10279991	3300012000	Freshwater	AWVVLDGSAKTIVGYAILATLVAWAITYPLRNRED*
Ga0119951_10833191	3300012000	Freshwater	AWVVLDGSAKTIVGYAIICTLIAWAITYPIRNRED*
Ga0153799_10589323	3300012012	Freshwater	VLDGSAKTVVGYAIVVTTLMWIVTYKARNPKDDDGNI*
Ga0157138_10072301	3300012352	Freshwater	TLLGMFIAWVVLDGSAKTVVGYGIGFTTITWILTYPIRNRED*
Ga0157498_10268653	3300012666	Freshwater, Surface Ice	WTVLGMFIAWVVLDGSAKTVVGYAIIGTLIAWAVTYRLRNPKDENE*
Ga0157550_12327401	3300012710	Freshwater	TVLGMFIAWVVLDGSAKTVVGYAIIGTLIAWAITYRLRNPKDDDE*
Ga0164293_106969313	3300013004	Freshwater	AWVVLDGSAKTVVGYAIAGTLIAWAITYPLRNPKDDE*
Ga0164293_109774813	3300013004	Freshwater	MFIAWVVLDGSAKTVVGYAIVGTLVAWAVTYPLRNPKDEE*
Ga0164295_102156361	3300013014	Freshwater	GMGIAWVVLDGSAKQIVGIAIWGTFLAWCISYPFRNPKDDE*
Ga0170791_109427211	3300013295	Freshwater	WVVLDGSAKTVVGYAIVGTLVAWAVTYPIRNPKDEE*
Ga0177922_110337423	3300013372	Freshwater	VLTGSAKTVVGYAIIGTLIIWAVTYHLRNPKDEQ*
Ga0119952_10277471	3300014050	Freshwater	MFIAWVVLDGSAKTIVGYAIIGTLIAWAITYPIRNPKD
Ga0181347_10064321	3300017722	Freshwater Lake	LGMFIAWVVLDGSAKTVVGYAIAGTLIAWAVTYPLRNGDDK
Ga0181365_10664802	3300017736	Freshwater Lake	MGIAWVVLDGSAKTVVGFAIVGTLGIWAITYPLRNPKDK
Ga0181356_101325511	3300017761	Freshwater Lake	WVVLDGSAKTIVGYAIICTLIAWAVTYPIRNREDK
Ga0181357_10153348	3300017777	Freshwater Lake	MLDQLWTLLGIGIAWVVLDGSAKQIVGIAIWGTFLAWCISYPFRNPKDDE
Ga0181357_10713053	3300017777	Freshwater Lake	MGIAWVVLDGSAKTVVGYAIIGTLAVWAITYPLRNPKDE
Ga0181348_10488811	3300017784	Freshwater Lake	MGIAWVVLDGSAKTVVGYAIIGTLGVWAITYPLRNPKDE
Ga0181355_11171612	3300017785	Freshwater Lake	MGIAWVVLDGSAKTVVGYAIMGTLGVWAITYPLRNPKDE
Ga0181359_12469931	3300019784	Freshwater Lake	LLGMFIAWVVLDGSAKTIVGYAIMGTLVAWAVTYRLRNPKDDE
Ga0207193_14502783	3300020048	Freshwater Lake Sediment	IAWVVLDGSAKTIVGYAIIGTIFAWVVTYPLRNRDE
Ga0194113_101365343	3300020074	Freshwater Lake	MFIAWVVLDGSAKTVVGWATLGTIVLWGITYPLRNKEED
Ga0211733_104612385	3300020160	Freshwater	TLLGMFIAWVVLDGSAKDIVGYGIIATTALWIATSPIRNRNSD
Ga0211729_107943171	3300020172	Freshwater	MFIAWVVLDGSAKDIVGYGIIATTALWIATSPIRNRNSD
Ga0211729_109731261	3300020172	Freshwater	GMFIAWVVLTGSAKTVVGYAIILTLVVWAITYPLRNSNDE
Ga0211729_113967904	3300020172	Freshwater	AWVVLDGSAKDIVGYGIIATTALWIATSPIRNKNSE
Ga0222714_100148074	3300021961	Estuarine Water	MGIAWVVLDGSAKTVVGYAIVGTLLVWAITYPLRNPKDE
Ga0222712_103579071	3300021963	Estuarine Water	VLGMFIAWVVLDGSAKTVVGYAIIGTLIAWSVTYPLRNPKEDD
Ga0222712_107700942	3300021963	Estuarine Water	MFIAWVVLDGSAKTVVGYAIIATLIVWAVTYRLRNPKDDNE
Ga0214923_100639639	3300023179	Freshwater	FIAWVVLDGSAKTIVGYAIIGTLIMWAITYPLRNRE
Ga0214919_1000392131	3300023184	Freshwater	MGIAWVVLDGSAKTVVGYAIVGTLVVWAVTYPLRNPKDE
Ga0244777_104123851	3300024343	Estuarine	IAWVVLDGSAKTVVGYGIIATTAIWILTSPIRNRGEE
Ga0244775_110088161	3300024346	Estuarine	TLLGMFIAWVVLDGSAKDIVGYGIMATTALWIATSPIRNRNSE
Ga0244775_111619203	3300024346	Estuarine	TLLGMGIAWVVLDGSAKQIVGIAIWGTFLAWCISYPIRNPKDDE
Ga0208005_100007357	3300025848	Aqueous	LGMFIAWVVLEGSAKTVVGYAIILSLIVWSITFKLRQDEDE
Ga0255277_11087411	3300026569	Freshwater	LGMFIAWVVLDGSAKTVVGYAIVGTLLAWAITYPLRNPKDEE
Ga0255067_10585561	3300027129	Freshwater	FIAWVVLDGSAKTVVGYAIMGTLVAWAITYPLRNSKE
Ga0255070_10545421	3300027133	Freshwater	LLGMFIAWVVLDGSAKTIVGYAIVATFVVWAITYPLRNPKDDES
Ga0255082_10369951	3300027139	Freshwater	LLGMFIAWVVLDGSAKTVVGYAIVCTLIAWGVTYPIRNKEWDEE
Ga0255080_10353511	3300027140	Freshwater	AWVVLDGSAKTVVGYAIVCTLIAWGVTYPIRNKEWDEE
Ga0208022_10970751	3300027418	Estuarine	IAWVVLDGSAKTIVGYAIIGTLVAWAVTYPLRNPKDEE
Ga0208022_11006401	3300027418	Estuarine	WVVLDGSAKTVVGYAIAGTLIAWAVTYPLRNPKDE
Ga0255103_10743651	3300027493	Freshwater	TLLGMFIAWVVLDGSAKDIVGYGIIATTALWIVTSPIRNRNSE
Ga0209651_11091223	3300027581	Freshwater Lake	FIAWVVLDGSAKTIVGWSIIGTIVVWAVTYPIRHREDES
Ga0209356_10201249	3300027644	Freshwater Lake	AWVVLDGSAKTIVGYAIICTLIAWAVTYPIRNREDK
Ga0208975_10849721	3300027659	Freshwater Lentic	LGMFIAWVVLEGSAKTIVGYAIGISLIIWIVTLNLRNLKDE
Ga0208975_11237261	3300027659	Freshwater Lentic	IAWVVLDGSAKTVVGYAIIGTLAAWAITINIRNMKDE
Ga0209553_12812111	3300027688	Freshwater Lake	VLGMFIAWVVLDGSAKTVVGYAIIGTLIAWAITYRLRNPKDDNE
Ga0209599_101636963	3300027710	Deep Subsurface	LLGMFIAWVVLEGSAKSVVGYAIALSSVIWIITFKLRNPKDE
Ga0209087_10079246	3300027734	Freshwater Lake	MGIAWVVLDGSAKTVVGYAIVGTLALWVVTYPLRNPKDE
Ga0209087_102464411	3300027734	Freshwater Lake	FIAWVVLDGSAKTIVGYAIICTLIAWAITYPIRNREDD
Ga0209087_10993272	3300027734	Freshwater Lake	MGIAWVVLDGSAKTVVGYAIMGTLVVWAITYPLRNPKGE
Ga0209087_11939931	3300027734	Freshwater Lake	VLDGSAKTVVGYAIIFAMIVWWATYPIRNARDDDDE
Ga0209085_10278833	3300027741	Freshwater Lake	MGIAWVVLDGSAKTVVGYAIVGTLVVWAITYPLRNPRDE
Ga0209355_11632733	3300027744	Freshwater Lake	AWVVLTGSAKTVVGYAIIGTLIIWAVTYHLRNPKDE
Ga0208305_101810343	3300027753	Estuarine	VVLDGSAKTVVGYAIMATLFAWAVTYPLRNPKDEE
Ga0209296_10526124	3300027759	Freshwater Lake	MFIAWVVLTGSAKTVVGYAIVLTLIVWAVTYPLRNGGDE
Ga0209296_10554246	3300027759	Freshwater Lake	LLGMFIAWVVLDGSAKTIVGYGIIATMVLWILTGPIRNREE
Ga0209296_12526292	3300027759	Freshwater Lake	FIAWVVLDGSAKTVVGYAIVGTLVAWAVTYPLRNPKDEE
Ga0209500_103845431	3300027782	Freshwater Lake	LLGMFVAWVVLEGSAKTVVGYAIIVTSVLWVVSYKARNPKDE
Ga0209246_101416942	3300027785	Freshwater Lake	MFIAWVVLDGSAKTIVGYAIIGTLAVWAITINIRNMKDE
Ga0209972_104295732	3300027793	Freshwater Lake	MELLGMFIAWVVLEGSAKTVVGYAIILSLIVWSITFKLRQDEDE
Ga0209972_105000981	3300027793	Freshwater Lake	WVVLEGSAKTVVGYAIIATLAVWSITLNIRNMKDE
Ga0209229_103758001	3300027805	Freshwater And Sediment	VLDGSAKQVVGVAIFATLFFWAVTYPIRNPLDKDE
Ga0209400_13828542	3300027963	Freshwater Lake	MFIAWVVLTGSAKTVVGYAIILTLVVWAVTYPLRNGGNE
Ga0209191_10943151	3300027969	Freshwater Lake	VAWLVLDGSAKTITGYAIIATSAFWICTYPLRNPKDDEDTEG
Ga0209191_12373854	3300027969	Freshwater Lake	GMFIAWVVLDGSAKTIVGYAIICTLVAWAVTYPIRNREDK
Ga0209299_10050533	3300027974	Freshwater Lake	MFVAWVVLDGSAKTVVGYAIVFTMVMWSATYWLRNPKDDE
Ga0247723_10358921	3300028025	Deep Subsurface Sediment	LLGMFVAYVVLEGSAKEVIGWCIIGTLGLWIVTYPLRKPSDSNQDSE
Ga0247723_10629241	3300028025	Deep Subsurface Sediment	AWVVLDGSAKTIVGYGIVATTALWIITSPFRNKEE
Ga0247723_11060003	3300028025	Deep Subsurface Sediment	TLLGMFIAWVVLDGSAKTIVGYAIMGTLAAWAITYPLRNPKDDE
Ga0247723_11139993	3300028025	Deep Subsurface Sediment	LGMFIAWVVLDGSAKSVVGYFIVITFVAHVATYRLRNPKE
Ga0247723_11166671	3300028025	Deep Subsurface Sediment	LGMFIAWVVLDGSAKTIVGYGIMATTTLWIITSPIRNREEG
Ga0256331_11388793	3300028286	Freshwater	LLGMFIAWIVLDGSAKTVVGWATLGTLIAWIVTYPLRNRED
Ga0315909_100526481	3300031857	Freshwater	AWVVLEGSAKTVVGYAIIATLAVWSITLNIRNMKDE
Ga0315909_102976634	3300031857	Freshwater	LDGSAKTVVGYAIVVTTLLWVVSYKARNLKDDDENI
Ga0315285_102407272	3300031885	Sediment	MFIAWVVLDGSAKTVVGYAIAASLVVWIITFRLRNTEDE
Ga0315904_104896442	3300031951	Freshwater	MFIAWVVLDGSAKSVVGWATVGTIVLWGITYPLRNKEED
Ga0315294_104367291	3300031952	Sediment	TVLGMFIAWVVLDGSAKTVVGYAIIGTLIAWAITYRLRNPKDDNE
Ga0315294_109961571	3300031952	Sediment	IAWVVLDGSAKTVVGYAIIGTLIAWAITYRLRNPKDDNE
Ga0315906_100414222	3300032050	Freshwater	MFIAWLVLDGSAKTVVGYAIVFSMVVWWATYPIRNARDDE
Ga0315906_112089661	3300032050	Freshwater	LGMFIAWVVLDGSAKTIVGYAILGTLVAWAVTYPLRNRED
Ga0315284_105562273	3300032053	Sediment	MGIAWVVLDGSAKTVVGFAIVGTLGIWAITYPLRNPKDN
Ga0315284_117052912	3300032053	Sediment	WLVLEGSARQVVGYAIVGTLIVWVVTYPLRKDSDE
Ga0315905_1004033711	3300032092	Freshwater	IAWVVLDGSAKTVVGYAIMATIFAWAVTYPLRNPKDEE
Ga0315902_110504031	3300032093	Freshwater	AWVVLDGSAKTIVGYAILGTLVAWAVTYPLRNRED
Ga0315903_101161841	3300032116	Freshwater	MFIAWVVLDGSAKTIVGYGIIATTALWILTSPARNKDSE
Ga0315903_104445134	3300032116	Freshwater	LLGMFIAWVVLDGSAKTVVGYAIIGTLIAWAVTYPLRKSNDE
Ga0315903_106258493	3300032116	Freshwater	FIAWVVLDGSAKTVVGYAIVGTIVAWTVTYPLRNPKDQED
Ga0334992_0515311_27_149	3300033992	Freshwater	MFIAWVVLDGSAKTVVGYAIIGTLFAWAVTYPLRNPKDED
Ga0335002_0151539_24_146	3300034020	Freshwater	MFIAWVVLDGSAKTVVGYAIIGTLVAWAITYPLRNPKDED
Ga0335023_0221829_915_1031	3300034050	Freshwater	MFIAWVVLDGSAKTIVGYGIMATTTLWILTSPIRNKEE
Ga0334987_0085311_2350_2475	3300034061	Freshwater	LGMFIAWVVLTGSAKTVVGYAIILTLIVWAITYPLRNSNDE
Ga0334987_0137375_1680_1805	3300034061	Freshwater	MFIAWVVLDGSAKTIVGYGIMSTLALWVITSPIRNKEYGDE
Ga0334987_0265258_1022_1141	3300034061	Freshwater	MFIAWVVLEGSAKTIVGYAIMVTLVVWVVTLNIRNMKDE
Ga0334987_0509920_1_114	3300034061	Freshwater	FIAWVVLDGSAKTIVGYGIMATTALWIITSPIRNKEE
Ga0334987_0698025_425_550	3300034061	Freshwater	MFIAWVVLDGSAKTIVGYAIFGTILAWAITYPLRNPKDQEE
Ga0335019_0201133_1_123	3300034066	Freshwater	FIAWVVLDGSAKTVVGYAIVCTLIAWGITYPIRNKEWDEE
Ga0335010_0269635_3_116	3300034092	Freshwater	AWVVLDGSAKTVVGYAIIGTLFAWAVTYPLRNPKDEE
Ga0335012_0066942_1_129	3300034093	Freshwater	LLGMFVAWVVLDGSAKTVVGYAIVVTTLVWVVTYKARNPKDE
Ga0335022_0607935_442_549	3300034095	Freshwater	WVVLDGSAKDIVGYGIIATTALWIATSPIRNRNSE
Ga0335027_0196008_1312_1431	3300034101	Freshwater	MFIAWVVLDGSAKTVVGYAIIGTLIAWAVTYPLRKSNDE
Ga0335027_0592675_105_227	3300034101	Freshwater	MFIAWVVLEGSAKTVVGYAIVLSLVVWGITFNLRNPKDEE
Ga0335029_0224814_3_128	3300034102	Freshwater	FIAYVVLDGSAKQIVGVAIMATMFAWAITYPIRNKDWKDDE
Ga0335031_0517363_2_109	3300034104	Freshwater	WVVLDGSAKTIVGYGIIATTALWVATSPIRNKDSE
Ga0335036_0349706_843_965	3300034106	Freshwater	LGMFIAWIVLDGSAKDVVGVATIATLFAWMVTYPLRNRED
Ga0335051_0288769_10_138	3300034109	Freshwater	MFIAWVVLDGSAKTIVGYGIVATTTLWIITSPFRNKEEEDGN
Ga0335055_0029348_2424_2543	3300034110	Freshwater	MFIAWVVLDGSAKTIVGYGIVATTTLWIITSPFRNKEEE
Ga0335068_0241706_3_122	3300034116	Freshwater	IAWVVLDGSAKTVVGYAIIATLIAWAVTYRLRNPKDDDE
Ga0335033_0346257_602_721	3300034117	Freshwater	MFIAWVVLDGSAKDIVGYGIIATTALWVATSPIRNRNSD
Ga0335065_0452699_629_751	3300034200	Freshwater	MFIAWVVLDGSAKTVVGYAIGGTLIAWAITYPLRNPKEDK
Ga0335065_0568519_23_148	3300034200	Freshwater	MFIAWLVLDGSAKTIVGYAIIFAMVVWWATYPLRNARNDDE
Ga0335049_0385840_774_890	3300034272	Freshwater	MFIAWVVLDGSAKTIVGYGIIATTALWILTSPARNKEE
Ga0335007_0029487_3610_3735	3300034283	Freshwater	MFIAWVVLDGSAKTIVGYAIVGTILAWAITYPLRNPKDQEE
Ga0335007_0077353_1068_1187	3300034283	Freshwater	MFIAWVVLTGSAKTVVGYAIILTLIVWAITYPLRNSNDE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F023052

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences