| Basic Information | |
|---|---|
| Family ID | F022968 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF |
| Number of Associated Samples | 169 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 53.30 % |
| % of genes near scaffold ends (potentially truncated) | 37.74 % |
| % of genes from short scaffolds (< 2000 bps) | 79.25 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.132 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.698 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.698 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 3.77 |
| PF02735 | Ku | 2.36 |
| PF06411 | HdeA | 1.89 |
| PF13847 | Methyltransf_31 | 1.42 |
| PF01494 | FAD_binding_3 | 1.42 |
| PF04392 | ABC_sub_bind | 0.94 |
| PF04952 | AstE_AspA | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| PF13417 | GST_N_3 | 0.94 |
| PF00166 | Cpn10 | 0.47 |
| PF02798 | GST_N | 0.47 |
| PF13533 | Biotin_lipoyl_2 | 0.47 |
| PF13181 | TPR_8 | 0.47 |
| PF14023 | DUF4239 | 0.47 |
| PF02656 | DUF202 | 0.47 |
| PF13436 | Gly-zipper_OmpA | 0.47 |
| PF01381 | HTH_3 | 0.47 |
| PF01970 | TctA | 0.47 |
| PF04964 | Flp_Fap | 0.47 |
| PF14397 | ATPgrasp_ST | 0.47 |
| PF02653 | BPD_transp_2 | 0.47 |
| PF13450 | NAD_binding_8 | 0.47 |
| PF04588 | HIG_1_N | 0.47 |
| PF02687 | FtsX | 0.47 |
| PF07883 | Cupin_2 | 0.47 |
| PF03330 | DPBB_1 | 0.47 |
| PF02353 | CMAS | 0.47 |
| PF04073 | tRNA_edit | 0.47 |
| PF03733 | YccF | 0.47 |
| PF01068 | DNA_ligase_A_M | 0.47 |
| PF01370 | Epimerase | 0.47 |
| PF01380 | SIS | 0.47 |
| PF02771 | Acyl-CoA_dh_N | 0.47 |
| PF00072 | Response_reg | 0.47 |
| PF00106 | adh_short | 0.47 |
| PF12229 | PG_binding_4 | 0.47 |
| PF13458 | Peripla_BP_6 | 0.47 |
| PF12071 | DUF3551 | 0.47 |
| PF00534 | Glycos_transf_1 | 0.47 |
| PF02737 | 3HCDH_N | 0.47 |
| PF10101 | DUF2339 | 0.47 |
| PF00156 | Pribosyltran | 0.47 |
| PF00909 | Ammonium_transp | 0.47 |
| PF01522 | Polysacc_deac_1 | 0.47 |
| PF00725 | 3HCDH | 0.47 |
| PF00027 | cNMP_binding | 0.47 |
| PF16868 | NMT1_3 | 0.47 |
| PF07045 | DUF1330 | 0.47 |
| PF03886 | ABC_trans_aux | 0.47 |
| PF02586 | SRAP | 0.47 |
| PF07750 | GcrA | 0.47 |
| PF12637 | TSCPD | 0.47 |
| PF04290 | DctQ | 0.47 |
| PF00263 | Secretin | 0.47 |
| PF00589 | Phage_integrase | 0.47 |
| PF00005 | ABC_tran | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.77 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.83 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 2.36 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.42 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.42 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.42 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.94 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.94 |
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 0.47 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.47 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.47 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.47 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.47 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.47 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.47 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.47 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.47 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.47 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.47 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.47 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.47 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.47 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.47 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.47 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.47 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.47 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.47 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.13 % |
| All Organisms | root | All Organisms | 43.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090004|P1_DRAFT_NODE_124933_len_1150_cov_21_121738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1200 | Open in IMG/M |
| 2140918006|ConsensusfromContig102340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 708 | Open in IMG/M |
| 2140918007|ConsensusfromContig193819 | Not Available | 625 | Open in IMG/M |
| 2166559005|cont_contig55713 | Not Available | 827 | Open in IMG/M |
| 2170459013|GO6OHWN01EU4IP | Not Available | 532 | Open in IMG/M |
| 2170459014|G1P06HT01CZGJ5 | Not Available | 524 | Open in IMG/M |
| 2199352025|deepsgr__Contig_191572 | Not Available | 576 | Open in IMG/M |
| 2199352025|deepsgr__Contig_22863 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
| 2199352025|deepsgr_contig00498.357 | All Organisms → cellular organisms → Bacteria | 7688 | Open in IMG/M |
| 3300000313|WSSedB1CaDRAFT_10057002 | Not Available | 739 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10858029 | Not Available | 818 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100765174 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1000665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5264 | Open in IMG/M |
| 3300000729|JGI12371J11900_1009179 | Not Available | 665 | Open in IMG/M |
| 3300000890|JGI11643J12802_11569973 | Not Available | 582 | Open in IMG/M |
| 3300000956|JGI10216J12902_106515172 | Not Available | 1205 | Open in IMG/M |
| 3300003369|JGI24140J50213_10094999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 995 | Open in IMG/M |
| 3300005563|Ga0068855_101766674 | Not Available | 629 | Open in IMG/M |
| 3300005564|Ga0070664_100684704 | Not Available | 954 | Open in IMG/M |
| 3300005713|Ga0066905_100002705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6727 | Open in IMG/M |
| 3300005713|Ga0066905_100005518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5381 | Open in IMG/M |
| 3300005713|Ga0066905_100261640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1336 | Open in IMG/M |
| 3300005713|Ga0066905_100462942 | Not Available | 1045 | Open in IMG/M |
| 3300005718|Ga0068866_10915947 | Not Available | 618 | Open in IMG/M |
| 3300005764|Ga0066903_100015901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7669 | Open in IMG/M |
| 3300005764|Ga0066903_101195231 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300005764|Ga0066903_105566824 | Not Available | 663 | Open in IMG/M |
| 3300005937|Ga0081455_10008475 | All Organisms → cellular organisms → Bacteria | 10687 | Open in IMG/M |
| 3300005937|Ga0081455_10054337 | Not Available | 3414 | Open in IMG/M |
| 3300005938|Ga0066795_10058386 | Not Available | 1139 | Open in IMG/M |
| 3300005947|Ga0066794_10183723 | Not Available | 628 | Open in IMG/M |
| 3300005983|Ga0081540_1020610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3957 | Open in IMG/M |
| 3300006028|Ga0070717_11456359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300006041|Ga0075023_100161008 | Not Available | 835 | Open in IMG/M |
| 3300006047|Ga0075024_100193736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 949 | Open in IMG/M |
| 3300006047|Ga0075024_100546559 | Not Available | 614 | Open in IMG/M |
| 3300006049|Ga0075417_10199448 | Not Available | 947 | Open in IMG/M |
| 3300006052|Ga0075029_100299076 | Not Available | 1027 | Open in IMG/M |
| 3300006052|Ga0075029_100866925 | Not Available | 618 | Open in IMG/M |
| 3300006055|Ga0097691_1090718 | Not Available | 919 | Open in IMG/M |
| 3300006172|Ga0075018_10009465 | All Organisms → cellular organisms → Bacteria | 3568 | Open in IMG/M |
| 3300006173|Ga0070716_100087733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1875 | Open in IMG/M |
| 3300006174|Ga0075014_100179279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1055 | Open in IMG/M |
| 3300006237|Ga0097621_101263594 | Not Available | 696 | Open in IMG/M |
| 3300006636|Ga0075525_10031212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1058 | Open in IMG/M |
| 3300006640|Ga0075527_10085725 | Not Available | 864 | Open in IMG/M |
| 3300006806|Ga0079220_10158898 | Not Available | 1257 | Open in IMG/M |
| 3300006844|Ga0075428_100327097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1647 | Open in IMG/M |
| 3300006845|Ga0075421_101906624 | Not Available | 636 | Open in IMG/M |
| 3300006871|Ga0075434_100289552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1658 | Open in IMG/M |
| 3300007076|Ga0075435_100951372 | Not Available | 750 | Open in IMG/M |
| 3300009029|Ga0066793_10088332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1787 | Open in IMG/M |
| 3300009036|Ga0105244_10362748 | Not Available | 667 | Open in IMG/M |
| 3300009090|Ga0099827_11948793 | Not Available | 511 | Open in IMG/M |
| 3300009094|Ga0111539_10582587 | Not Available | 1303 | Open in IMG/M |
| 3300009094|Ga0111539_13061518 | Not Available | 540 | Open in IMG/M |
| 3300009098|Ga0105245_10838245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 959 | Open in IMG/M |
| 3300009100|Ga0075418_10045601 | All Organisms → cellular organisms → Bacteria | 4715 | Open in IMG/M |
| 3300009147|Ga0114129_10127569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia carboxidovorans | 3497 | Open in IMG/M |
| 3300009147|Ga0114129_11896523 | Not Available | 723 | Open in IMG/M |
| 3300009148|Ga0105243_10452216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1205 | Open in IMG/M |
| 3300009174|Ga0105241_12222770 | Not Available | 544 | Open in IMG/M |
| 3300009553|Ga0105249_13431826 | Not Available | 510 | Open in IMG/M |
| 3300009792|Ga0126374_10533621 | Not Available | 853 | Open in IMG/M |
| 3300009792|Ga0126374_10705287 | Not Available | 759 | Open in IMG/M |
| 3300010043|Ga0126380_10008853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 4425 | Open in IMG/M |
| 3300010043|Ga0126380_10012959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3801 | Open in IMG/M |
| 3300010043|Ga0126380_10068126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2006 | Open in IMG/M |
| 3300010043|Ga0126380_10384839 | Not Available | 1035 | Open in IMG/M |
| 3300010046|Ga0126384_10093112 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300010046|Ga0126384_10415079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1140 | Open in IMG/M |
| 3300010047|Ga0126382_10002956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7275 | Open in IMG/M |
| 3300010047|Ga0126382_11858999 | Not Available | 568 | Open in IMG/M |
| 3300010048|Ga0126373_10042395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4011 | Open in IMG/M |
| 3300010147|Ga0126319_1411218 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300010359|Ga0126376_11643342 | Not Available | 676 | Open in IMG/M |
| 3300010359|Ga0126376_12457248 | Not Available | 568 | Open in IMG/M |
| 3300010359|Ga0126376_12956367 | Not Available | 525 | Open in IMG/M |
| 3300010359|Ga0126376_13243748 | Not Available | 503 | Open in IMG/M |
| 3300010366|Ga0126379_10799992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300010366|Ga0126379_12534523 | Not Available | 611 | Open in IMG/M |
| 3300010371|Ga0134125_13010212 | Not Available | 511 | Open in IMG/M |
| 3300010376|Ga0126381_101119754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
| 3300010397|Ga0134124_10037102 | All Organisms → cellular organisms → Bacteria | 4061 | Open in IMG/M |
| 3300010398|Ga0126383_12407552 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300010863|Ga0124850_1007378 | Not Available | 3478 | Open in IMG/M |
| 3300011000|Ga0138513_100009558 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1190 | Open in IMG/M |
| 3300011003|Ga0138514_100102276 | Not Available | 622 | Open in IMG/M |
| 3300011270|Ga0137391_10122650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2256 | Open in IMG/M |
| 3300012010|Ga0120118_1029632 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 1445 | Open in IMG/M |
| 3300012019|Ga0120139_1071908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300012200|Ga0137382_10137247 | Not Available | 1648 | Open in IMG/M |
| 3300012492|Ga0157335_1022363 | Not Available | 610 | Open in IMG/M |
| 3300012499|Ga0157350_1042851 | Not Available | 548 | Open in IMG/M |
| 3300012955|Ga0164298_10217634 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012955|Ga0164298_11362386 | Not Available | 547 | Open in IMG/M |
| 3300012961|Ga0164302_10042722 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300012984|Ga0164309_10412556 | Not Available | 1010 | Open in IMG/M |
| 3300012985|Ga0164308_10039852 | Not Available | 2950 | Open in IMG/M |
| 3300012986|Ga0164304_10025921 | Not Available | 2922 | Open in IMG/M |
| 3300012989|Ga0164305_10795181 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300013296|Ga0157374_10759368 | Not Available | 984 | Open in IMG/M |
| 3300013297|Ga0157378_10722908 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300013297|Ga0157378_11042249 | Not Available | 853 | Open in IMG/M |
| 3300013306|Ga0163162_12214556 | Not Available | 631 | Open in IMG/M |
| 3300013307|Ga0157372_12923697 | Not Available | 547 | Open in IMG/M |
| 3300013503|Ga0120127_10040816 | Not Available | 901 | Open in IMG/M |
| 3300013503|Ga0120127_10070527 | Not Available | 736 | Open in IMG/M |
| 3300013832|Ga0120132_1001587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3288 | Open in IMG/M |
| 3300014058|Ga0120149_1063952 | Not Available | 946 | Open in IMG/M |
| 3300014325|Ga0163163_10019366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6392 | Open in IMG/M |
| 3300014969|Ga0157376_12837860 | Not Available | 524 | Open in IMG/M |
| 3300015371|Ga0132258_10830631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 2330 | Open in IMG/M |
| 3300015371|Ga0132258_11222891 | Not Available | 1899 | Open in IMG/M |
| 3300015371|Ga0132258_12894165 | Not Available | 1193 | Open in IMG/M |
| 3300015372|Ga0132256_102069287 | Not Available | 675 | Open in IMG/M |
| 3300015374|Ga0132255_100081658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4332 | Open in IMG/M |
| 3300017792|Ga0163161_11093853 | Not Available | 685 | Open in IMG/M |
| 3300017930|Ga0187825_10136451 | Not Available | 862 | Open in IMG/M |
| 3300017936|Ga0187821_10394442 | Not Available | 565 | Open in IMG/M |
| 3300017939|Ga0187775_10000909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7074 | Open in IMG/M |
| 3300017944|Ga0187786_10031836 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300017947|Ga0187785_10003556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5094 | Open in IMG/M |
| 3300017947|Ga0187785_10006307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3934 | Open in IMG/M |
| 3300017947|Ga0187785_10065748 | Not Available | 1389 | Open in IMG/M |
| 3300017959|Ga0187779_10017744 | Not Available | 4050 | Open in IMG/M |
| 3300017966|Ga0187776_11573122 | Not Available | 507 | Open in IMG/M |
| 3300017974|Ga0187777_10000323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 35193 | Open in IMG/M |
| 3300017974|Ga0187777_10090873 | Not Available | 1996 | Open in IMG/M |
| 3300017974|Ga0187777_10863842 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300017994|Ga0187822_10184598 | Not Available | 688 | Open in IMG/M |
| 3300018028|Ga0184608_10286263 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300018029|Ga0187787_10341346 | Not Available | 574 | Open in IMG/M |
| 3300018030|Ga0187869_10631982 | Not Available | 504 | Open in IMG/M |
| 3300018031|Ga0184634_10424462 | Not Available | 603 | Open in IMG/M |
| 3300018058|Ga0187766_10039681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2750 | Open in IMG/M |
| 3300018060|Ga0187765_10066282 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300018072|Ga0184635_10052340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1578 | Open in IMG/M |
| 3300018081|Ga0184625_10127947 | Not Available | 1322 | Open in IMG/M |
| 3300018081|Ga0184625_10157091 | Not Available | 1188 | Open in IMG/M |
| 3300019878|Ga0193715_1107328 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300019888|Ga0193751_1107726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1061 | Open in IMG/M |
| 3300020006|Ga0193735_1097712 | Not Available | 822 | Open in IMG/M |
| 3300021510|Ga0222621_1042045 | Not Available | 952 | Open in IMG/M |
| 3300021560|Ga0126371_10012121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7814 | Open in IMG/M |
| 3300021560|Ga0126371_10422572 | Not Available | 1477 | Open in IMG/M |
| 3300021560|Ga0126371_10616190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1234 | Open in IMG/M |
| 3300022534|Ga0224452_1025929 | Not Available | 1665 | Open in IMG/M |
| 3300022883|Ga0247786_1024577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1152 | Open in IMG/M |
| 3300022892|Ga0247753_1003646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1481 | Open in IMG/M |
| 3300025271|Ga0207666_1057587 | Not Available | 620 | Open in IMG/M |
| 3300025457|Ga0208850_1004279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3137 | Open in IMG/M |
| 3300025474|Ga0208479_1081361 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300025484|Ga0208587_1077747 | Not Available | 699 | Open in IMG/M |
| 3300025505|Ga0207929_1001051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7133 | Open in IMG/M |
| 3300025900|Ga0207710_10010743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3856 | Open in IMG/M |
| 3300025903|Ga0207680_10116506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1741 | Open in IMG/M |
| 3300025906|Ga0207699_10858887 | Not Available | 669 | Open in IMG/M |
| 3300025912|Ga0207707_10049371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3666 | Open in IMG/M |
| 3300025917|Ga0207660_10624833 | Not Available | 878 | Open in IMG/M |
| 3300025928|Ga0207700_10269765 | Not Available | 1460 | Open in IMG/M |
| 3300025931|Ga0207644_10397170 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300025933|Ga0207706_11185857 | Not Available | 635 | Open in IMG/M |
| 3300025961|Ga0207712_12098192 | Not Available | 506 | Open in IMG/M |
| 3300025972|Ga0207668_12073050 | Not Available | 512 | Open in IMG/M |
| 3300025981|Ga0207640_10573561 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300025986|Ga0207658_10152494 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300026035|Ga0207703_11185214 | Not Available | 734 | Open in IMG/M |
| 3300026088|Ga0207641_11248345 | Not Available | 743 | Open in IMG/M |
| 3300026746|Ga0207454_103996 | Not Available | 532 | Open in IMG/M |
| 3300026833|Ga0207728_117475 | Not Available | 650 | Open in IMG/M |
| 3300026921|Ga0207860_1010823 | Not Available | 1226 | Open in IMG/M |
| 3300027680|Ga0207826_1070665 | Not Available | 962 | Open in IMG/M |
| 3300027909|Ga0209382_10277883 | Not Available | 1894 | Open in IMG/M |
| 3300027915|Ga0209069_10023373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2894 | Open in IMG/M |
| 3300027915|Ga0209069_10648015 | Not Available | 614 | Open in IMG/M |
| 3300028381|Ga0268264_12687211 | Not Available | 502 | Open in IMG/M |
| 3300028715|Ga0307313_10055281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1168 | Open in IMG/M |
| 3300028715|Ga0307313_10268364 | Not Available | 531 | Open in IMG/M |
| 3300028718|Ga0307307_10195903 | Not Available | 639 | Open in IMG/M |
| 3300028787|Ga0307323_10089628 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300028791|Ga0307290_10362595 | Not Available | 530 | Open in IMG/M |
| 3300028799|Ga0307284_10333340 | Not Available | 613 | Open in IMG/M |
| 3300028814|Ga0307302_10070407 | Not Available | 1647 | Open in IMG/M |
| 3300028885|Ga0307304_10313905 | Not Available | 695 | Open in IMG/M |
| 3300030989|Ga0308196_1054445 | Not Available | 561 | Open in IMG/M |
| 3300031058|Ga0308189_10166895 | Not Available | 770 | Open in IMG/M |
| 3300031170|Ga0307498_10017330 | Not Available | 1579 | Open in IMG/M |
| 3300031170|Ga0307498_10268583 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031231|Ga0170824_116292938 | Not Available | 786 | Open in IMG/M |
| 3300031360|Ga0307444_1064500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1178 | Open in IMG/M |
| 3300031446|Ga0170820_15628194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300031740|Ga0307468_101711693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 592 | Open in IMG/M |
| 3300031819|Ga0318568_10342655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300031854|Ga0310904_10248369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1101 | Open in IMG/M |
| 3300031858|Ga0310892_10251428 | Not Available | 1091 | Open in IMG/M |
| 3300032782|Ga0335082_10745270 | Not Available | 841 | Open in IMG/M |
| 3300032828|Ga0335080_11079784 | Not Available | 813 | Open in IMG/M |
| 3300033412|Ga0310810_10011257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10455 | Open in IMG/M |
| 3300033433|Ga0326726_10011495 | All Organisms → cellular organisms → Bacteria | 7805 | Open in IMG/M |
| 3300033433|Ga0326726_10211320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1794 | Open in IMG/M |
| 3300033433|Ga0326726_10320510 | Not Available | 1457 | Open in IMG/M |
| 3300033513|Ga0316628_102655072 | Not Available | 660 | Open in IMG/M |
| 3300033758|Ga0314868_043886 | Not Available | 537 | Open in IMG/M |
| 3300033887|Ga0334790_007000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6584 | Open in IMG/M |
| 3300033887|Ga0334790_016947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3431 | Open in IMG/M |
| 3300034090|Ga0326723_0205310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 873 | Open in IMG/M |
| 3300034090|Ga0326723_0414271 | Not Available | 613 | Open in IMG/M |
| 3300034090|Ga0326723_0510084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 552 | Open in IMG/M |
| 3300034090|Ga0326723_0609007 | Not Available | 506 | Open in IMG/M |
| 3300034661|Ga0314782_139793 | Not Available | 585 | Open in IMG/M |
| 3300034819|Ga0373958_0008501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1665 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.25% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.77% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.30% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.42% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.47% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.47% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.47% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.47% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.47% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.47% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.47% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.47% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000729 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006636 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026746 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031360 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-40 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_DRAFT_00395310 | 2088090004 | Soil | MLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF |
| P1_C_00565190 | 2140918006 | Soil | AMLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF |
| A_all_C_02829180 | 2140918007 | Soil | MQRVSAIMSYVVNDGRLFALKPSEWSMLLFGLALCGFVMLFF |
| cont_0713.00003800 | 2166559005 | Simulated | MGISMLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG |
| N57_03312410 | 2170459013 | Grass Soil | MMAYVVNDGRLLALKPSEWFLMLGGVALTGFLTLLI |
| 2PV_00657880 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MMAYVVSEGRLCALKPAEWSLLLSGVVLCGIATLLFLMLHA |
| deepsgr_03306890 | 2199352025 | Soil | MLAYVKSDGRLFGLNSSEWSMLLGGVTLCGLLTLLLAG |
| deepsgr_03400270 | 2199352025 | Soil | MMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF |
| deepsgr_00276000 | 2199352025 | Soil | MLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG |
| WSSedB1CaDRAFT_100570022 | 3300000313 | Wetland | MMAYVVSDGRLFALKPSEWSLLLVGVALCGLFALLL* |
| ICChiseqgaiiFebDRAFT_108580291 | 3300000363 | Soil | MLAYVKSEGRLFGLNPSEWSMLLGGVILCGLLTLLLTA* |
| INPhiseqgaiiFebDRAFT_1007651742 | 3300000364 | Soil | AMLAYVVSEGRLFALKPSDWSMLLGGVTLCGLMTLLLG* |
| AF_2010_repII_A01DRAFT_10006656 | 3300000580 | Forest Soil | MVSPINVSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| JGI12371J11900_10091791 | 3300000729 | Tropical Forest Soil | ATLAYVVSEGRLFALTPSEWSILLVGGALCRFVEQLF* |
| JGI11643J12802_115699731 | 3300000890 | Soil | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVAVCGI |
| JGI10216J12902_1065151722 | 3300000956 | Soil | SARMVSLQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| JGI24140J50213_100949991 | 3300003369 | Arctic Peat Soil | VSAMLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF* |
| Ga0068855_1017666742 | 3300005563 | Corn Rhizosphere | MMAYVVNDGRLLALKPSEWFLMLTGVALTGFLALLF* |
| Ga0070664_1006847042 | 3300005564 | Corn Rhizosphere | MLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0066905_1000027052 | 3300005713 | Tropical Forest Soil | MLAYVVSEGRLFALKPSDWSMLLGGVILCGLMTLLLG* |
| Ga0066905_1000055184 | 3300005713 | Tropical Forest Soil | MLAYVVSEGRLFALKPSDWSMLLGGVTLCGILTLLLG* |
| Ga0066905_1002616403 | 3300005713 | Tropical Forest Soil | MLAYVVSEGRLFALKPSEWSMLLGGVTLCGLLALLLG* |
| Ga0066905_1004629422 | 3300005713 | Tropical Forest Soil | MLAYVVSEGRFFALKPSDWSLLLGGVMLCGLLTLVFG* |
| Ga0068866_109159471 | 3300005718 | Miscanthus Rhizosphere | MMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF* |
| Ga0066903_1000159017 | 3300005764 | Tropical Forest Soil | MMTYVISEGRLFGLTPSEWSMMLGGVALCGLMTLLF* |
| Ga0066903_1011952312 | 3300005764 | Tropical Forest Soil | MLAYVLSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0066903_1055668241 | 3300005764 | Tropical Forest Soil | MMSYVVSEGRLFALKPSEWLILLIGVALSGLLTLLLLL* |
| Ga0081455_100084755 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLAYVVSEGRLFALKPSDWSMLLGGVTLCGLMTLLLG* |
| Ga0081455_100543376 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MMAYVASEGRLFALKPSEWGILLVGVALCGFATLLF* |
| Ga0066795_100583861 | 3300005938 | Soil | MLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF* |
| Ga0066794_101837232 | 3300005947 | Soil | LAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF* |
| Ga0081540_10206108 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MLAYVKNEGRLFGLNPSEWSVLLGGVILCGLLTLLLTA* |
| Ga0070717_114563592 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAYVVNDGRLLALKPSEWFLMLAGVALTGFLALLI* |
| Ga0075023_1001610082 | 3300006041 | Watersheds | MMTYVISEGRLFALKPSEWAMMLVGVALCGFITLLF* |
| Ga0075024_1001937361 | 3300006047 | Watersheds | MERVSALMAYVVSEGRLCALKPSEWSLLLAGVALCGF |
| Ga0075024_1005465592 | 3300006047 | Watersheds | MHMMAYVISEGRLLGLDAAEWSIMLVGVVLCGFVALLF* |
| Ga0075417_101994483 | 3300006049 | Populus Rhizosphere | MLAYVVSEGRLFALNPSEWAMLLVGVAACGFLTLLF* |
| Ga0075029_1002990762 | 3300006052 | Watersheds | MMAYVVSDGRLFALKPSEWSLLLVGVALCGLIALLL* |
| Ga0075029_1008669251 | 3300006052 | Watersheds | MMAYVVSDGRLFALKLSEWSMLLVGVTLCGFIALLF* |
| Ga0097691_10907182 | 3300006055 | Arctic Peat Soil | MMAYLISDGRLLALKPSEWSALLVGVALCGMAVLLF* |
| Ga0075018_100094655 | 3300006172 | Watersheds | MMAYVVSEGRLFALKPSEWTMLLVGVALCGFITLLF* |
| Ga0070716_1000877332 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAYVVNEGRLLALKPSEWAMMLGGVALCGLIALLF* |
| Ga0075014_1001792792 | 3300006174 | Watersheds | MQSLSAMMACVVSEGRLFALKPSEWSMLLVGVALCGFIALLF* |
| Ga0097621_1012635941 | 3300006237 | Miscanthus Rhizosphere | MMTYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF |
| Ga0075525_100312123 | 3300006636 | Arctic Peat Soil | LAYVVSEGRLFALNPSEWSMLLVGVALCGFVTLLF* |
| Ga0075527_100857251 | 3300006640 | Arctic Peat Soil | MAYVVSDGRLFALKPSEWSVLLVGVALCGVVTLLF* |
| Ga0079220_101588981 | 3300006806 | Agricultural Soil | MLSFVISEGRFFALKPSDWSMLLGGVALCGLLALLF* |
| Ga0075428_1003270973 | 3300006844 | Populus Rhizosphere | APAMLAYVVSEGRLFALNPSEWAMLLVGVAACGFLTLLF* |
| Ga0075421_1019066241 | 3300006845 | Populus Rhizosphere | SRYVLGHKLRVRAMLAYVVSDGRLFALKPSEWTMLLVGVAACGFLALLF* |
| Ga0075434_1002895523 | 3300006871 | Populus Rhizosphere | QRGSAMLAYVVSEGRLFALKPSDWSMLLGGVTLCGLMTLLLG* |
| Ga0075435_1009513722 | 3300007076 | Populus Rhizosphere | MMAYVMSDGRLFALKPSEWAMLLFGVASCGFLAVLFSV* |
| Ga0066793_100883324 | 3300009029 | Prmafrost Soil | MMAYVVSDGRLFALKPSEWSVLLVGVALCGVVTLLF* |
| Ga0105244_103627482 | 3300009036 | Miscanthus Rhizosphere | MMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA* |
| Ga0099827_119487933 | 3300009090 | Vadose Zone Soil | VSAIMSYVVSEGRVCALKPSEWSLLLVGVALCGIVALLL* |
| Ga0111539_105825872 | 3300009094 | Populus Rhizosphere | MLAYVVSDGRLFALKPSEWAVLVVGVAICGLVTLFFSV* |
| Ga0111539_130615181 | 3300009094 | Populus Rhizosphere | MLAYLVSDGRSLALKPPEWAVLLSGAAVCGFLTVFF |
| Ga0105245_108382451 | 3300009098 | Miscanthus Rhizosphere | TAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0075418_100456018 | 3300009100 | Populus Rhizosphere | MMAYVASEGTLFALKPSEWGILVVGVALCGFATLLF* |
| Ga0114129_101275697 | 3300009147 | Populus Rhizosphere | MLAYVVSEGRLFALNPSDWAMLLVGVALCGFGTLLF* |
| Ga0114129_118965231 | 3300009147 | Populus Rhizosphere | RVPAMLAYVMSDGRLFALKASKWAVLLVGVVLCGFLTLVFSV* |
| Ga0105243_104522163 | 3300009148 | Miscanthus Rhizosphere | MMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA* |
| Ga0105241_122227701 | 3300009174 | Corn Rhizosphere | AAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0105249_134318262 | 3300009553 | Switchgrass Rhizosphere | EGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA* |
| Ga0126374_105336212 | 3300009792 | Tropical Forest Soil | MMTYVIGEGRLFGLTPSEWSMMLGGVALCGFITLLF* |
| Ga0126374_107052871 | 3300009792 | Tropical Forest Soil | MMTYVISEGRLLGLTPSEWSMMLGGVALCGFITLLF* |
| Ga0126380_100088532 | 3300010043 | Tropical Forest Soil | MLTYVKGDGRLFGLNPSEWSMLIGGVILCGFVTLLLTA* |
| Ga0126380_100129596 | 3300010043 | Tropical Forest Soil | MMTYVISEGRLFGLTPSEWSMMLGGVAICGIITLLF* |
| Ga0126380_100681263 | 3300010043 | Tropical Forest Soil | LAMLAYVVSEGRFFALKPSDWSLLLGGGLLFKIKTLVFG* |
| Ga0126380_103848392 | 3300010043 | Tropical Forest Soil | MLAYVVSDGRLFALKPSEWTILFVGVAACGFLTLLF* |
| Ga0126384_100931121 | 3300010046 | Tropical Forest Soil | SPINVSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0126384_104150792 | 3300010046 | Tropical Forest Soil | MLAYVVSDGRLFALKPSEWAMLLVGVAVCGFLTLLF* |
| Ga0126382_1000295610 | 3300010047 | Tropical Forest Soil | AMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0126382_118589991 | 3300010047 | Tropical Forest Soil | AVRQRVFAMLTYVKSDGRLFALNPSEWSMLIGGVILCGLLTLLLTA* |
| Ga0126373_100423956 | 3300010048 | Tropical Forest Soil | MMTYVIGEGRLFGLTPSEWSMMLGGVAICGIITLLF* |
| Ga0126319_14112181 | 3300010147 | Soil | EYMQMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF* |
| Ga0126376_116433421 | 3300010359 | Tropical Forest Soil | MMAYVVNEGRLCALKPSEWSLLLAGVTLCGAATLLFLMVHA* |
| Ga0126376_124572481 | 3300010359 | Tropical Forest Soil | SAMLTYVMSDGRLFGLNSSEWSMLIGGVILCGFLTLLLV* |
| Ga0126376_129563671 | 3300010359 | Tropical Forest Soil | MLAYVISEGRLFELKPSEWAMMLGGVALCGFMALLFG* |
| Ga0126376_132437481 | 3300010359 | Tropical Forest Soil | MMTYVISDGRLLGLTPSEWSMMLGGVALCGFITLLF* |
| Ga0126379_107999921 | 3300010366 | Tropical Forest Soil | NDSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMLCGLLTLVFG* |
| Ga0126379_125345231 | 3300010366 | Tropical Forest Soil | MVSHNDSAAGLAMLAYVVSAGRFFALKPSDWSLLLGGVMLCGLLTLV |
| Ga0134125_130102121 | 3300010371 | Terrestrial Soil | MLEYVVSEGRLFALKPSEWSMLLGGVTLCGLLTLLF |
| Ga0126381_1011197542 | 3300010376 | Tropical Forest Soil | MLTYVKSDGRLFGLNPSEWSMLIGGVILCGLLTLLLTA* |
| Ga0134124_100371021 | 3300010397 | Terrestrial Soil | VALQPSRGSARMVSPQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0126383_124075521 | 3300010398 | Tropical Forest Soil | MLMYVKGDGRLFGLSPSEWSILIGGVILCGFLTLLL |
| Ga0124850_10073785 | 3300010863 | Tropical Forest Soil | MMTFVISEGRLFGLTPSEWSLMLGGVALCGFIKLLF* |
| Ga0138513_1000095583 | 3300011000 | Soil | MLAYVVSEGRLFALNPSDWAMLLVGVALCGFVTLLF* |
| Ga0138514_1001022762 | 3300011003 | Soil | MMAYVASEGRLFALKPSEWGILLGGVALCGFATLLF* |
| Ga0137391_101226502 | 3300011270 | Vadose Zone Soil | MSYVVSEGRVCALKPSEWSLLLVGVALCGIVALLL* |
| Ga0120118_10296323 | 3300012010 | Permafrost | MQSVSAMMAYVVSEGRLCALKPSDWAMLLVGVALCGFIALLF* |
| Ga0120139_10719083 | 3300012019 | Permafrost | MQSVSAMMAYVVNYGRLCALKPSEWSMLLVGVIIYGFIALLF* |
| Ga0137382_101372473 | 3300012200 | Vadose Zone Soil | MLAYVMSEGRLFALNPSDWAMLLVGVTLCGLGTLLF* |
| Ga0157335_10223632 | 3300012492 | Arabidopsis Rhizosphere | QPSRGSARMVSPQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0157350_10428512 | 3300012499 | Unplanted Soil | SPQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0164298_102176341 | 3300012955 | Soil | MMAYVISEGRLFGLKPSEWSLMLVGGALCIIMTLLF* |
| Ga0164298_113623862 | 3300012955 | Soil | SAAGLAMLAYVLSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0164302_100427224 | 3300012961 | Soil | YVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0164309_104125562 | 3300012984 | Soil | MSMLSYVISEGRLFALKPSDWSMLLGGVALCGLLALLF* |
| Ga0164308_100398523 | 3300012985 | Soil | MMAYVVNDGRLLALKPSEWFLMLAGVAFTGFLTLLV* |
| Ga0164304_100259212 | 3300012986 | Soil | MMAYVVNDGRLLALKPSELFLMLAGVALTGFLALLI* |
| Ga0164305_107951812 | 3300012989 | Soil | AYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLLFG* |
| Ga0157374_107593681 | 3300013296 | Miscanthus Rhizosphere | QTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0157378_107229081 | 3300013297 | Miscanthus Rhizosphere | MRMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF* |
| Ga0157378_110422491 | 3300013297 | Miscanthus Rhizosphere | MMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLL |
| Ga0163162_122145561 | 3300013306 | Switchgrass Rhizosphere | NSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0157372_129236971 | 3300013307 | Corn Rhizosphere | ESINDSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0120127_100408162 | 3300013503 | Permafrost | MMAYVVSDGRVFALKPSEWSMLLVGVAICGFVTLLF* |
| Ga0120127_100705271 | 3300013503 | Permafrost | MMAYLINDGRLLALKPSEWSTLLVGVALCGIAVLLF* |
| Ga0120132_10015874 | 3300013832 | Permafrost | MMAYLFSDGRLLALKPSEWSTLIVGVALCGIAILLF* |
| Ga0120149_10639522 | 3300014058 | Permafrost | MQSVSAMMAYVVSEGRLCALKPSEWSMLLVGVIICGFIALLF* |
| Ga0163163_100193666 | 3300014325 | Switchgrass Rhizosphere | MMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLVLHA* |
| Ga0157376_128378601 | 3300014969 | Miscanthus Rhizosphere | CPYGEPINDSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG* |
| Ga0132258_108306311 | 3300015371 | Arabidopsis Rhizosphere | VVSEGRVCALKPAEWLLLLTGVALCGIATLLFLMLHA* |
| Ga0132258_112228913 | 3300015371 | Arabidopsis Rhizosphere | MLTYVKGDGRLFGLDPSEWSMLIGGVILCGFFTLLLTA* |
| Ga0132258_128941651 | 3300015371 | Arabidopsis Rhizosphere | MMAYVVSEGRVFALKPSEWGMLLIGVALCGFATLFF* |
| Ga0132256_1020692872 | 3300015372 | Arabidopsis Rhizosphere | MMTYVISEGRLFGLTPAEWSMMLGGVAICGIITLLF* |
| Ga0132255_1000816581 | 3300015374 | Arabidopsis Rhizosphere | MQRVTAIMAYVVSEGRLCALRPAEWSLLLFGVALCG |
| Ga0163161_110938532 | 3300017792 | Switchgrass Rhizosphere | MMAYVISDGRLFALKPSEWAMLLFGVASCGFLAVLFSV |
| Ga0187825_101364513 | 3300017930 | Freshwater Sediment | MMAYVVSDGRLLALKPSEWSMLLVGVALCGMLVLLFTAN |
| Ga0187821_103944422 | 3300017936 | Freshwater Sediment | AMMACVVSEGRLCALKPSEWSMLLVGVALCGFIALLF |
| Ga0187775_100009097 | 3300017939 | Tropical Peatland | MLSFVISEGRLFALKPSDWSMLLGGVALCGLLALLF |
| Ga0187786_100318362 | 3300017944 | Tropical Peatland | MVEFVISEGRLFALKPSEWSMLLGGVMFCGLLTLLF |
| Ga0187785_100035563 | 3300017947 | Tropical Peatland | MHMIAYVISEGRLFGLDAAEWSIMLVGVALCGFVALLF |
| Ga0187785_100063073 | 3300017947 | Tropical Peatland | MMTYVVSDGRLLGLNPAEWSIMLVGVALCGFMTLLF |
| Ga0187785_100657482 | 3300017947 | Tropical Peatland | MVSHINDSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMLCGLLTLVFG |
| Ga0187779_100177442 | 3300017959 | Tropical Peatland | MLSYVINEGRLFALKPSDWSMLLGGVALCGLLALLF |
| Ga0187776_115731222 | 3300017966 | Tropical Peatland | MMAYIVSEGRLFALKPSEWSMLLVGVTLCGFAALLF |
| Ga0187777_100003233 | 3300017974 | Tropical Peatland | MMAYVVSEGRLFALKPSDWLILLIGVSFAGLLALLL |
| Ga0187777_100908732 | 3300017974 | Tropical Peatland | MLAYVVSEGRFFALKPSDWSLLLGGVMLCGLVTLVLG |
| Ga0187777_108638422 | 3300017974 | Tropical Peatland | MLTYVKGDGRLFGLNPSEWSMLIGGVILCGFFTLLLTA |
| Ga0187822_101845982 | 3300017994 | Freshwater Sediment | MMAYVVSDGRLLALKPSEWSVLLVGVALCGMLVLLFTAN |
| Ga0184608_102862631 | 3300018028 | Groundwater Sediment | MLAYVVSEGRLFALKPSEWSLLLGGVFCGLLTLLFG |
| Ga0187787_103413461 | 3300018029 | Tropical Peatland | VLPKMMMYAVSEGRLCALKPSEWSILLMGVALCGILTLLF |
| Ga0187869_106319821 | 3300018030 | Peatland | EGKTAMMAYVVSEGRLCGLKPSDWSVLLVAVALCGSLTLLF |
| Ga0184634_104244621 | 3300018031 | Groundwater Sediment | MMAYVASEGRLFALKPSEWGILLGGVALCGFATLLF |
| Ga0187766_100396813 | 3300018058 | Tropical Peatland | MMAYVVSEGRLFALKPSDWLILLIGVSFAGLMALLL |
| Ga0187765_100662823 | 3300018060 | Tropical Peatland | MMTFVISEGRLFGLTPAEWSMMLGGVAICGIITLLF |
| Ga0184635_100523403 | 3300018072 | Groundwater Sediment | MMTYVASEGRLFALKPSEWGILLGGVALCGFATLLF |
| Ga0184625_101279472 | 3300018081 | Groundwater Sediment | MMAYVASEGRLFALKPSEWGILLVGVALCGFATLLF |
| Ga0184625_101570912 | 3300018081 | Groundwater Sediment | MLAYVKSDGRLFGLNSSDWSMLLGGVTLCGLLTLLLTG |
| Ga0193715_11073282 | 3300019878 | Soil | TMLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG |
| Ga0193751_11077261 | 3300019888 | Soil | MSFVVSEGRVCALKPSEWSLLLVGVALCGIVALLL |
| Ga0193735_10977123 | 3300020006 | Soil | MLAYVVSEGRLFALNPSDWAMLLVGVALCGFVTLLF |
| Ga0222621_10420451 | 3300021510 | Groundwater Sediment | MLAYVLSEGRLFALNLSDWAMLLVGVALCGFVTLLF |
| Ga0126371_100121212 | 3300021560 | Tropical Forest Soil | MLTYVKGDGRLFGLNPSEWSMLIGGVILCGFVTLLLTA |
| Ga0126371_104225721 | 3300021560 | Tropical Forest Soil | MLTYVKSDGRLFGLNPSEWSMLIGGVILCGLLTLLLTA |
| Ga0126371_106161903 | 3300021560 | Tropical Forest Soil | MVSPINVSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG |
| Ga0224452_10259294 | 3300022534 | Groundwater Sediment | MLAYVMSEGRLFALNPSDWAMLLVGVTLCGFGTLLF |
| Ga0247786_10245773 | 3300022883 | Soil | AMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0247753_10036464 | 3300022892 | Soil | SEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0207666_10575871 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCG |
| Ga0208850_10042795 | 3300025457 | Arctic Peat Soil | LAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF |
| Ga0208479_10813612 | 3300025474 | Arctic Peat Soil | MMAYVISDGRLLALKPSEWSTLLAGVALCGIAVLLF |
| Ga0208587_10777471 | 3300025484 | Arctic Peat Soil | MMAYVVSDGRLFALKPSEWSVLLVGVALCGVVTLLF |
| Ga0207929_10010512 | 3300025505 | Arctic Peat Soil | MMAYVVSDGRVFALKPSEWSMLLVGVAICGFVTLLF |
| Ga0207710_100107434 | 3300025900 | Switchgrass Rhizosphere | MLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG |
| Ga0207680_101165062 | 3300025903 | Switchgrass Rhizosphere | YMRMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF |
| Ga0207699_108588871 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAYVVNDGRLLALKPSEWFLMLAGVTLTGFLALLI |
| Ga0207707_100493713 | 3300025912 | Corn Rhizosphere | MMAYVVNDGRLLALKPSEWFLMLTGVALTGFLALLF |
| Ga0207660_106248331 | 3300025917 | Corn Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSLLLIGVALCGIA |
| Ga0207700_102697651 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ARMVSPQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG |
| Ga0207644_103971701 | 3300025931 | Switchgrass Rhizosphere | QRVSTEYMQMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF |
| Ga0207706_111858572 | 3300025933 | Corn Rhizosphere | MMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0207712_120981921 | 3300025961 | Switchgrass Rhizosphere | MLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLV |
| Ga0207668_120730501 | 3300025972 | Switchgrass Rhizosphere | SEGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA |
| Ga0207640_105735611 | 3300025981 | Corn Rhizosphere | ATVQRISTEYMRMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF |
| Ga0207658_101524944 | 3300025986 | Switchgrass Rhizosphere | SAGLSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA |
| Ga0207703_111852141 | 3300026035 | Switchgrass Rhizosphere | MVSLQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG |
| Ga0207641_112483452 | 3300026088 | Switchgrass Rhizosphere | VSSEYMQMMTYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF |
| Ga0207454_1039961 | 3300026746 | Soil | MMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA |
| Ga0207728_1174751 | 3300026833 | Tropical Forest Soil | SATLAYVVSEGRLFALTPSEWSILLVGGALCRFVEQLF |
| Ga0207860_10108231 | 3300026921 | Tropical Forest Soil | LPLRYSAWHDSTAGFYVLSYVVSEGRLFALKPSEWSMLLCGVALCGLL |
| Ga0207826_10706651 | 3300027680 | Tropical Forest Soil | LAYVVSEGRLFALTPSEWSILLVGGALCRFVEQLF |
| Ga0209382_102778831 | 3300027909 | Populus Rhizosphere | MMAYVASEGTLFALKPSEWGILVVGVALCGFATLLF |
| Ga0209069_100233731 | 3300027915 | Watersheds | MMAYVVSEGRLFALKPSEWTMLLVGVALCGFITLLF |
| Ga0209069_106480151 | 3300027915 | Watersheds | MHMMAYVISEGRLLGLDAAEWSIMLVGVVLCGFVALLF |
| Ga0268264_126872112 | 3300028381 | Switchgrass Rhizosphere | MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFL |
| Ga0307313_100552812 | 3300028715 | Soil | MLAYVVSEGRLFALNPSDWAMLLVGVTLCGLGTLLF |
| Ga0307313_102683642 | 3300028715 | Soil | MLAYVLSEGRLFALNPSDWAMLLVGVTLCGFGTLLF |
| Ga0307307_101959031 | 3300028718 | Soil | MMAYVVIEGRLFALKSSEWSMLLVGVALCGFLTMLF |
| Ga0307323_100896282 | 3300028787 | Soil | NSTTGITMLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG |
| Ga0307290_103625952 | 3300028791 | Soil | MMAYVVSEGRLFALKPSEWSMLLVGVALCGFLTMLF |
| Ga0307284_103333402 | 3300028799 | Soil | YLGHEQRAPAMLAYVMSEGRLFALNPSDWAMLLVGVTLCGFGTLLF |
| Ga0307302_100704072 | 3300028814 | Soil | MLAYVVSEGRLFALKPSEWSMLLGGVTLCGLLTLLF |
| Ga0307304_103139052 | 3300028885 | Soil | MLAYVVSEGRLFALNPSDWAMLLIGVALCGLPILGPANERA |
| Ga0308196_10544452 | 3300030989 | Soil | HEQRAPAMLAYVVSEGRLFALNPSDWAMLLVGVALCGFVTLLF |
| Ga0308189_101668951 | 3300031058 | Soil | SEHLRCWRYVLSEGRLFALNPSDWAMLLVGVTLCGLGTLLF |
| Ga0307498_100173301 | 3300031170 | Soil | MAYVASEGRLFALKPSEWGILLGGVALCGFATLLF |
| Ga0307498_102685831 | 3300031170 | Soil | ITMLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG |
| Ga0170824_1162929382 | 3300031231 | Forest Soil | MMAYVVNDGRLLALKPSEWFLMLAGVALTGLLALLM |
| Ga0307444_10645003 | 3300031360 | Salt Marsh | MKAYLVSDGRLFALKPSEWAMLLVGVAICGLAALLF |
| Ga0170820_156281942 | 3300031446 | Forest Soil | MMAYVVNDGRLLALKPSEWFLMLAGVALTGFLTLLI |
| Ga0307468_1017116933 | 3300031740 | Hardwood Forest Soil | MLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLLFG |
| Ga0318568_103426551 | 3300031819 | Soil | NDSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMLCGLLTLVFG |
| Ga0310904_102483691 | 3300031854 | Soil | MMAYVVSEGRVFALKPSEWGMLLIGVALCGFATLFF |
| Ga0310892_102514281 | 3300031858 | Soil | ARVCPYGESINDSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG |
| Ga0335082_107452701 | 3300032782 | Soil | MLSFVISEGRFFALKPSDWSMLLGGVALCGLLALLF |
| Ga0335080_110797841 | 3300032828 | Soil | MVEFVISEGRLFALKPSEWSMLLGGVVFCGLLTLLF |
| Ga0310810_1001125711 | 3300033412 | Soil | MLAYVVSDGRLLQLKPSDWTFLLVGICLCGMLTVFA |
| Ga0326726_100114954 | 3300033433 | Peat Soil | MMTYVVSEGRLFALKPSEWAMMLVGVALCGFITLLF |
| Ga0326726_102113203 | 3300033433 | Peat Soil | MAYVVSEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL |
| Ga0326726_103205101 | 3300033433 | Peat Soil | MIAYIVSEGRVFELKPSEWAIMLVGVALCGFIALLF |
| Ga0316628_1026550721 | 3300033513 | Soil | MMAYVVSDGRLFALKPSEWSLLLVGVALCGLIALLL |
| Ga0314868_043886_430_537 | 3300033758 | Peatland | MQRVAALMSYVVNEGRVCALKPSEWSLLLAGVALCG |
| Ga0334790_007000_3241_3351 | 3300033887 | Soil | MMAYVISDGRLLALRPSEWSTLLVGVALCGIAVLLF |
| Ga0334790_016947_389_499 | 3300033887 | Soil | MMAYVVSDGRVFALKPSEWSMLLVGVTICGFVTLLF |
| Ga0326723_0205310_691_798 | 3300034090 | Peat Soil | MSYVVSEGRLFELKPSEWAMMLVGVALCGLITLLF |
| Ga0326723_0414271_310_420 | 3300034090 | Peat Soil | MMAYVVSEGRLFALKPLDWGMLLVGVALCGFVSLLF |
| Ga0326723_0510084_365_475 | 3300034090 | Peat Soil | MMAYVVSEGRLFALKPSEWSMLLAGVAICGVATLLF |
| Ga0326723_0609007_365_475 | 3300034090 | Peat Soil | MLAYVASDGRLFALKPSEWAMLLVGVAVCGFLTMLF |
| Ga0314782_139793_470_583 | 3300034661 | Soil | RMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF |
| Ga0373958_0008501_1541_1663 | 3300034819 | Rhizosphere Soil | MQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLL |
| ⦗Top⦘ |