| Basic Information | |
|---|---|
| Family ID | F022948 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKIVETAEIAPTCHAGYKLVETAEVAPTCHNFSLVETTEVAPTCH |
| Number of Associated Samples | 154 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.08 % |
| % of genes near scaffold ends (potentially truncated) | 24.53 % |
| % of genes from short scaffolds (< 2000 bps) | 71.23 % |
| Associated GOLD sequencing projects | 141 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.868 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.321 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.868 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.075 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.18% Coil/Unstructured: 80.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF05114 | DUF692 | 32.55 |
| PF10017 | Methyltransf_33 | 2.36 |
| PF01979 | Amidohydro_1 | 1.89 |
| PF00484 | Pro_CA | 1.42 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.94 |
| PF13313 | DUF4082 | 0.94 |
| PF13602 | ADH_zinc_N_2 | 0.94 |
| PF12802 | MarR_2 | 0.94 |
| PF00550 | PP-binding | 0.94 |
| PF07238 | PilZ | 0.47 |
| PF01370 | Epimerase | 0.47 |
| PF03819 | MazG | 0.47 |
| PF13401 | AAA_22 | 0.47 |
| PF00378 | ECH_1 | 0.47 |
| PF01850 | PIN | 0.47 |
| PF02777 | Sod_Fe_C | 0.47 |
| PF00248 | Aldo_ket_red | 0.47 |
| PF08471 | Ribonuc_red_2_N | 0.47 |
| PF03102 | NeuB | 0.47 |
| PF13632 | Glyco_trans_2_3 | 0.47 |
| PF02518 | HATPase_c | 0.47 |
| PF14158 | YndJ | 0.47 |
| PF00291 | PALP | 0.47 |
| PF03699 | UPF0182 | 0.47 |
| PF01406 | tRNA-synt_1e | 0.47 |
| PF13735 | tRNA_NucTran2_2 | 0.47 |
| PF04069 | OpuAC | 0.47 |
| PF11741 | AMIN | 0.47 |
| PF02801 | Ketoacyl-synt_C | 0.47 |
| PF00535 | Glycos_transf_2 | 0.47 |
| PF00118 | Cpn60_TCP1 | 0.47 |
| PF13589 | HATPase_c_3 | 0.47 |
| PF01041 | DegT_DnrJ_EryC1 | 0.47 |
| PF00903 | Glyoxalase | 0.47 |
| PF07859 | Abhydrolase_3 | 0.47 |
| PF13847 | Methyltransf_31 | 0.47 |
| PF13194 | DUF4010 | 0.47 |
| PF00989 | PAS | 0.47 |
| PF00072 | Response_reg | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG3220 | Uncharacterized conserved protein, UPF0276 family | Function unknown [S] | 32.55 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 1.42 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.47 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.47 |
| COG2089 | Sialic acid synthase SpsE, contains C-terminal SAF domain | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.47 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.47 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.47 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.47 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.47 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.47 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.47 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.87 % |
| Unclassified | root | N/A | 6.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_134069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300000567|JGI12270J11330_10011672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5795 | Open in IMG/M |
| 3300001356|JGI12269J14319_10002876 | All Organisms → cellular organisms → Bacteria | 16405 | Open in IMG/M |
| 3300001356|JGI12269J14319_10007998 | All Organisms → cellular organisms → Bacteria | 8930 | Open in IMG/M |
| 3300001593|JGI12635J15846_10916722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300002568|C688J35102_118140510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300002568|C688J35102_120935351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2566 | Open in IMG/M |
| 3300004080|Ga0062385_11005724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300004091|Ga0062387_100710874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300004092|Ga0062389_101042570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300004092|Ga0062389_101909455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300004100|Ga0058904_1358962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300004476|Ga0068966_1479715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L48C026A00 | 1047 | Open in IMG/M |
| 3300005167|Ga0066672_10040415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2619 | Open in IMG/M |
| 3300005167|Ga0066672_10267437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300005171|Ga0066677_10265405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300005174|Ga0066680_10324059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300005175|Ga0066673_10000006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 35459 | Open in IMG/M |
| 3300005175|Ga0066673_10445890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300005176|Ga0066679_10041649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2598 | Open in IMG/M |
| 3300005176|Ga0066679_10968275 | Not Available | 532 | Open in IMG/M |
| 3300005179|Ga0066684_10488526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300005184|Ga0066671_10334965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300005184|Ga0066671_10889493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300005186|Ga0066676_10165561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300005186|Ga0066676_10232649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300005434|Ga0070709_10118332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1791 | Open in IMG/M |
| 3300005435|Ga0070714_100065034 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
| 3300005436|Ga0070713_100135820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2173 | Open in IMG/M |
| 3300005436|Ga0070713_100349648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300005436|Ga0070713_102448369 | Not Available | 504 | Open in IMG/M |
| 3300005446|Ga0066686_10504974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300005447|Ga0066689_10222400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 1153 | Open in IMG/M |
| 3300005454|Ga0066687_10040051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2123 | Open in IMG/M |
| 3300005454|Ga0066687_10383237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300005458|Ga0070681_10337942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300005468|Ga0070707_100467540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300005518|Ga0070699_100864673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300005518|Ga0070699_101576628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005529|Ga0070741_10000768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 108133 | Open in IMG/M |
| 3300005529|Ga0070741_10134278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2523 | Open in IMG/M |
| 3300005533|Ga0070734_10010883 | All Organisms → cellular organisms → Bacteria | 6689 | Open in IMG/M |
| 3300005534|Ga0070735_10528109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300005536|Ga0070697_100088475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2558 | Open in IMG/M |
| 3300005537|Ga0070730_10069657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2485 | Open in IMG/M |
| 3300005537|Ga0070730_10078778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2311 | Open in IMG/M |
| 3300005542|Ga0070732_10675109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300005575|Ga0066702_10998381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300005587|Ga0066654_10613000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005891|Ga0075283_1000093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6327 | Open in IMG/M |
| 3300005892|Ga0075275_1027007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300006028|Ga0070717_11636300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300006032|Ga0066696_10327267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300006046|Ga0066652_100892176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300006173|Ga0070716_100591932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300006175|Ga0070712_100772366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300006354|Ga0075021_10293773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300006755|Ga0079222_10207036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300006804|Ga0079221_10182081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300006804|Ga0079221_11296569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300006893|Ga0073928_10032998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4932 | Open in IMG/M |
| 3300006893|Ga0073928_10115675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2221 | Open in IMG/M |
| 3300006893|Ga0073928_10688361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300006914|Ga0075436_100313060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
| 3300007076|Ga0075435_101198893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300007076|Ga0075435_101515287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300007788|Ga0099795_10657764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300009012|Ga0066710_103301264 | Not Available | 616 | Open in IMG/M |
| 3300009038|Ga0099829_10116054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2102 | Open in IMG/M |
| 3300009038|Ga0099829_10144327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1895 | Open in IMG/M |
| 3300009521|Ga0116222_1099939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300009524|Ga0116225_1371606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300009683|Ga0116224_10123845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
| 3300009698|Ga0116216_10575912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300009700|Ga0116217_10008905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8534 | Open in IMG/M |
| 3300009824|Ga0116219_10246958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300010303|Ga0134082_10178046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300010339|Ga0074046_10708363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300010343|Ga0074044_10028649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3946 | Open in IMG/M |
| 3300010360|Ga0126372_12043138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300010361|Ga0126378_12486257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300010371|Ga0134125_11488428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300010371|Ga0134125_12910928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300010373|Ga0134128_10083212 | All Organisms → cellular organisms → Bacteria | 3652 | Open in IMG/M |
| 3300010376|Ga0126381_100042566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5515 | Open in IMG/M |
| 3300010379|Ga0136449_100855083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1492 | Open in IMG/M |
| 3300011078|Ga0138565_1158531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300011120|Ga0150983_11916519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1823 | Open in IMG/M |
| 3300012212|Ga0150985_114549318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300012349|Ga0137387_10024866 | All Organisms → cellular organisms → Bacteria | 3787 | Open in IMG/M |
| 3300012683|Ga0137398_11076693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300012975|Ga0134110_10013538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3113 | Open in IMG/M |
| 3300013104|Ga0157370_10243154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
| 3300014150|Ga0134081_10413597 | Not Available | 508 | Open in IMG/M |
| 3300014156|Ga0181518_10002013 | All Organisms → cellular organisms → Bacteria | 20002 | Open in IMG/M |
| 3300014166|Ga0134079_10594558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300015357|Ga0134072_10009779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2197 | Open in IMG/M |
| 3300017821|Ga0187812_1042109 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300017821|Ga0187812_1082025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300017821|Ga0187812_1196701 | Not Available | 645 | Open in IMG/M |
| 3300017822|Ga0187802_10090588 | Not Available | 1145 | Open in IMG/M |
| 3300017823|Ga0187818_10002722 | All Organisms → cellular organisms → Bacteria | 7422 | Open in IMG/M |
| 3300017823|Ga0187818_10035733 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| 3300017823|Ga0187818_10191924 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 891 | Open in IMG/M |
| 3300017823|Ga0187818_10312727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300017823|Ga0187818_10589675 | Not Available | 502 | Open in IMG/M |
| 3300017930|Ga0187825_10000285 | All Organisms → cellular organisms → Bacteria | 11485 | Open in IMG/M |
| 3300017930|Ga0187825_10189697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300017932|Ga0187814_10122254 | Not Available | 965 | Open in IMG/M |
| 3300017933|Ga0187801_10043931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1608 | Open in IMG/M |
| 3300017933|Ga0187801_10186223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300017934|Ga0187803_10038982 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300017942|Ga0187808_10077556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300017943|Ga0187819_10392129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300017955|Ga0187817_10240088 | Not Available | 1154 | Open in IMG/M |
| 3300017955|Ga0187817_10315273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300017955|Ga0187817_10353835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300017955|Ga0187817_10413066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300017955|Ga0187817_10552797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 734 | Open in IMG/M |
| 3300017959|Ga0187779_10839893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300017961|Ga0187778_10090257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1897 | Open in IMG/M |
| 3300017961|Ga0187778_10140802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1517 | Open in IMG/M |
| 3300017966|Ga0187776_10119708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
| 3300017970|Ga0187783_10038617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3537 | Open in IMG/M |
| 3300017972|Ga0187781_10119381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1838 | Open in IMG/M |
| 3300017973|Ga0187780_10027574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4019 | Open in IMG/M |
| 3300017973|Ga0187780_10079001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2261 | Open in IMG/M |
| 3300018001|Ga0187815_10059938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
| 3300018001|Ga0187815_10121577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300018027|Ga0184605_10002163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6563 | Open in IMG/M |
| 3300018058|Ga0187766_10379601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300018062|Ga0187784_10937752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300018064|Ga0187773_10662030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300018085|Ga0187772_10177914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1420 | Open in IMG/M |
| 3300018085|Ga0187772_10322148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300018086|Ga0187769_10007640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6746 | Open in IMG/M |
| 3300018088|Ga0187771_10077797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2636 | Open in IMG/M |
| 3300018088|Ga0187771_10779147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300018089|Ga0187774_10123702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
| 3300018090|Ga0187770_10070172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2565 | Open in IMG/M |
| 3300018431|Ga0066655_10015837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3400 | Open in IMG/M |
| 3300018431|Ga0066655_10295808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300018431|Ga0066655_10947700 | Not Available | 591 | Open in IMG/M |
| 3300018433|Ga0066667_10035736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2851 | Open in IMG/M |
| 3300018433|Ga0066667_10047073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2573 | Open in IMG/M |
| 3300018433|Ga0066667_10084999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2052 | Open in IMG/M |
| 3300018468|Ga0066662_10522477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300018482|Ga0066669_10632751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300019284|Ga0187797_1387314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300020579|Ga0210407_10201875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1545 | Open in IMG/M |
| 3300020580|Ga0210403_10003897 | All Organisms → cellular organisms → Bacteria | 12986 | Open in IMG/M |
| 3300020581|Ga0210399_10007143 | All Organisms → cellular organisms → Bacteria | 8741 | Open in IMG/M |
| 3300020581|Ga0210399_10703277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300021170|Ga0210400_10738561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300021344|Ga0193719_10064771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1587 | Open in IMG/M |
| 3300021358|Ga0213873_10315827 | Not Available | 507 | Open in IMG/M |
| 3300021377|Ga0213874_10265062 | Not Available | 637 | Open in IMG/M |
| 3300021432|Ga0210384_10043035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4138 | Open in IMG/M |
| 3300022557|Ga0212123_10133314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1949 | Open in IMG/M |
| 3300022557|Ga0212123_10215236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
| 3300025912|Ga0207707_10579514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300025912|Ga0207707_11072925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300025915|Ga0207693_10865926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300025922|Ga0207646_10882290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300025994|Ga0208142_1016807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300026324|Ga0209470_1206875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300026326|Ga0209801_1343816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300026334|Ga0209377_1226956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 615 | Open in IMG/M |
| 3300026529|Ga0209806_1070985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
| 3300026550|Ga0209474_10054536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2844 | Open in IMG/M |
| 3300026550|Ga0209474_10626146 | Not Available | 552 | Open in IMG/M |
| 3300027604|Ga0208324_1012038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2789 | Open in IMG/M |
| 3300027625|Ga0208044_1142414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300027641|Ga0208827_1119917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300027698|Ga0209446_1186839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300027783|Ga0209448_10126581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300027826|Ga0209060_10018546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3710 | Open in IMG/M |
| 3300027854|Ga0209517_10134291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1608 | Open in IMG/M |
| 3300027857|Ga0209166_10058704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2218 | Open in IMG/M |
| 3300027875|Ga0209283_10173085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300027894|Ga0209068_10198233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300027905|Ga0209415_10765836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300028792|Ga0307504_10085865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300029636|Ga0222749_10251406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300030659|Ga0316363_10003087 | All Organisms → cellular organisms → Bacteria | 12149 | Open in IMG/M |
| 3300030975|Ga0099845_1566589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300031715|Ga0307476_10153814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1654 | Open in IMG/M |
| 3300031718|Ga0307474_10415706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1048 | Open in IMG/M |
| 3300031720|Ga0307469_10368121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300031720|Ga0307469_10886532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300031754|Ga0307475_10279932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1338 | Open in IMG/M |
| 3300031962|Ga0307479_10007534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10035 | Open in IMG/M |
| 3300031962|Ga0307479_10178220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2090 | Open in IMG/M |
| 3300032160|Ga0311301_11802808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300032205|Ga0307472_100039089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2845 | Open in IMG/M |
| 3300032261|Ga0306920_102336936 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032261|Ga0306920_103370297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300032783|Ga0335079_10008238 | All Organisms → cellular organisms → Bacteria | 11879 | Open in IMG/M |
| 3300032783|Ga0335079_10171100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2426 | Open in IMG/M |
| 3300032805|Ga0335078_10036209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7327 | Open in IMG/M |
| 3300032805|Ga0335078_10155504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3229 | Open in IMG/M |
| 3300032805|Ga0335078_10796427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300032828|Ga0335080_10048036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4712 | Open in IMG/M |
| 3300032828|Ga0335080_11062508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300032828|Ga0335080_11851260 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032892|Ga0335081_10003278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 25445 | Open in IMG/M |
| 3300032892|Ga0335081_10160532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3193 | Open in IMG/M |
| 3300032892|Ga0335081_10489639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300032892|Ga0335081_12189370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300032892|Ga0335081_12240151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300033158|Ga0335077_10162484 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300033158|Ga0335077_10805519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 956 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 11.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.32% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.30% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.83% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.42% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.47% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.47% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025994 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02440660 | 2199352024 | Soil | MKIIDIAEVAPTCHSNVKLVETAEVAPTCHTEVKLVESAETAPTCH |
| JGI12270J11330_100116724 | 3300000567 | Peatlands Soil | MKIVETVELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH* |
| JGI12269J14319_100028765 | 3300001356 | Peatlands Soil | MKIVETAEIAPTCHVGYKLVETAEIAPTCHNFSLVDTTEVAPTCH* |
| JGI12269J14319_100079981 | 3300001356 | Peatlands Soil | GLAVTLRRLEQMKIVETAELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH* |
| JGI12635J15846_109167222 | 3300001593 | Forest Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVEST |
| C688J35102_1181405101 | 3300002568 | Soil | IIEISEVAPTCHSNLKLVETAEVTPTCHNNVRLVETAEVAPTCH* |
| C688J35102_1209353513 | 3300002568 | Soil | MKILEISEIAPTCHSNMKLVETAEVAPTCHNNVKLVESTEVAPTCH* |
| Ga0062385_110057242 | 3300004080 | Bog Forest Soil | QMKIVETAELAPTCHAGCKLVETAEIAPTCHNFSLVGTTEVAPTCH* |
| Ga0062387_1007108742 | 3300004091 | Bog Forest Soil | MKIVELQLAPTCHAGCKLVETAEIAPTCHNFSLVGTTEVAPTCH* |
| Ga0062389_1010425702 | 3300004092 | Bog Forest Soil | MKIVETAELAPTCHAGCKLVETAEIAPTCHNFSLVGTTEVAPTCH* |
| Ga0062389_1019094552 | 3300004092 | Bog Forest Soil | MKIVETAEIAPTCHVGYKLVETAEIAPTCHNFSLVETTEVAPTCH* |
| Ga0058904_13589622 | 3300004100 | Forest Soil | MKIIEIGEIAPTCHSTVKLVETAEVAPTCHSNVKLVESMEVAPTCH* |
| Ga0068966_14797151 | 3300004476 | Peatlands Soil | MKIVETAELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH* |
| Ga0066672_100404152 | 3300005167 | Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTEVAPTCH* |
| Ga0066672_102674372 | 3300005167 | Soil | MKIVEITEVAATCHANMKLVETTEVAATCHNARLVESTEVAPTCH* |
| Ga0066677_102654052 | 3300005171 | Soil | MKIVEVSEIAPTCHSNLKLVETSEVAATCHSNLKVVETAEIAPTCH* |
| Ga0066680_103240592 | 3300005174 | Soil | MKIVEISEVAPTCHNNFKLVESAEVVPTCHNNYKLVESTEVAPTCH* |
| Ga0066673_1000000621 | 3300005175 | Soil | MKIIEISEVAPTSHSNLRLVETAEVAPTCHNGLKLVESTEVAPTCH* |
| Ga0066673_104458902 | 3300005175 | Soil | MKIVEITEVAPTCHANMKLVETTEVAATCHNARLVESTEVAPTCH* |
| Ga0066679_100416491 | 3300005176 | Soil | MKIIEISEVAPTCHSNVKLVETAEVAPTCHNSVKLVESTEVAPTCH* |
| Ga0066679_109682752 | 3300005176 | Soil | MKILEISEVAPTCHSNVKLVETAEVAPTCHNNLKLVESAEVAPTCH* |
| Ga0066684_104885262 | 3300005179 | Soil | MKIIEISEVAPTCHSNMKLVETVEVAPTCHTDVKLVESAEIAPTCH* |
| Ga0066671_103349652 | 3300005184 | Soil | MKIIEISEVAPTCHSNMKLVETAEVAPTCHTNVKLVESAEIAPTCH* |
| Ga0066671_108894932 | 3300005184 | Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHSNFKLVESTEVAP |
| Ga0066676_101655611 | 3300005186 | Soil | VEISEVAPTCHSNFKLVETAEVSPTCHSNFKLVESTEVAPTCH* |
| Ga0066676_102326492 | 3300005186 | Soil | MKIIEISEVAPTCHSNLKLVETAEVTPTCHNNVRLVETAEVAPTCH* |
| Ga0070709_101183323 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQEDVMKIVETSEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH* |
| Ga0070714_1000650342 | 3300005435 | Agricultural Soil | MRSQEDVMKIVETSEVSPTCHANFQLVETAEVSPTCHAEFKLVEAAEVAPTCH* |
| Ga0070713_1001358202 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIMETTEIAPTCHSSIKLVETAEVAPTCHNNVKLVESTEVAPTCH* |
| Ga0070713_1003496482 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIVETSEVSPTCHANFQLVETAEVSPACHAEFKLVEAAEVAPTCH* |
| Ga0070713_1024483691 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIVETSEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH* |
| Ga0066686_105049742 | 3300005446 | Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHSNFKLVESTEVAPTCH* |
| Ga0066689_102224001 | 3300005447 | Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTEVAP |
| Ga0066687_100400512 | 3300005454 | Soil | MKIVEIGEVTPTCHSNFKLVETAEVNATCHSDFKLVESAEVAPTCH* |
| Ga0066687_103832372 | 3300005454 | Soil | MKIIEISEVAPTCHSNMKLVDTVEVAPTCHTNVKLVESAEIAPTCH* |
| Ga0070681_103379422 | 3300005458 | Corn Rhizosphere | MCSQEDVMKIVETAEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEIAPTCH* |
| Ga0070707_1004675401 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEVTPTCHNNFKLVETAEVAPTCHNNYKLVESTEVAPTCH* |
| Ga0070699_1008646731 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQEDVMKIVETTEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH* |
| Ga0070699_1015766281 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSQEDVMKIVETSEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEIAPTCH* |
| Ga0070741_1000076829 | 3300005529 | Surface Soil | MKVVEISDVAPACHNFKLVETAEVAPTCHSHFKLVETSETAPTCH* |
| Ga0070741_101342782 | 3300005529 | Surface Soil | MKLVETSELAPTCHTSYKLVETAEVAPTCHSSFKLVDTAEVAPTCH* |
| Ga0070734_100108837 | 3300005533 | Surface Soil | MKIVETSEIAPTCHSQIQLVETAEVSATCHADFKLVEAAEVAPTCH* |
| Ga0070735_105281091 | 3300005534 | Surface Soil | MKIVEISEVAPTCHSNIKLVETAEVAPTCHNNVKLVESAEVAPTCH* |
| Ga0070697_1000884753 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIVEISEVAPTCHNNFKLVETAEVSPTCHNNFKLVESTEVAPTCH* |
| Ga0070730_100696573 | 3300005537 | Surface Soil | MKILEISEVAPACHSNVELVETAEVAPTCHNNVKLVESTEVAPTCH* |
| Ga0070730_100787782 | 3300005537 | Surface Soil | MKIIEVSEIAPTCHSTVKLVETAEVAPTCHNNVKLVESAEVAPTCH* |
| Ga0070732_106751092 | 3300005542 | Surface Soil | MKIIEVNEVAPTCHSNVKLVETAEVAPTCHSNVRLVESAEVAPTCH* |
| Ga0066702_109983812 | 3300005575 | Soil | MKILEISEIAPTCHSNVKLVESVEVAPTCHNNLKLVEGTEVAPTCH* |
| Ga0066654_106130002 | 3300005587 | Soil | MKIIEISEVAPTCHSNIKLVETAEVAPTCHNSVKLVESTEVAPTCH* |
| Ga0075283_10000935 | 3300005891 | Rice Paddy Soil | MCSQEDVMKIVETTEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH* |
| Ga0075275_10270071 | 3300005892 | Rice Paddy Soil | GRAVMCSQEDVMKIVETTEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH* |
| Ga0070717_116363002 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIIEISEVAPTCHSSVKLVETAEVAPTCHSNVKLVESIEVAPTCH* |
| Ga0066696_103272672 | 3300006032 | Soil | MKIVEITEVAPTCHAHMKLVETTEVAATCHNARLVESTEVAPTCH* |
| Ga0066652_1008921761 | 3300006046 | Soil | AIGGNIMKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTEVAPTCH* |
| Ga0070716_1005919322 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIVETTEIAPTCHSNIKLVETAEVAPTCHNNVKLVESTEVAPTCH* |
| Ga0070712_1007723662 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIIEISEVAPTCHSNVKLVETAEVAPTCHSSVKLVESTEVAPTCH* |
| Ga0075021_102937731 | 3300006354 | Watersheds | EMAPTCHAGYKLVETAEVAPTCHNFNLVETTEVAPTCH* |
| Ga0079222_102070363 | 3300006755 | Agricultural Soil | APTCHSNIKVVETTEVAPTCHNNVQLVESTEVAPMCH* |
| Ga0079221_101820811 | 3300006804 | Agricultural Soil | MRSQEDVMKIVETSEVSPTCHANFQLVETAEVSPACHAEFKLVEAAEVAPTCH* |
| Ga0079221_112965692 | 3300006804 | Agricultural Soil | VETMEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH* |
| Ga0073928_100329982 | 3300006893 | Iron-Sulfur Acid Spring | MKIVEISEIAPTCHSNLKLVETTEVAATCHSNMNVVETAEMAPTCH* |
| Ga0073928_101156752 | 3300006893 | Iron-Sulfur Acid Spring | MKIVEISEIAPTCHSNLKLVESTEVAATCHSNMSVVETAEVAPTCH* |
| Ga0073928_106883611 | 3300006893 | Iron-Sulfur Acid Spring | MKIIELSEIAPTCHSTVKLVETAEVAPTCHSNVKLVESAEIASTCH* |
| Ga0075436_1003130602 | 3300006914 | Populus Rhizosphere | MCSQEDVMKIVETAEIAPTCHSNFKLVETAEVSPTCHAEFKLVETAEVAPTCH* |
| Ga0075435_1011988931 | 3300007076 | Populus Rhizosphere | MKIVETSEVSPTCHANFQLVETAEVSPACHAEFKLVEAAEVAPTCH |
| Ga0075435_1015152872 | 3300007076 | Populus Rhizosphere | VEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTEVAPTCH* |
| Ga0099795_106577642 | 3300007788 | Vadose Zone Soil | MKILEISEIAPTCHSNVKLVETAEVAPTCHNNVKLVESTEI |
| Ga0066710_1033012641 | 3300009012 | Grasslands Soil | MKIIEISEVAPTSHPNLRLVETAEVAPTCHNGLKLVESTEVAPTCH |
| Ga0099829_101160544 | 3300009038 | Vadose Zone Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTE |
| Ga0099829_101443273 | 3300009038 | Vadose Zone Soil | MKIVEVSEVTPTCHNNFKLVETAEVAPTCHNNYKLVESTEVAPTCH* |
| Ga0116222_10999392 | 3300009521 | Peatlands Soil | MKIVETTEIAPTCHVGYKLVETAEIAPTCHNFSLVDTTEVAPTCH* |
| Ga0116225_13716062 | 3300009524 | Peatlands Soil | LAVTLRRLEEMKILETAELVPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH* |
| Ga0116224_101238451 | 3300009683 | Peatlands Soil | MKIVETAELAPTCHASCKLVETAEVAPTCHNFNVVETTEVAPTCH* |
| Ga0116216_105759121 | 3300009698 | Peatlands Soil | MKIVETAELAPTCHAGCKLVETAEIAPTCHNFSVVETTEVAPTCD* |
| Ga0116217_100089051 | 3300009700 | Peatlands Soil | YIRRRLAQMKIVETVELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH* |
| Ga0116219_102469582 | 3300009824 | Peatlands Soil | MKIVETAELAPTCHAGCKLVETAEVAPTCHNFSVVET |
| Ga0134082_101780462 | 3300010303 | Grasslands Soil | MKIVEISEVAPTCHSNFKLVETVEVSPTCHNNFKLVEITEVAPTCH* |
| Ga0074046_107083631 | 3300010339 | Bog Forest Soil | MKIVETAELAPTCHAGCKLVETAEVAPTCHNFSLVETTEVAPTCH* |
| Ga0074044_100286492 | 3300010343 | Bog Forest Soil | MKIVETAELAPTCHAGCKLVETAEIAPTCHNFSVVETTEVAPTCH* |
| Ga0126372_120431382 | 3300010360 | Tropical Forest Soil | CHSNVKLVETAEVAPTCHNSVKLVESTEVAPTCH* |
| Ga0126378_124862572 | 3300010361 | Tropical Forest Soil | MKPVEITEVAPTCHTNMKLVEVAEVAPTCHTAKLVESTEVAPTCH* |
| Ga0134125_114884282 | 3300010371 | Terrestrial Soil | MKIIDIAEVAPTCHSNVKLVETAEVAPTCHSEVKLVESAETAPTCH* |
| Ga0134125_129109282 | 3300010371 | Terrestrial Soil | MKIIDIAEVAPTCHTNVKLVETAEVAPTCHSNVKPVESAETAPTCH* |
| Ga0134128_100832122 | 3300010373 | Terrestrial Soil | MKIIDIAEVAPTCHSNVKLVETAEVAPTCHSNVKPVESAETAPTCH* |
| Ga0126381_1000425664 | 3300010376 | Tropical Forest Soil | MKIVEISEVAPTCHSNVKLVETAEVAPTCHNNVRLVESTEVAPTCH* |
| Ga0136449_1008550832 | 3300010379 | Peatlands Soil | MKIVETAELAPTCHASCKLVETAEITPTCHNFSLVETTEVAPTCH* |
| Ga0138565_11585312 | 3300011078 | Peatlands Soil | VTLRRLEQMKIVETVELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH* |
| Ga0150983_119165191 | 3300011120 | Forest Soil | MKILEISEVAPTCHSNIKLVETAEVAPTCHNNVKLVESTEVAPTCH* |
| Ga0150985_1145493181 | 3300012212 | Avena Fatua Rhizosphere | MKIIEVSEIAPTCHSTVKLVETAEVAPTCHNNVKLVESAETAPTCH* |
| Ga0137387_100248666 | 3300012349 | Vadose Zone Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTQVAPTCH* |
| Ga0137398_110766932 | 3300012683 | Vadose Zone Soil | MKILEISEIAPTCHSNVKLVETAEVAPTCHNNVTLVESTEIAPTCH* |
| Ga0134110_100135382 | 3300012975 | Grasslands Soil | MKIIEISEVAPTSHSNLRLVETAEVAPTYHNGLKLVESTEVAPTCH* |
| Ga0157370_102431541 | 3300013104 | Corn Rhizosphere | MCSQEDVMKIVETAEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH* |
| Ga0134081_104135972 | 3300014150 | Grasslands Soil | MKIVEITEVTPTCHANMKLVETTEVAATCHNARLVESTEVAPTCH* |
| Ga0181518_1000201311 | 3300014156 | Bog | MKNVETAELAPTCHAGCKLVETAEIAPTCHNFSVVETTEVAPTCH* |
| Ga0134079_105945582 | 3300014166 | Grasslands Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVE |
| Ga0134072_100097792 | 3300015357 | Grasslands Soil | MKIIEISEVAPTSHSNVRLVETAEVAPTCHNGLKLVESTEVAPTCH* |
| Ga0187812_10421092 | 3300017821 | Freshwater Sediment | MKIVETAELAPTSYAGCKLEETAEVAPPCHNLSVVETTEVAPTCH |
| Ga0187812_10820252 | 3300017821 | Freshwater Sediment | MKIVETAEMAPTCHASYKLVETAEVAPTCHNLSVVETTEVAPTCH |
| Ga0187812_11967013 | 3300017821 | Freshwater Sediment | MKIVETAEIAPTCHAGYKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0187802_100905882 | 3300017822 | Freshwater Sediment | MKIVETAELAPTCHAGCKLVETAEIAPTCHNFSLVETTEVSPTCH |
| Ga0187818_100027225 | 3300017823 | Freshwater Sediment | MKIVETAELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0187818_100357332 | 3300017823 | Freshwater Sediment | MKIVETAELAPTCHAGCKLVETAEVAPTCHNLSLVETTEVAPTCH |
| Ga0187818_101919242 | 3300017823 | Freshwater Sediment | MKIVETTEIAPTCHAGCKLVETAEVAPTCHNLSLVETTEVAPTCH |
| Ga0187818_103127272 | 3300017823 | Freshwater Sediment | MKIVETTEIAPTCHAGYKLVETAEVAPTCHNLSLVETTEVAPTCH |
| Ga0187818_105896751 | 3300017823 | Freshwater Sediment | GSPTRRLAQMKIVETTEIAPTCHAGYKLVETTEVAPTCHNFSVVETTEVAPTCH |
| Ga0187825_1000028510 | 3300017930 | Freshwater Sediment | MRSQEDVMKIVETTEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH |
| Ga0187825_101896972 | 3300017930 | Freshwater Sediment | MRSQEDVMKIVETSEIAPTCHSNFKLVETSEVSPTCHADFKLVETAEVAPTCH |
| Ga0187814_101222541 | 3300017932 | Freshwater Sediment | MKIVETAELAPTCHAGCKLVETAEVAPTCHNFSLVETTEVAPTCH |
| Ga0187801_100439312 | 3300017933 | Freshwater Sediment | MKIVETAEIAPTCHAGYKLVETAEVAPTCHNFSLVETTEVAPTCH |
| Ga0187801_101862231 | 3300017933 | Freshwater Sediment | TTEIAPTCHAGYKLVETAEVAPTCHNLSLVETTEVAPTCH |
| Ga0187803_100389822 | 3300017934 | Freshwater Sediment | MKIVETTEIAPTCHAGYKLVETTEVAPTCHNFSVVETTEVAPTCH |
| Ga0187808_100775561 | 3300017942 | Freshwater Sediment | KIVETAEMAPTCHAGYKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0187819_103921291 | 3300017943 | Freshwater Sediment | MKIVEIAEMAPTCHAGYKLVETAEVAPTCHNFSLV |
| Ga0187817_102400883 | 3300017955 | Freshwater Sediment | MKIVETTEIAPTCHAGYKLVETAEVAPTCHNLSLVE |
| Ga0187817_103152732 | 3300017955 | Freshwater Sediment | MKIVETAEFAPTCHAGYKLVETAEVAPTCHNFNLVETTEVAPTCH |
| Ga0187817_103538352 | 3300017955 | Freshwater Sediment | MKIVETAELAPTCHAGYKLVETAEVAPTCHNLSLVETTEVAPTCH |
| Ga0187817_104130661 | 3300017955 | Freshwater Sediment | APTCHAGYKLVETAEVAPTCHNLSLVETTEVAPTCH |
| Ga0187817_105527972 | 3300017955 | Freshwater Sediment | LAPTCHAGCKLVETAEIAPTCHNFSLVETTEVSPTCH |
| Ga0187779_108398932 | 3300017959 | Tropical Peatland | MKIVETAELAPTCHAGCKLVETAEVAPTCHNFNLVETTEVAPTCH |
| Ga0187778_100902572 | 3300017961 | Tropical Peatland | MKIVETAELAPTCHASYKLVETAEVAPTCHNLSVVETTEVAPTCH |
| Ga0187778_101408022 | 3300017961 | Tropical Peatland | MKIVETAELAPTCHAGYKLVETAEVAPTCHNFSLVETTEVTPTCH |
| Ga0187776_101197082 | 3300017966 | Tropical Peatland | MKIVETAEIAPTCHAGCTLVETAEVAPTCHNISLVETTEVAPTCH |
| Ga0187783_100386173 | 3300017970 | Tropical Peatland | MKIVETTEIAPTCHAGYKLVETAEVAPTCHNFSLVETTEVAPTCH |
| Ga0187781_101193812 | 3300017972 | Tropical Peatland | MKIVETAELAPTCHAGCKLVETAEIAPTCHNFSLVETTEVAPTCH |
| Ga0187780_100275742 | 3300017973 | Tropical Peatland | MKIVETTEIAPTCHAGCKLVETAEVAPTCHNFSLVETTEVAPTCH |
| Ga0187780_100790013 | 3300017973 | Tropical Peatland | MKIVETAELAPTCHAGYKLVETAEIAPTCHNLSLVDTTEVAPTCH |
| Ga0187815_100599381 | 3300018001 | Freshwater Sediment | QMKIVETAELAPTCHTGCKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0187815_101215772 | 3300018001 | Freshwater Sediment | MKIVEIAEMAPTCHAGYKLVETAEVAPTCHNFSLVETTEVAPTCH |
| Ga0184605_100021635 | 3300018027 | Groundwater Sediment | MKIVEISEVAPTCHSNFKLVETAEVSPTCHSNFKLVESTEVAPTCH |
| Ga0187766_103796011 | 3300018058 | Tropical Peatland | MKIVETAEMAPTCHAGYKLVETAEVAPTCHNFSLVETTEVAPTCH |
| Ga0187784_109377522 | 3300018062 | Tropical Peatland | MKIVETAELAPTCHAGYKLVETAEVAPTCHNLSLVETAEVAPTCH |
| Ga0187773_106620302 | 3300018064 | Tropical Peatland | MKIVETVEIAPTCHAGYRLVETAEVAPTCHNFSLVETTEVTPTCH |
| Ga0187772_101779142 | 3300018085 | Tropical Peatland | MKIVETAELAPTCHAGYKLVETAEVAPTCHNLSLVETTEVTPTCH |
| Ga0187772_103221481 | 3300018085 | Tropical Peatland | VETTEIAPTCHAGYKLVETAEVAPTCHNLSLVETAEVAPTCH |
| Ga0187769_100076407 | 3300018086 | Tropical Peatland | MKIVETAELAPTCHASYKLVETAEVVPTCHNFSVVETTEVAPTCH |
| Ga0187771_100777971 | 3300018088 | Tropical Peatland | MKIVETTEIAPTCHAGYKLVETAEVAPTCHNFSPVETTEVAPTCH |
| Ga0187771_107791472 | 3300018088 | Tropical Peatland | MKIVETAEIAPTCHAGYKLVETAEVVPTCHNLSLVETTEVAPTCH |
| Ga0187774_101237022 | 3300018089 | Tropical Peatland | MKIVETAEMAPTCHAGYKLVETEEVAPTCHNFSLVETTEVAPTCH |
| Ga0187770_100701724 | 3300018090 | Tropical Peatland | MKIVETAELAPTCHAGYKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0066655_100158372 | 3300018431 | Grasslands Soil | MKIIEISEVAPTSHSNLRLVETAEVAPTCHNGLKLVESTEVAPICTGLSAC |
| Ga0066655_102958082 | 3300018431 | Grasslands Soil | MKIVEITEVAPTCHANMKLVETTEVAATCHNARLVESTEVAPTCH |
| Ga0066655_109477001 | 3300018431 | Grasslands Soil | MKIVEITEVAATCHANMKLVETTEVAPTCHNARLVESREVAPACH |
| Ga0066667_100357363 | 3300018433 | Grasslands Soil | MKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTEVAPTCH |
| Ga0066667_100470732 | 3300018433 | Grasslands Soil | MKIVEITEVAATCHANMKLVETTEVAATCHNARLVESTEVAPTCH |
| Ga0066667_100849993 | 3300018433 | Grasslands Soil | MKIIEISEVAPTSHSNLRLVETAEVAPTCHNGLKLVESTEVAPTCH |
| Ga0066662_105224772 | 3300018468 | Grasslands Soil | MKILEISEIAPTCHSNVKLVETAEVAPTCHNNVKLVESTEIAPTCH |
| Ga0066669_106327512 | 3300018482 | Grasslands Soil | MKIIEVNEVAPTCHSNMKLVDTVEVAPTCHTNVKLVESAEIAPTCH |
| Ga0187797_13873142 | 3300019284 | Peatland | TPVRRLAQMKIVETAELAPTCHAGYKLVETAEVAPTCHNLSLVETAEVAPTCH |
| Ga0210407_102018752 | 3300020579 | Soil | MKIIEIGEIAPTCHSTVKLVETAEVAPTCHSNVKLVESMEVAPTCH |
| Ga0210403_100038973 | 3300020580 | Soil | MKIIEISEVAPTCHSNVKLVEAAEVAPTCHNSVRLVESTEVAPTCH |
| Ga0210399_100071436 | 3300020581 | Soil | MKIIEISEVAPTCHSNVKLVEAADVAPTCHNSVRLVESTEVAPTCH |
| Ga0210399_107032771 | 3300020581 | Soil | MKIIEIGEIAPTCHSTVKLVETAEVAPTCHSNVKLVESTEVAPTCH |
| Ga0210400_107385611 | 3300021170 | Soil | PTCHSNIKLVETAEVAPTCHNNVKLVESTEVAPTCH |
| Ga0193719_100647712 | 3300021344 | Soil | MKIVEISEVAPTCHNNFKLVETTEVSPTCHNNFKLVESTEVAPTCH |
| Ga0213873_103158271 | 3300021358 | Rhizosphere | MKILEINEVAPACHSNVKLVETAEVAPTCHNNIKLVESAETAPTCH |
| Ga0213874_102650621 | 3300021377 | Plant Roots | MKIVEISEVAPTCHSNIKLVETAEVAPTCHSNVKLVESAEVAPTCH |
| Ga0210384_100430353 | 3300021432 | Soil | MKILEISEVAPTCHSNIKLVETAEVAPTCHNNVKLVESTEVAPTCH |
| Ga0212123_101333141 | 3300022557 | Iron-Sulfur Acid Spring | MKIVEISEIAPTCHSNLKLVESTEVAATCHSNMSVVETAEVAPTCH |
| Ga0212123_102152363 | 3300022557 | Iron-Sulfur Acid Spring | MKIVEISEIAPTCHSNLKLVETTEVAATCHSNMNVVETAEMAPTCH |
| Ga0207707_105795142 | 3300025912 | Corn Rhizosphere | MRSQEDVMKIVETSEVSPTCHANFQLVETAEVSPTCHADFKLVETAEIAPTCH |
| Ga0207707_110729252 | 3300025912 | Corn Rhizosphere | MCSQEDVMKIVETAEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEIAPTCH |
| Ga0207693_108659262 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIIEISEVAPTCHSNVKLVETAEVAPTCHSSVKLVESTEVAPTCH |
| Ga0207646_108822901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KIVEVSEVTPTCHNNFKLVETAEVAPTCHNNYKLVESTEVAPTCH |
| Ga0208142_10168072 | 3300025994 | Rice Paddy Soil | MCSQEDVMKIVETTEIAPTCHSNFKLVETAEVSPTCHADFKLVETAEVAPTCH |
| Ga0209470_12068751 | 3300026324 | Soil | IMKIVEISEVAPTCHSNFKLVETAEVSPTCHSNFKLVESTEVAPTCH |
| Ga0209801_13438162 | 3300026326 | Soil | VAPTCHSNFKLVETAEVSPTCHSNFKLVESTEVAPTCH |
| Ga0209377_12269562 | 3300026334 | Soil | MKIVEISEVAPTCHNNFKLVESAEVVPTCHNNYKLVESTEVAPTCH |
| Ga0209806_10709851 | 3300026529 | Soil | KAIGGNIMKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTEVAPTCH |
| Ga0209474_100545362 | 3300026550 | Soil | MKIVEITEVAPTCHAHMKLVETTEVAATCHNARLVESTEVAPTCH |
| Ga0209474_106261462 | 3300026550 | Soil | MKIVEITEVAPTCHANMKLVETTEVAATCHNARLVERTEVAPTCH |
| Ga0208324_10120383 | 3300027604 | Peatlands Soil | MKIVETAEIAPTCHVGYKLVETAEIAPTCHNFSLVDTTEVAPTCH |
| Ga0208044_11424142 | 3300027625 | Peatlands Soil | MKILETAELVPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0208827_11199171 | 3300027641 | Peatlands Soil | DSGKRPASTRGLAVTLRRLEQMKIVETAELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0209446_11868392 | 3300027698 | Bog Forest Soil | MKIVETAELAPTCHAGCKLVETAEIAPTCHNFSLVGTTEVAPTCH |
| Ga0209448_101265811 | 3300027783 | Bog Forest Soil | MKIVETAEIAPTCHVGYKLVETAEIAPTCHNFSLVGTTEVAPTCH |
| Ga0209060_100185464 | 3300027826 | Surface Soil | MKIVETSEIAPTCHSQIQLVETAEVSATCHADFKLVEAAEVAPTCH |
| Ga0209517_101342912 | 3300027854 | Peatlands Soil | MKIVETAELAPTCHASCKLVETAEITPTCHNFSLVETTEVAPTCH |
| Ga0209166_100587042 | 3300027857 | Surface Soil | MKIIEVSEIAPTCHSTVKLVETAEVAPTCHNNVKLVESAEVAPTCH |
| Ga0209283_101730852 | 3300027875 | Vadose Zone Soil | MKIVEISEVAPTCHNNFKLVETAEVAPTCHNNYRLVESTEVAPTCH |
| Ga0209068_101982331 | 3300027894 | Watersheds | EMAPTCHAGYKLVETAEVAPTCHNFNLVETTEVAPTCH |
| Ga0209415_107658362 | 3300027905 | Peatlands Soil | LRRLEQMKIVETAELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0307504_100858651 | 3300028792 | Soil | MKIVEVSEVAPTCHNNFKLVETAEVAPTCHNNYRLVESTEVAPTCH |
| Ga0222749_102514062 | 3300029636 | Soil | MKILEISEVAPTCHSNIKLVETAEVAPTCHNNVKLVE |
| Ga0316363_100030878 | 3300030659 | Peatlands Soil | MKIVETVELAPTCHAGCKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0099845_15665892 | 3300030975 | Boreal Forest Soil | IGGNIMKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTEVAPTCH |
| Ga0307476_101538142 | 3300031715 | Hardwood Forest Soil | MKILEISEVAPACHSNVKLVETADVAPTCHNNVKLVESAETAPTCH |
| Ga0307474_104157061 | 3300031718 | Hardwood Forest Soil | MKIIEVSETAPTCHSTVKLVETAEVAPTCHNNVKLVESAEIAPTCH |
| Ga0307469_103681212 | 3300031720 | Hardwood Forest Soil | MKIVEITEVAPTCHNNFKLVETAEVAPTCHNNFKLVESTEVAPTCH |
| Ga0307469_108865321 | 3300031720 | Hardwood Forest Soil | GGNIMKIVEISEVAPTCHSNFKLVETAEVSPTCHNNFKLVESTEVAPTCH |
| Ga0307475_102799321 | 3300031754 | Hardwood Forest Soil | EIAPTCHSNLKLVETAEVAPTCHSNVKLVESAEVAPTCH |
| Ga0307479_100075346 | 3300031962 | Hardwood Forest Soil | MKIIEISEVAPTCHSNVRLVETAEVAPTCHNSVKLVESTEVAPTCH |
| Ga0307479_101782203 | 3300031962 | Hardwood Forest Soil | MKIIEVGEIAPTCHSTVRLVETAEVAPTCHNNVKLVESAEIAPTCH |
| Ga0311301_118028081 | 3300032160 | Peatlands Soil | RPASSRGLAVTLRRLEQMKIVETAELAPTCHAGCKLVETAEIAPTCHNFSVVETTEVAPTCH |
| Ga0307472_1000390892 | 3300032205 | Hardwood Forest Soil | MKIVEISEVAPTCHCNFKLVETAEVSPTCHNNFKLVESTEVAPTCH |
| Ga0306920_1023369361 | 3300032261 | Soil | MKIVETAEMAPACHTGYALVETAEVAPTCHNVVETTEVTPTCH |
| Ga0306920_1033702972 | 3300032261 | Soil | MKIVEISEVAPTCHSNVKLVETAEVAPTCHNNVKLVES |
| Ga0335079_100082386 | 3300032783 | Soil | MKIVETAELAPTCHASYKLVETAEVAPTCHNLSVVETTEVAPICH |
| Ga0335079_101711002 | 3300032783 | Soil | MKIVETAEMAPTCHAGYKLVETAEVAPACHNLSLVETAEVAPTCH |
| Ga0335078_100362098 | 3300032805 | Soil | MKIVETAELAPTCHASYKLVETAEVAPTCHNLSLVETTEVAPTCH |
| Ga0335078_101555043 | 3300032805 | Soil | MKIVETAELAPTCHASYKLVETAEVAPTCHNFSVVETTEVAPTCH |
| Ga0335078_107964272 | 3300032805 | Soil | MKLVETAELAPTCHAGCKLVETAEIAPTCHNISLVETTEVAPTCH |
| Ga0335080_100480364 | 3300032828 | Soil | MKLVETSELAPTCHTSYKMVETAEVAPTCHSSFKLVETAEVAPTCH |
| Ga0335080_110625082 | 3300032828 | Soil | MKLVETAEMTPTCHTSLKLVETNEVAPTCHAEFKLVESAEVAPTCH |
| Ga0335080_118512601 | 3300032828 | Soil | MKLVETAEMTPTCHTSLKLVETSEVAPTCHAEFKLVESAEVAPTCH |
| Ga0335081_1000327823 | 3300032892 | Soil | MKIVETAEMAPTCHASYKLVETEEVAPTCHSFSVVETTEVAPTCH |
| Ga0335081_101605322 | 3300032892 | Soil | MKIVETTEIAPTCHAGYKLVETVEVAPTCHNLSLVETTEVAPTCH |
| Ga0335081_104896392 | 3300032892 | Soil | MKIVEISEVAPTCHANFKLVESAEVSATCHNNFKLVEAAEVSPTCH |
| Ga0335081_121893701 | 3300032892 | Soil | MKIVETAELAPTCHPSYKLVETAEVAPTCHNLSVVETTEVAPTCH |
| Ga0335081_122401511 | 3300032892 | Soil | PTCHAGYKLVETAEVAPTCHNFSLVETTEVAPTCH |
| Ga0335077_101624841 | 3300033158 | Soil | MKIVETAELAPTCHAGCKLVETAEVAPACHNFSVVETTEVAPTCH |
| Ga0335077_108055192 | 3300033158 | Soil | ETAELAPTSYAGCKLEETAEVAPPCHNLSVVETTEVAPTCH |
| ⦗Top⦘ |