NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022940

Metagenome / Metatranscriptome Family F022940

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022940
Family Type Metagenome / Metatranscriptome
Number of Sequences 212
Average Sequence Length 40 residues
Representative Sequence GPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLL
Number of Associated Samples 176
Number of Associated Scaffolds 212

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.94 %
% of genes near scaffold ends (potentially truncated) 96.70 %
% of genes from short scaffolds (< 2000 bps) 92.92 %
Associated GOLD sequencing projects 165
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.642 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.396 % of family members)
Environment Ontology (ENVO) Unclassified
(27.830 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.604 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.48%    β-sheet: 0.00%    Coil/Unstructured: 95.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 212 Family Scaffolds
PF02628COX15-CtaA 72.17
PF09754PAC2 4.72
PF08241Methyltransf_11 4.72
PF00291PALP 2.36
PF09413DUF2007 1.89
PF00561Abhydrolase_1 0.94
PF01676Metalloenzyme 0.47
PF02770Acyl-CoA_dh_M 0.47
PF00300His_Phos_1 0.47
PF02894GFO_IDH_MocA_C 0.47
PF00441Acyl-CoA_dh_1 0.47
PF07883Cupin_2 0.47
PF12840HTH_20 0.47
PF02683DsbD 0.47
PF01694Rhomboid 0.47
PF05331DUF742 0.47
PF02771Acyl-CoA_dh_N 0.47
PF01522Polysacc_deac_1 0.47
PF13580SIS_2 0.47
PF00903Glyoxalase 0.47
PF027373HCDH_N 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 212 Family Scaffolds
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 72.17
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.42
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.47
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.47
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.47
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.47
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.47
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.47
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.47
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.47
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.47
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.64 %
UnclassifiedrootN/A2.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459013|GO6OHWN01CKAA3All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
2170459013|GO6OHWN01D4NDTAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
2170459018|G1P06HT01D2G85All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300000550|F24TB_10274942Not Available596Open in IMG/M
3300000956|JGI10216J12902_108577006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300000956|JGI10216J12902_109615220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300000956|JGI10216J12902_112761671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300002070|JGI24750J21931_1068327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300002568|C688J35102_120059042All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300004480|Ga0062592_100712860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani875Open in IMG/M
3300005166|Ga0066674_10387158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300005166|Ga0066674_10503450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300005171|Ga0066677_10719792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300005173|Ga0066822_1005063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300005174|Ga0066680_10141591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1500Open in IMG/M
3300005175|Ga0066673_10242108All Organisms → cellular organisms → Bacteria → Terrabacteria group1042Open in IMG/M
3300005186|Ga0066676_10013344All Organisms → cellular organisms → Bacteria4117Open in IMG/M
3300005186|Ga0066676_10491476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia833Open in IMG/M
3300005187|Ga0066675_11382156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300005343|Ga0070687_100907500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300005440|Ga0070705_101083459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae655Open in IMG/M
3300005444|Ga0070694_101779794All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300005458|Ga0070681_10563474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1053Open in IMG/M
3300005526|Ga0073909_10271521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300005540|Ga0066697_10155043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1353Open in IMG/M
3300005549|Ga0070704_101420739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300005549|Ga0070704_102084968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium527Open in IMG/M
3300005553|Ga0066695_10615681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300005558|Ga0066698_10997359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300005559|Ga0066700_10395852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300005578|Ga0068854_100095963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2214Open in IMG/M
3300005887|Ga0075292_1043746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300006031|Ga0066651_10479112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300006032|Ga0066696_10221030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1216Open in IMG/M
3300006032|Ga0066696_10840562All Organisms → cellular organisms → Bacteria → Terrabacteria group585Open in IMG/M
3300006046|Ga0066652_100268664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1501Open in IMG/M
3300006049|Ga0075417_10166986All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300006051|Ga0075364_11187175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300006058|Ga0075432_10501559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300006173|Ga0070716_101644018All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300006358|Ga0068871_101593682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300006578|Ga0074059_11636623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300006604|Ga0074060_11188108Not Available809Open in IMG/M
3300006606|Ga0074062_12834362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300006791|Ga0066653_10105215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300006796|Ga0066665_10279990All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300006800|Ga0066660_11715772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300006804|Ga0079221_11368349All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006806|Ga0079220_10893213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300006845|Ga0075421_101377921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300006854|Ga0075425_102358910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300006880|Ga0075429_100467183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300006881|Ga0068865_102155764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300006903|Ga0075426_11103266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300006904|Ga0075424_100999985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium892Open in IMG/M
3300006904|Ga0075424_102824860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300006954|Ga0079219_10688133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300007004|Ga0079218_13432453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300009012|Ga0066710_101607896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300009012|Ga0066710_102824399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300009012|Ga0066710_103944433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300009088|Ga0099830_10804884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium775Open in IMG/M
3300009098|Ga0105245_10007289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9683Open in IMG/M
3300009137|Ga0066709_103656788All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300009137|Ga0066709_104389947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300009147|Ga0114129_10042401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6408Open in IMG/M
3300009148|Ga0105243_10464912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1190Open in IMG/M
3300009156|Ga0111538_12356178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300009162|Ga0075423_12355289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300009176|Ga0105242_11136894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria797Open in IMG/M
3300009811|Ga0105084_1026622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300009837|Ga0105058_1175316Not Available529Open in IMG/M
3300009840|Ga0126313_10144977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1788Open in IMG/M
3300009840|Ga0126313_11205390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300009840|Ga0126313_11450254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300010037|Ga0126304_10228839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300010039|Ga0126309_10368186All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300010039|Ga0126309_10858132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300010043|Ga0126380_10037954All Organisms → cellular organisms → Bacteria2502Open in IMG/M
3300010045|Ga0126311_10641757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300010303|Ga0134082_10539604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300010321|Ga0134067_10432030All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300010333|Ga0134080_10253659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300010333|Ga0134080_10658747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300010335|Ga0134063_10674911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300010336|Ga0134071_10694959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300010337|Ga0134062_10136655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1080Open in IMG/M
3300010337|Ga0134062_10666263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300010362|Ga0126377_11863319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300010373|Ga0134128_11152542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria855Open in IMG/M
3300010396|Ga0134126_10902821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300010400|Ga0134122_10912436All Organisms → cellular organisms → Bacteria → Terrabacteria group851Open in IMG/M
3300011119|Ga0105246_10941912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300011440|Ga0137433_1262234Not Available563Open in IMG/M
3300011992|Ga0120146_1021369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1207Open in IMG/M
3300012091|Ga0136625_1109856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria960Open in IMG/M
3300012096|Ga0137389_10498317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1044Open in IMG/M
3300012200|Ga0137382_10340525All Organisms → cellular organisms → Bacteria → Terrabacteria group1051Open in IMG/M
3300012207|Ga0137381_10695122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria884Open in IMG/M
3300012209|Ga0137379_10462851All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300012211|Ga0137377_11377925All Organisms → cellular organisms → Bacteria → Terrabacteria group634Open in IMG/M
3300012285|Ga0137370_10553310All Organisms → cellular organisms → Bacteria → Terrabacteria group708Open in IMG/M
3300012285|Ga0137370_10935695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300012351|Ga0137386_10393896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria997Open in IMG/M
3300012353|Ga0137367_10087156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2306Open in IMG/M
3300012355|Ga0137369_10125201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2072Open in IMG/M
3300012355|Ga0137369_10514985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300012356|Ga0137371_10707088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300012358|Ga0137368_10279911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1138Open in IMG/M
3300012360|Ga0137375_11231684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300012360|Ga0137375_11470203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300012532|Ga0137373_10669650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300012532|Ga0137373_10829146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300012582|Ga0137358_10474338All Organisms → cellular organisms → Bacteria → Terrabacteria group844Open in IMG/M
3300012896|Ga0157303_10037204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300012902|Ga0157291_10015816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1426Open in IMG/M
3300012915|Ga0157302_10327828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300012986|Ga0164304_11522306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300012988|Ga0164306_10238983All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300013100|Ga0157373_11069709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300013296|Ga0157374_12976205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300013308|Ga0157375_10756033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1123Open in IMG/M
3300013308|Ga0157375_13223991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300013765|Ga0120172_1039656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1258Open in IMG/M
3300014058|Ga0120149_1050412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1050Open in IMG/M
3300014150|Ga0134081_10427004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300014166|Ga0134079_10345061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300014271|Ga0075326_1202069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani597Open in IMG/M
3300014497|Ga0182008_10892940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300014968|Ga0157379_12321547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300015371|Ga0132258_13943171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1008Open in IMG/M
3300015372|Ga0132256_103287726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300017654|Ga0134069_1086568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300017654|Ga0134069_1196170All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300017654|Ga0134069_1334289All Organisms → cellular organisms → Bacteria → Terrabacteria group543Open in IMG/M
3300018027|Ga0184605_10390785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300018028|Ga0184608_10160373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria973Open in IMG/M
3300018061|Ga0184619_10132560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1132Open in IMG/M
3300018061|Ga0184619_10511907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300018066|Ga0184617_1216490All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300018067|Ga0184611_1023611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1918Open in IMG/M
3300018074|Ga0184640_10360953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300018081|Ga0184625_10303572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300018433|Ga0066667_11761768All Organisms → cellular organisms → Bacteria → Terrabacteria group559Open in IMG/M
3300018433|Ga0066667_12033436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300018482|Ga0066669_10356800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1217Open in IMG/M
3300019362|Ga0173479_10100233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1071Open in IMG/M
3300019865|Ga0193748_1011684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium801Open in IMG/M
3300019869|Ga0193705_1075096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300019873|Ga0193700_1008525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1624Open in IMG/M
3300019890|Ga0193728_1335353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300021080|Ga0210382_10047695All Organisms → cellular organisms → Bacteria1676Open in IMG/M
3300023072|Ga0247799_1005303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1804Open in IMG/M
3300025552|Ga0210142_1001701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4339Open in IMG/M
3300025556|Ga0210120_1062020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300025910|Ga0207684_10625541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria918Open in IMG/M
3300025920|Ga0207649_10282094All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300025938|Ga0207704_11362824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300025944|Ga0207661_11718016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300025981|Ga0207640_11019615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300026095|Ga0207676_12307786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300026118|Ga0207675_102047982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300026142|Ga0207698_11878232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300026306|Ga0209468_1147579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300026308|Ga0209265_1190992All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300026317|Ga0209154_1199594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300026342|Ga0209057_1119410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300026532|Ga0209160_1120198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1292Open in IMG/M
3300026536|Ga0209058_1256021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300026547|Ga0209156_10016549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4551Open in IMG/M
3300026550|Ga0209474_10505779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300026550|Ga0209474_10602991All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300026552|Ga0209577_10165299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1727Open in IMG/M
3300026552|Ga0209577_10669602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300027006|Ga0209896_1002947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1646Open in IMG/M
3300027577|Ga0209874_1122326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300027717|Ga0209998_10116877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300027873|Ga0209814_10000545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12481Open in IMG/M
3300027907|Ga0207428_10239391Not Available1356Open in IMG/M
3300028707|Ga0307291_1097738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium731Open in IMG/M
3300028711|Ga0307293_10255693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300028715|Ga0307313_10152091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300028719|Ga0307301_10072400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1076Open in IMG/M
3300028720|Ga0307317_10052749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1305Open in IMG/M
3300028722|Ga0307319_10140564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300028768|Ga0307280_10059176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1212Open in IMG/M
3300028778|Ga0307288_10328693All Organisms → cellular organisms → Bacteria → Terrabacteria group612Open in IMG/M
3300028784|Ga0307282_10169783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1037Open in IMG/M
3300028784|Ga0307282_10230271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria888Open in IMG/M
3300028784|Ga0307282_10347767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300028787|Ga0307323_10054887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1406Open in IMG/M
3300028791|Ga0307290_10021893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2235Open in IMG/M
3300028791|Ga0307290_10178081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300028796|Ga0307287_10118173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1003Open in IMG/M
3300028796|Ga0307287_10315856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300028807|Ga0307305_10014104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3541Open in IMG/M
3300028807|Ga0307305_10017965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3163Open in IMG/M
3300028807|Ga0307305_10466753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300028810|Ga0307294_10363395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300028819|Ga0307296_10394624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300028819|Ga0307296_10827658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300028824|Ga0307310_10111519All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300028824|Ga0307310_10221266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria900Open in IMG/M
3300028824|Ga0307310_10438044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300028828|Ga0307312_10479635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300028876|Ga0307286_10015402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2414Open in IMG/M
3300028880|Ga0307300_10305795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300032013|Ga0310906_10785034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300032180|Ga0307471_100557512All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300033004|Ga0335084_10024363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6170Open in IMG/M
3300033412|Ga0310810_10474144All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300034113|Ga0364937_133901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.13%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.13%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.77%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.42%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.42%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.94%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.47%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.47%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.47%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.47%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.47%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.47%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.47%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.47%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.47%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.47%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.47%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.47%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
2170459018Litter degradation MG2EngineeredOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005173Soil and rhizosphere microbial communities from Laval, Canada - mgHMAEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011992Permafrost microbial communities from Nunavut, Canada - A23_65cm_12MEnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019865Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025556Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N57_045025302170459013Grass SoilMPVLLNAADRPLFLGSRPTPVDGADGYPAKELLEPLI
N57_048001802170459013Grass SoilLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL
2MG_024798702170459018Switchgrass, Maize And Mischanthus LitterGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAVFDPL
F24TB_1027494213300000550SoilRGPDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLEPL*
JGI10216J12902_10857700623300000956SoilDMMPVLLNAADRPLFLGSCPTPFAGADGYPSILDPL*
JGI10216J12902_10961522023300000956SoilDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
JGI10216J12902_11276167123300000956SoilLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
JGI24750J21931_106832723300002070Corn, Switchgrass And Miscanthus RhizosphereLGQLCGPDLMPVLLNAADRPLFLGSRPTPVDGADGYPAVLEPLL*
C688J35102_12005904233300002568SoilGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLT*
Ga0062592_10071286023300004480SoilCGADLMPVLLNAADRALFAGSRPTPFRHAQGYPSLLEPL*
Ga0066674_1038715813300005166SoilRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDRL*
Ga0066674_1050345013300005166SoilGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPLL*
Ga0066677_1071979223300005171SoilGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILEPL*
Ga0066822_100506323300005173SoilLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0066680_1014159133300005174SoilRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPALLDPL*
Ga0066673_1024210823300005175SoilGPDLMPVLLNAADRPLFLGSRPTPVDGADGYPADELLEPLI*
Ga0066676_1001334453300005186SoilLRGPDMMPVLLNAADRPLFLGSRPTPYDGADGYPALLDPLR*
Ga0066676_1049147613300005186SoilILGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0066675_1138215613300005187SoilRGPDLMPVLLNAADRPLFLGSRPTPFRGADGYPAVLQPLL*
Ga0070687_10090750013300005343Switchgrass RhizosphereRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAVLEPLT*
Ga0070705_10108345913300005440Corn, Switchgrass And Miscanthus RhizosphereGHIRGEDVMPILLNAADRPLFLGLRSTPVPGAAGFPAAVEPLDA*
Ga0070694_10177979413300005444Corn, Switchgrass And Miscanthus RhizosphereQLRGPDLMPVLLNAADRPLFLGSRPTPADGADGYPDRELLEPLI*
Ga0070681_1056347423300005458Corn RhizosphereLGQLRGPDLLPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL*
Ga0073909_1027152123300005526Surface SoilMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL*
Ga0066697_1015504333300005540SoilVLLNAADRPLFLGSRPTPVDGADGYPDREELEALI*
Ga0070704_10142073923300005549Corn, Switchgrass And Miscanthus RhizosphereQLRGPDLMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLK*
Ga0070704_10208496823300005549Corn, Switchgrass And Miscanthus RhizosphereGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSLLEPLT*
Ga0066695_1061568123300005553SoilDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILNPLL*
Ga0066698_1099735913300005558SoilRGPDVMPVLLNAADRPLFQGSRPTPFDGADGYPALLEPLRI*
Ga0066700_1039585223300005559SoilPDMMPVLLNAADRPLFLGSRPTPFDGADGYPALLDPL*
Ga0068854_10009596343300005578Corn RhizosphereLMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL*
Ga0075292_104374613300005887Rice Paddy SoilRGPDLMPVLLNAADRALFLGSRPTPFEGADGYPVLLEPLL*
Ga0066651_1047911223300006031SoilHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPLL*
Ga0066696_1022103013300006032SoilGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDRL*
Ga0066696_1084056213300006032SoilMPVLLNAADRPLFLGSRPTPVDGADGYPADELLEPLI*
Ga0066652_10026866433300006046SoilLGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
Ga0075417_1016698623300006049Populus RhizosphereGHLRGPDLMPILLNAADRPLFLGSRPTPFPGADGYPAVLEPLRP*
Ga0075364_1118717523300006051Populus EndosphereGHLRGEDVMPVLLNAADRPLFAGSRPTPYAGADGYPSLLEPLRIE*
Ga0075432_1050155913300006058Populus RhizosphereMPVLLNAADRPLFLGSHPTPVDGADGYPAVLEPLL*
Ga0070716_10164401813300006173Corn, Switchgrass And Miscanthus RhizospherePVLLNAADRPLFLGSRPTPVDGADGYPSRDLLEPLI*
Ga0068871_10159368223300006358Miscanthus RhizosphereGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0074059_1163662313300006578SoilPVLLNAADRPLFLGSRPTPFEGADGYPAVLEPLL*
Ga0074060_1118810813300006604SoilRGPDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLAPL*
Ga0074062_1283436223300006606SoilPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL*
Ga0066653_1010521513300006791SoilMMPVLLNAADRPLFLGSRPTPFDGADGYPGILDPL*
Ga0066665_1027999033300006796SoilMMPVLLNAADRPLFLGSRPTTFDGADGYPAILDPL*
Ga0066660_1171577223300006800SoilDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILEPFV*
Ga0079221_1136834923300006804Agricultural SoilMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
Ga0079220_1089321323300006806Agricultural SoilPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPFR*
Ga0075421_10137792123300006845Populus RhizosphereMPVLLNAADRPLFAGSRPTPYAGADGYPSLLEPLRIE*
Ga0075425_10235891013300006854Populus RhizospherePDLMPVLLNAADRPLFLGSRPTPFRGADGYPAVLQPLL*
Ga0075429_10046718313300006880Populus RhizosphereLGPLRGPDMMPVLLNAADRPLYLGSRPTPFDGADGYPEILEPLRW*
Ga0068865_10215576413300006881Miscanthus RhizosphereGPDLMPVLLNAADRPLFMGSRPTPFPGADGYPQLLEPLL*
Ga0075426_1110326613300006903Populus RhizosphereLGHLRGPDMMPVLLNAADRPLFLGSRPTAFDGADGYPAILDPL*
Ga0075424_10099998523300006904Populus RhizospherePVLLNAADRPLFLGSRPTPFRGADGYPAILEPLL*
Ga0075424_10282486013300006904Populus RhizospherePDLMPVLLNAADRPLFLGSRPTPVDGADGYPAVLEPLL*
Ga0079219_1068813323300006954Agricultural SoilMPVLLNAADRPLFLGSRPTPFEGADGYPAVLEPLL*
Ga0079218_1343245313300007004Agricultural SoilILGHLRGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLD*
Ga0066710_10160789613300009012Grasslands SoilLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPLL
Ga0066710_10282439923300009012Grasslands SoilPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILEPLV
Ga0066710_10394443323300009012Grasslands SoilGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPALLDPL
Ga0099830_1080488423300009088Vadose Zone SoilPDMMPVLLNAADRPLFLGSRPTPFAGADGYPALLEPLAV*
Ga0105245_1000728993300009098Miscanthus RhizosphereGQLRGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLQ*
Ga0066709_10365678813300009137Grasslands SoilADLMPVLLNAADRPLCLGSRPTPVDGADGYPDKELLEPLI*
Ga0066709_10438994723300009137Grasslands SoilPVLLNAADRPLFLGSRPTPFDGADGYPEILEPLL*
Ga0114129_1004240173300009147Populus RhizosphereMPVLLNAADRPLFLGSRPTPFPGADGYPALLEPLRV*
Ga0105243_1046491213300009148Miscanthus RhizosphereLMPVLLNAADRPLFLGSRPTPVDGADGYPAVLEPLL*
Ga0111538_1235617823300009156Populus RhizosphereSDLMPVLLNAADRPLFLGSRPTPVDGADGYPAVLEPLL*
Ga0075423_1235528913300009162Populus RhizosphereDLMPVLLNAADRPLFLGSRPTPFRGADGYPAVLQPLL*
Ga0105242_1113689423300009176Miscanthus RhizosphereGPDMMPVLLNAADRPLFLGSRPTAFDGADGYPAILDPL*
Ga0105084_102662223300009811Groundwater SandLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPLL*
Ga0105058_117531613300009837Groundwater SandPDMMPVLLNAADRPLFLGSRPTPFAGADGYPELLEPLL*
Ga0126313_1014497733300009840Serpentine SoilGHLRGEDVMPVLLNAADRPLFAGSRPTPYAGADGYPSLLEPLRIH*
Ga0126313_1120539023300009840Serpentine SoilMPVLLNAADRPLFLGSRPTPFDGADGYPSILEPLDSTP*
Ga0126313_1145025413300009840Serpentine SoilDMMPVLLNAADRPLFLGSRPTPFDGADGYPSLLEPLI*
Ga0126304_1022883923300010037Serpentine SoilMRVLLNAADRPLFAGSRPTPFAGADGYPSLLEPLRGASLDS*
Ga0126309_1036818623300010039Serpentine SoilLRGPDMMPVLLNAADRPLFLGSRPTPFPGADGYPAILEPLRP*
Ga0126309_1085813223300010039Serpentine SoilDVMPVLLNAADRPLFLGSRPTPFAGADGYPSILEPLR*
Ga0126380_1003795443300010043Tropical Forest SoilVLLNAADRPLFLGSRPTPVDGADGYQAEELLEPLT*
Ga0126311_1064175713300010045Serpentine SoilILGHLRGPDMMPVLLNAADRPLYLGSRPTPFDGADGYPEILEPL*
Ga0134082_1053960413300010303Grasslands SoilRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
Ga0134067_1043203013300010321Grasslands SoilILGQLRGPDLMPVLLNAADRPLFLGSRPTLFDGADGYPALLEPLR*
Ga0134080_1025365913300010333Grasslands SoilHLRGPDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLEPLL*
Ga0134080_1065874723300010333Grasslands SoilILGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
Ga0134063_1067491123300010335Grasslands SoilQLRGPDLMPVLLNDADRPLFLGSRPTPFKGADGYPALLEPLR*
Ga0134071_1069495913300010336Grasslands SoilGPDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLEPL*
Ga0134062_1013665523300010337Grasslands SoilADLMPVLLNAADRPLFLGSRPTPVDGADGYPDREELEALI*
Ga0134062_1066626323300010337Grasslands SoilPDLMPVLLNAADRPLFLGSRPTPFAGADGYPALLEPFR*
Ga0126377_1186331923300010362Tropical Forest SoilLGQLRGPDLMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL*
Ga0134128_1115254213300010373Terrestrial SoilRGPDLMPVLLNAADRPLFLGSRPTPFEGADGYPAVLDPLL*
Ga0134126_1090282123300010396Terrestrial SoilGILGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
Ga0134122_1091243623300010400Terrestrial SoilGSDLMPVLLNAADRPLFLGSRPTPVDGADGYPDKELLEPLI*
Ga0105246_1094191213300011119Miscanthus RhizospherePDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0137433_126223423300011440SoilDMMPVLLNAADRPLFLGSRPTPFSGADGYPEVMEPLR*
Ga0120146_102136923300011992PermafrostDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLL*
Ga0136625_110985623300012091Polar Desert SandLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLD*
Ga0137389_1049831733300012096Vadose Zone SoilDMMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLTV*
Ga0137382_1034052523300012200Vadose Zone SoilRGPDLMPVLLNAADRPLFLGSRPTPIEGADGYPAEELLEPLI*
Ga0137381_1069512223300012207Vadose Zone SoilGPDLMPVLLNSADRPLFLGSRPTPFEGADGYPAILEPLLPE*
Ga0137379_1046285113300012209Vadose Zone SoilMPVLLNAADRPLFLGSRPTPVDGADGYPAKELLEPLI*
Ga0137377_1137792513300012211Vadose Zone SoilDLMPVLLNAADRPLFLGSRPTPVDGADGYPAKELLEPLI*
Ga0137370_1055331023300012285Vadose Zone SoilGPDLMPVLLNAADRPLFLGSRPTPVDGADGYPAKELLEPLI*
Ga0137370_1093569513300012285Vadose Zone SoilDLMPVLLNAADRPLFLGSRPTPFDGADGYPAVLEPLR*
Ga0137386_1039389623300012351Vadose Zone SoilPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILEPLL*
Ga0137367_1008715643300012353Vadose Zone SoilRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0137369_1012520133300012355Vadose Zone SoilDGIFGQLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
Ga0137369_1051498523300012355Vadose Zone SoilDMMPVLLNVADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0137371_1070708823300012356Vadose Zone SoilPDVMPVLLNAADRPLFQGSRPTPFDGADGFPALLEPLRVGV*
Ga0137368_1027991123300012358Vadose Zone SoilGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILEPL*
Ga0137375_1123168423300012360Vadose Zone SoilGQLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPGVLEPLL*
Ga0137375_1147020313300012360Vadose Zone SoilLRGPDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLEPL*
Ga0137373_1066965013300012532Vadose Zone SoilQLRGPDMMPVLLNAADRPLFLGSRPTPFPGADGYPELIEPLL*
Ga0137373_1082914613300012532Vadose Zone SoilDIVPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0137358_1047433813300012582Vadose Zone SoilQLRGPDLMPVLLNAADRPLFLGSRPTPVDGADGYPDRELLEPLI*
Ga0157303_1003720413300012896SoilPDLMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL*
Ga0157291_1001581613300012902SoilLRGPDMMPVLLNAADRPLFLGSRPTPFPGADGYPELLEPLL*
Ga0157302_1032782813300012915SoilFGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL*
Ga0164304_1152230623300012986SoilLMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0164306_1023898333300012988SoilLLNAADRPLFLGSRPTPVDGADGYPDRELLEPLI*
Ga0157373_1106970923300013100Corn RhizosphereRVPHLLPGLLDAADRPLFLGSRPTPFEGADGYPALLEPLL*
Ga0157374_1297620513300013296Miscanthus RhizosphereDMMPVLLNAADRPLFLGSRPTAFDGADGYPAILDPL*
Ga0157375_1075603313300013308Miscanthus RhizosphereRGPDLMPVLLNAADRPLFMGSRPTPFPGADGYPQLLEPLL*
Ga0157375_1322399133300013308Miscanthus RhizospherePVLLNAADRPLFLGSRPTPFDGADGYPSLLEPLR*
Ga0120172_103965633300013765PermafrostLIPVLLNAADRPLFLGSRPTPFDGADGYPEILEPLL*
Ga0120149_105041213300014058PermafrostGPDLMPVLLNAADRPLFLGSRPTPVDGADGYPAVLDPLL*
Ga0134081_1042700413300014150Grasslands SoilMMPVLLNAADRPLFLGSRPTPFDGADGYPSILEPLL*
Ga0134079_1034506123300014166Grasslands SoilPDLMPVLLNAADRPLFLGSRPTPFEGADGYPALLERFR*
Ga0075326_120206923300014271Natural And Restored WetlandsLTGADVMPVLLNAADRALFLGSRPTPVPAPAGVPADVEPLAP*
Ga0182008_1089294033300014497RhizosphereIFGRLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSLLEPLT*
Ga0157379_1232154723300014968Switchgrass RhizosphereGHLRGPDLMPVLLNAADRPLFMGSRPTPFPGADGYPQLLEPLL*
Ga0132258_1394317113300015371Arabidopsis RhizosphereDMMPVLLNAADRPLFLGSRPTPFDGAAGYPAVLEPLT*
Ga0132256_10328772613300015372Arabidopsis RhizosphereLGPLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL*
Ga0134069_108656813300017654Grasslands SoilGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPLL
Ga0134069_119617013300017654Grasslands SoilDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLR
Ga0134069_133428923300017654Grasslands SoilLRGPDLMPVLLNAADRPLFLGSRPTPVDGADGYPAKELLEPLI
Ga0184605_1039078523300018027Groundwater SedimentLGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL
Ga0184608_1016037313300018028Groundwater SedimentMPVLLNAADRPLFLGSRPTPFQGADGYPELLEPLL
Ga0184619_1013256013300018061Groundwater SedimentMPLLLNAADRPLFLGSRPTPYDGADGYPALLEPLRV
Ga0184619_1051190723300018061Groundwater SedimentRGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLR
Ga0184617_121649013300018066Groundwater SedimentGILGQLCGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPAVLDPLL
Ga0184611_102361133300018067Groundwater SedimentGPDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLVPL
Ga0184640_1036095323300018074Groundwater SedimentMMPILLNAADRPLFLGSRPTPFPGADGYPEVLEPLR
Ga0184625_1030357213300018081Groundwater SedimentLMPVLLNAADRPLFLGSRPTPFDGADGYPALLDPLT
Ga0066667_1176176813300018433Grasslands SoilHLHGPDMMPVLLNAADRPLFLGSRPTPVDGADGYPAKELLEPLI
Ga0066667_1203343623300018433Grasslands SoilGHLRGPDMMPVLLNAGDRPLFLGSRPTPFDGADGYPAILDPL
Ga0066669_1035680013300018482Grasslands SoilPDLMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPFLP
Ga0173479_1010023323300019362SoilDMMPVLLNAADRPLFLGSRPTPFLGADGYPELLEPLL
Ga0193748_101168413300019865SoilLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLL
Ga0193705_107509623300019869SoilMMPVLLNAADRPLFLGSRPTPFQGADGYPELLEPLL
Ga0193700_100852533300019873SoilLMPVLLNAADRPLFLGSRPTAVDGADGYPAQFEPLL
Ga0193728_133535313300019890SoilHLRGPDMMPVLLNAADRPLFLGSRPTRFDGADGYPATLDPL
Ga0210382_1004769513300021080Groundwater SedimentLRGLDLMPVLLNAADRPLFLGSRPTPVEGADGYPAKQLLEPLI
Ga0247799_100530333300023072SoilQLRGPDLMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL
Ga0210142_100170113300025552Natural And Restored WetlandsQLRGPDLMPVLLNAADRPLFLGSRPTTFDGADGYPALLEPFL
Ga0210120_106202023300025556Natural And Restored WetlandsQLRGPDLMPVLLNAADRPLFLGSRPTRFDGADGYPALLEPFL
Ga0207684_1062554113300025910Corn, Switchgrass And Miscanthus RhizosphereGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL
Ga0207649_1028209433300025920Corn RhizospherePDLLPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL
Ga0207704_1136282423300025938Miscanthus RhizosphereMMPVLLNAADRPLFLGSRPTPFPGADGYPELLDPLL
Ga0207661_1171801623300025944Corn RhizosphereMPVLLNAADRPLFLGSRPTPFEGADGYPAVLEPLL
Ga0207640_1101961513300025981Corn RhizosphereMPVLLNAADRPLFLGSRPTPFDGADGYPALLDPLS
Ga0207676_1230778623300026095Switchgrass RhizosphereLMPVLLNAADRPLFMGSRPTPFPGADGYPQLLEPLL
Ga0207675_10204798223300026118Switchgrass RhizosphereRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLR
Ga0207698_1187823213300026142Corn RhizosphereILGHLRGPDLMPVLLNAADRPLFMGSRPTPFPGADGYPQLLEPLL
Ga0209468_114757923300026306SoilLGQLRGADLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLR
Ga0209265_119099223300026308SoilMMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPFR
Ga0209154_119959423300026317SoilGVLGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL
Ga0209057_111941023300026342SoilILGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPALLDRL
Ga0209160_112019833300026532SoilDMMPVLLNAADRPLFLGSRPTPFDGADGYPALLDPL
Ga0209058_125602113300026536SoilGADLMPVLLNAADRPLFLGSRPTPFDGADGYPALLDPL
Ga0209156_1001654913300026547SoilPVLLNAADRPLFLGSRPTPVDGADGYPDRDLLEPLI
Ga0209474_1050577913300026550SoilGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDRL
Ga0209474_1060299113300026550SoilVLLNAADRPLFLGSRPTPVDGADGYPADELLEPLI
Ga0209577_1016529943300026552SoilQLRGPDMMPVLLNAADRPLFLGSRPTSFDGADGYPSILEPLL
Ga0209577_1066960223300026552SoilLRGSDLMPVLLNAADRPLFLGSRPTPFDGADGYPAILEPLLPE
Ga0209896_100294713300027006Groundwater SandHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPLL
Ga0209874_112232623300027577Groundwater SandMPVLLNAADRPLFLGSRPTPYPGADGYPELLQPLL
Ga0209998_1011687723300027717Arabidopsis Thaliana RhizosphereDLMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL
Ga0209814_1000054513300027873Populus RhizospherePDLMPVLLNAADRPLFLGSRPTPVDGADGYPAAELLEPLT
Ga0207428_1023939133300027907Populus RhizosphereAGILGRIRGPDMMPVLLNAADRPLFLGSRPTPYDGADGYPLLLEPLR
Ga0307291_109773823300028707SoilILGQLRGPDLMPVLLNAADRPLFLGSRPTPYDGADGYPALLEPLL
Ga0307293_1025569313300028711SoilDLMPVLLNAADRPLFLGSRPTPVDGADGYPAVLEPLL
Ga0307313_1015209113300028715SoilPDLMPVLLNAADRPLFLGSRPTPVDGADGYPAVLEPLL
Ga0307301_1007240023300028719SoilPDLMPVLLNAADRPLFLGSRPTPFEGADGYPALLEPLL
Ga0307317_1005274933300028720SoilRGILGHLCGPDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLTPL
Ga0307319_1014056423300028722SoilPDLMPVLLNAADRPLFLGSRPTPFRGADGYPALLEPLL
Ga0307280_1005917613300028768SoilLGHLRGSDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL
Ga0307288_1032869323300028778SoilLMPVLLNAADRPLFLGSRPTPVDGADGYPDKELLEPLI
Ga0307282_1016978323300028784SoilRGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLL
Ga0307282_1023027113300028784SoilMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLTPL
Ga0307282_1034776723300028784SoilGILGHLRGPDMMPVLLNAADRPLFLGSRPTPFPGADGYPELLEPLL
Ga0307323_1005488733300028787SoilLGHLSGSDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLTPL
Ga0307290_1002189343300028791SoilGPDMMPVLLNAADRPLFLGSRPTPFPGADGYPELLEPLL
Ga0307290_1017808123300028791SoilDLMPVLLNAADRPLFLGSRPTAVDGADGYPAQFEPLL
Ga0307287_1011817313300028796SoilHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL
Ga0307287_1031585623300028796SoilLCGPDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLTPL
Ga0307305_1001410443300028807SoilLSGSDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLTPL
Ga0307305_1001796513300028807SoilPDLMPVLLNAADRPLFLGSRPTAVDGADGYPALLEPLL
Ga0307305_1046675313300028807SoilGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLL
Ga0307294_1036339523300028810SoilAGILGHLRGPDMMPVLLNAADRPLFLGSRPTPFPGADGYPELLEPLI
Ga0307296_1039462423300028819SoilHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPSILDPL
Ga0307296_1082765813300028819SoilGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLR
Ga0307310_1011151913300028824SoilGSDLMPVLLNAADRPLFLGSRPTPIDGADGYPARELLEPLI
Ga0307310_1022126613300028824SoilPDMMAVLLNAADRPLFLGSRPTPFDGADGYPAILDPL
Ga0307310_1043804423300028824SoilDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLL
Ga0307312_1047963523300028828SoilMMPVLLNAADRPLFLGSRPTSFDGADGYPAILDPL
Ga0307286_1001540213300028876SoilDMMPVLLNAADRPLFLGSRPTPFAGADGYPDLLVPL
Ga0307300_1030579513300028880SoilGILGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL
Ga0310906_1078503413300032013SoilGHLRGPDMMPVLLNAADRPLFLGSRPTPFDGADGYPAILDPL
Ga0307471_10055751233300032180Hardwood Forest SoilGQLRGPDLMPVLLNAADRPLFLGSRPTPDDGADGYPDRELLEPLI
Ga0335084_1002436363300033004SoilGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLERFL
Ga0310810_1047414413300033412SoilRGPDLMPVLLNAADRPLFLGSRPTPFDGADGYPALLEPLRYGD
Ga0364937_133901_94_2043300034113SedimentMMPVLLNAADRPLFLGSRPTPFAGADGYPELLEPLL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.