| Basic Information | |
|---|---|
| Family ID | F022918 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LTKSRLIYLLLIASLFAYFLACFHHPGPTGMSDGGGL |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.31 % |
| % of genes near scaffold ends (potentially truncated) | 17.45 % |
| % of genes from short scaffolds (< 2000 bps) | 80.19 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.811 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (8.962 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.170 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 36.79 |
| PF03109 | ABC1 | 16.98 |
| PF00106 | adh_short | 16.51 |
| PF13560 | HTH_31 | 4.72 |
| PF13424 | TPR_12 | 3.30 |
| PF07719 | TPR_2 | 1.89 |
| PF07690 | MFS_1 | 1.42 |
| PF02769 | AIRS_C | 1.42 |
| PF02540 | NAD_synthase | 0.94 |
| PF13977 | TetR_C_6 | 0.94 |
| PF02628 | COX15-CtaA | 0.94 |
| PF00586 | AIRS | 0.94 |
| PF00440 | TetR_N | 0.94 |
| PF13561 | adh_short_C2 | 0.47 |
| PF13847 | Methyltransf_31 | 0.47 |
| PF00581 | Rhodanese | 0.47 |
| PF09754 | PAC2 | 0.47 |
| PF00266 | Aminotran_5 | 0.47 |
| PF13340 | DUF4096 | 0.47 |
| PF01266 | DAO | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 16.98 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.94 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.81 % |
| Unclassified | root | N/A | 5.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_10006094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
| 3300001305|C688J14111_10005343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3543 | Open in IMG/M |
| 3300001305|C688J14111_10140015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300001305|C688J14111_10165613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300001535|A3PFW1_10121861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 2047 | Open in IMG/M |
| 3300001686|C688J18823_10084902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2196 | Open in IMG/M |
| 3300001686|C688J18823_10152247 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300002568|C688J35102_119971697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300002568|C688J35102_120358534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1012 | Open in IMG/M |
| 3300002568|C688J35102_120989075 | All Organisms → cellular organisms → Bacteria | 10030 | Open in IMG/M |
| 3300003320|rootH2_10103986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1872 | Open in IMG/M |
| 3300003324|soilH2_10014502 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300004114|Ga0062593_101182187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300004479|Ga0062595_100021387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2458 | Open in IMG/M |
| 3300004479|Ga0062595_100165945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1312 | Open in IMG/M |
| 3300004799|Ga0058863_10026362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1201 | Open in IMG/M |
| 3300005171|Ga0066677_10442303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300005174|Ga0066680_10514916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300005175|Ga0066673_10244842 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005176|Ga0066679_10139000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1512 | Open in IMG/M |
| 3300005187|Ga0066675_10444647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 963 | Open in IMG/M |
| 3300005327|Ga0070658_10020469 | All Organisms → cellular organisms → Bacteria | 5302 | Open in IMG/M |
| 3300005327|Ga0070658_10059339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3115 | Open in IMG/M |
| 3300005332|Ga0066388_100152961 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
| 3300005345|Ga0070692_10872554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300005435|Ga0070714_100075546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2923 | Open in IMG/M |
| 3300005435|Ga0070714_102353553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300005436|Ga0070713_100035596 | All Organisms → cellular organisms → Bacteria | 4009 | Open in IMG/M |
| 3300005439|Ga0070711_100363208 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300005445|Ga0070708_100167334 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300005455|Ga0070663_100673247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 877 | Open in IMG/M |
| 3300005518|Ga0070699_101171790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300005524|Ga0070737_10100310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
| 3300005526|Ga0073909_10003994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4357 | Open in IMG/M |
| 3300005526|Ga0073909_10036472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1717 | Open in IMG/M |
| 3300005532|Ga0070739_10011106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8548 | Open in IMG/M |
| 3300005532|Ga0070739_10034247 | All Organisms → cellular organisms → Bacteria | 3654 | Open in IMG/M |
| 3300005537|Ga0070730_10004606 | All Organisms → cellular organisms → Bacteria | 12041 | Open in IMG/M |
| 3300005545|Ga0070695_101619104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300005555|Ga0066692_10470449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300005560|Ga0066670_10987278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300005563|Ga0068855_100478526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1356 | Open in IMG/M |
| 3300005569|Ga0066705_10436932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300005576|Ga0066708_10095239 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300005586|Ga0066691_10680104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300005764|Ga0066903_100034585 | All Organisms → cellular organisms → Bacteria | 5810 | Open in IMG/M |
| 3300005764|Ga0066903_100043572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5339 | Open in IMG/M |
| 3300005764|Ga0066903_100589944 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300005764|Ga0066903_100785215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1700 | Open in IMG/M |
| 3300005764|Ga0066903_101061317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1489 | Open in IMG/M |
| 3300005764|Ga0066903_101585406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
| 3300005764|Ga0066903_101978983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300005764|Ga0066903_103237738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
| 3300005893|Ga0075278_1046078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300006028|Ga0070717_10019063 | All Organisms → cellular organisms → Bacteria | 5372 | Open in IMG/M |
| 3300006028|Ga0070717_10789280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300006032|Ga0066696_10089926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1823 | Open in IMG/M |
| 3300006034|Ga0066656_10165536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1391 | Open in IMG/M |
| 3300006059|Ga0075017_100024571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3938 | Open in IMG/M |
| 3300006175|Ga0070712_101606586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300006578|Ga0074059_10006726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300006604|Ga0074060_11890366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300006755|Ga0079222_10417920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
| 3300006755|Ga0079222_11478305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300006791|Ga0066653_10034904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2009 | Open in IMG/M |
| 3300006794|Ga0066658_10133587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
| 3300006797|Ga0066659_10613688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300006797|Ga0066659_11103335 | Not Available | 663 | Open in IMG/M |
| 3300006800|Ga0066660_10431872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1096 | Open in IMG/M |
| 3300006804|Ga0079221_10616874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300006804|Ga0079221_11126114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300006806|Ga0079220_11648689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300006854|Ga0075425_102230698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300006871|Ga0075434_102459475 | Not Available | 522 | Open in IMG/M |
| 3300006893|Ga0073928_10166259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1763 | Open in IMG/M |
| 3300009012|Ga0066710_100126938 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
| 3300009093|Ga0105240_11148101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 825 | Open in IMG/M |
| 3300009137|Ga0066709_100477215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1751 | Open in IMG/M |
| 3300009143|Ga0099792_10113099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1445 | Open in IMG/M |
| 3300009148|Ga0105243_12205918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300009177|Ga0105248_11246229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300010043|Ga0126380_11845802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300010043|Ga0126380_12021755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300010048|Ga0126373_12275859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300010048|Ga0126373_12606051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300010146|Ga0126320_1466932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300010147|Ga0126319_1312966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300010152|Ga0126318_10154733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1093 | Open in IMG/M |
| 3300010152|Ga0126318_10835808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300010152|Ga0126318_10864342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300010152|Ga0126318_10928501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300010154|Ga0127503_10261624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300010154|Ga0127503_10333765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300010154|Ga0127503_10363519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 972 | Open in IMG/M |
| 3300010154|Ga0127503_11175603 | Not Available | 760 | Open in IMG/M |
| 3300010154|Ga0127503_11283802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300010333|Ga0134080_10536797 | Not Available | 561 | Open in IMG/M |
| 3300010335|Ga0134063_10384728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300010361|Ga0126378_10408530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1470 | Open in IMG/M |
| 3300010362|Ga0126377_11953113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300010371|Ga0134125_10889166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 978 | Open in IMG/M |
| 3300010376|Ga0126381_100135765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3208 | Open in IMG/M |
| 3300010376|Ga0126381_102115905 | Not Available | 810 | Open in IMG/M |
| 3300010376|Ga0126381_104385106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300010397|Ga0134124_12268521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300010403|Ga0134123_10200643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1697 | Open in IMG/M |
| 3300012199|Ga0137383_11185748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300012208|Ga0137376_10502045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1052 | Open in IMG/M |
| 3300012210|Ga0137378_10362583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
| 3300012211|Ga0137377_10691194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 955 | Open in IMG/M |
| 3300012212|Ga0150985_108311205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
| 3300012212|Ga0150985_116458790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300012285|Ga0137370_10113336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1539 | Open in IMG/M |
| 3300012355|Ga0137369_10788447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300012356|Ga0137371_11341387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300012397|Ga0134056_1319309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
| 3300012915|Ga0157302_10065996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
| 3300012923|Ga0137359_10978039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
| 3300012948|Ga0126375_10848437 | Not Available | 728 | Open in IMG/M |
| 3300012958|Ga0164299_10363270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
| 3300012961|Ga0164302_10209707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
| 3300012971|Ga0126369_10436250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1356 | Open in IMG/M |
| 3300012971|Ga0126369_12947057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300012976|Ga0134076_10535804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300012977|Ga0134087_10160410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
| 3300013104|Ga0157370_11211371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300013105|Ga0157369_10811253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
| 3300013772|Ga0120158_10076700 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300013832|Ga0120132_1071990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
| 3300014969|Ga0157376_12196039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300015200|Ga0173480_10992414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300015242|Ga0137412_10309532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
| 3300015374|Ga0132255_103765117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300017937|Ga0187809_10043769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
| 3300017939|Ga0187775_10289082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300017947|Ga0187785_10098526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
| 3300017947|Ga0187785_10452056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
| 3300017947|Ga0187785_10577599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300017959|Ga0187779_10024744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3435 | Open in IMG/M |
| 3300017959|Ga0187779_10698790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 686 | Open in IMG/M |
| 3300017966|Ga0187776_11518819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300017973|Ga0187780_10016255 | All Organisms → cellular organisms → Bacteria | 5392 | Open in IMG/M |
| 3300018064|Ga0187773_11255652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300018433|Ga0066667_11202823 | Not Available | 659 | Open in IMG/M |
| 3300018433|Ga0066667_12023314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300018468|Ga0066662_10212326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1542 | Open in IMG/M |
| 3300018482|Ga0066669_10750533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 861 | Open in IMG/M |
| 3300019361|Ga0173482_10350881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300019361|Ga0173482_10704868 | Not Available | 522 | Open in IMG/M |
| 3300019888|Ga0193751_1021642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3154 | Open in IMG/M |
| 3300020069|Ga0197907_10118806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1210 | Open in IMG/M |
| 3300020069|Ga0197907_10177811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1395 | Open in IMG/M |
| 3300020070|Ga0206356_11679712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1363 | Open in IMG/M |
| 3300020075|Ga0206349_1395714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1140 | Open in IMG/M |
| 3300020076|Ga0206355_1371284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300020081|Ga0206354_10082768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
| 3300021478|Ga0210402_11774092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300021560|Ga0126371_10100121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2885 | Open in IMG/M |
| 3300022467|Ga0224712_10145088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300022533|Ga0242662_10194322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 636 | Open in IMG/M |
| 3300024181|Ga0247693_1061905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300024182|Ga0247669_1077019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300024187|Ga0247672_1046782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
| 3300024187|Ga0247672_1060758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
| 3300024254|Ga0247661_1029106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 985 | Open in IMG/M |
| 3300024279|Ga0247692_1031041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300024323|Ga0247666_1049447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300025912|Ga0207707_10625421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 909 | Open in IMG/M |
| 3300025914|Ga0207671_10495782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300025918|Ga0207662_10086774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1918 | Open in IMG/M |
| 3300025922|Ga0207646_10065782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3236 | Open in IMG/M |
| 3300025924|Ga0207694_10112463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2167 | Open in IMG/M |
| 3300025944|Ga0207661_11274254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300026300|Ga0209027_1033825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1931 | Open in IMG/M |
| 3300026300|Ga0209027_1037084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1839 | Open in IMG/M |
| 3300026306|Ga0209468_1104996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
| 3300026547|Ga0209156_10056467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2063 | Open in IMG/M |
| 3300026552|Ga0209577_10262452 | Not Available | 1300 | Open in IMG/M |
| 3300027371|Ga0209418_1003480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2090 | Open in IMG/M |
| 3300027560|Ga0207981_1094786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300027773|Ga0209810_1011683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6542 | Open in IMG/M |
| 3300027857|Ga0209166_10003026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12355 | Open in IMG/M |
| 3300027903|Ga0209488_10029988 | All Organisms → cellular organisms → Bacteria | 3962 | Open in IMG/M |
| 3300028802|Ga0307503_10006950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3111 | Open in IMG/M |
| 3300028881|Ga0307277_10040496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1879 | Open in IMG/M |
| 3300030336|Ga0247826_10736299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300030917|Ga0075382_11774544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300031231|Ga0170824_104452872 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300031231|Ga0170824_112448426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300031231|Ga0170824_112809847 | Not Available | 682 | Open in IMG/M |
| 3300031231|Ga0170824_121331186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
| 3300031446|Ga0170820_12200205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300031446|Ga0170820_14663962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300031474|Ga0170818_101802156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300031474|Ga0170818_105970765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
| 3300031474|Ga0170818_111856086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 863 | Open in IMG/M |
| 3300031544|Ga0318534_10023178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3324 | Open in IMG/M |
| 3300031716|Ga0310813_11563678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300031740|Ga0307468_102355039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300031938|Ga0308175_100000083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 74915 | Open in IMG/M |
| 3300031938|Ga0308175_100183636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2043 | Open in IMG/M |
| 3300031938|Ga0308175_100792049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
| 3300031938|Ga0308175_101384880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 3300031939|Ga0308174_10102431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2055 | Open in IMG/M |
| 3300032068|Ga0318553_10676721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300032089|Ga0318525_10527496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300032180|Ga0307471_102568928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300032770|Ga0335085_10375651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1658 | Open in IMG/M |
| 3300032893|Ga0335069_10272776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2024 | Open in IMG/M |
| 3300032897|Ga0335071_10365023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300033290|Ga0318519_10719184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 611 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.13% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 5.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.47% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.47% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.47% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.47% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.47% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.47% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_100060942 | 3300000953 | Soil | LTRSRLFYLLLIASLFAYFLACFRFSGFSPLGMSDGGGLL* |
| C688J14111_100053432 | 3300001305 | Soil | LTRSRLIYLLLIASLFAYFLACMHMRFGGFGMSDGGGL* |
| C688J14111_101400152 | 3300001305 | Soil | LTKSRLIYLLLIASLFAYFLACLRVHGMNGIDGMSDGGGFLHL* |
| C688J14111_101656132 | 3300001305 | Soil | LTKTRLIYLLLIASLFAYILACGHFGGFGMSDGGGL* |
| A3PFW1_101218612 | 3300001535 | Permafrost | MTKARLIYLLLIASLFACLLGGMSDGGGFRPHPW* |
| C688J18823_100849022 | 3300001686 | Soil | LTKAKLIYLMLFASLFAYTLACFRVPGLSGIYGMSDGGGFL* |
| C688J18823_101522472 | 3300001686 | Soil | LTKARLIYLLLIASLFAYILACGRFGGFGMSDGGGLL* |
| C688J35102_1199716972 | 3300002568 | Soil | LTKSRLIYLLLIASLFAYFLACLRVHGMNGIDGMSDGGGFL |
| C688J35102_1203585342 | 3300002568 | Soil | LTKGRLIYVLLIASLFAYMLACLNLGHLIGGHGMSDGGGH* |
| C688J35102_1209890754 | 3300002568 | Soil | VTNLTKAKLIYLMLFASLFAYTLACFRVPGLSGIYGMSDGGGFL* |
| rootH2_101039862 | 3300003320 | Sugarcane Root And Bulk Soil | LTKARLIYVLLIASLFAYMLACLRLPGLFGGHGMSDGGGH* |
| soilH2_100145022 | 3300003324 | Sugarcane Root And Bulk Soil | LTKSRLIYLLLIASLFAYFLACFRLPSLNPWGMSDGGGLL* |
| Ga0062593_1011821872 | 3300004114 | Soil | FLLLIASLFAYSLAWFHLPGLHGIPGLSGTDGMSDGGGLL* |
| Ga0062595_1000213874 | 3300004479 | Soil | LTKGRLIYLLLIASLFASMFACLNLGWLFGGHGMSDGGGH* |
| Ga0062595_1001659452 | 3300004479 | Soil | LTKARLIYVLLIASLFAYMLACIRIPSLFGGHGMSDGGGH* |
| Ga0058863_100263621 | 3300004799 | Host-Associated | LTKARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV* |
| Ga0066677_104423032 | 3300005171 | Soil | LTKGRLIYVLLIASLFAYMLACLNLGHLFGGHGMSDGGGH* |
| Ga0066680_105149161 | 3300005174 | Soil | VTNLTKSRLIYLLLIASLCAYFLAHMPAFGHGMSDGGGL* |
| Ga0066673_102448422 | 3300005175 | Soil | VTNLTKSRLIYLLLIASLCAYFLARLPAFGHGMSDGGGL* |
| Ga0066679_101390002 | 3300005176 | Soil | LTKGRLIYVLLIASLFAYMLACVRLPLDHFGHGMSDGGGH* |
| Ga0066675_104446472 | 3300005187 | Soil | LTKSRLIYLLLIASLFAYFLACFRLSGFNPAGMSDGGGLLHL* |
| Ga0070658_100204691 | 3300005327 | Corn Rhizosphere | VTNLTKARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV* |
| Ga0070658_100593392 | 3300005327 | Corn Rhizosphere | VNRSRLIFLLLIASLFAYSLAWFHLPGLHGIPGLSGTDGMSDGGGLL* |
| Ga0066388_1001529612 | 3300005332 | Tropical Forest Soil | LTKARLISLLLIASLFAYILACLHGFHGGGFGMSDGGGF* |
| Ga0070692_108725542 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LTKTRLITVLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGG |
| Ga0070714_1000755462 | 3300005435 | Agricultural Soil | VNDLTKARLISLLLIASLFATVFACGSGGVLGGWLGMSSGGGF* |
| Ga0070714_1023535532 | 3300005435 | Agricultural Soil | LTKGRLIYVLLIASLFAYMLACLRLPGPFGHGMSDGGGH* |
| Ga0070713_1000355964 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VTKLTKSRLIYLLLIASLCAYFLACFRLPVGHGMSDGGGL* |
| Ga0070711_1003632082 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LTKSRLIYLLLIASLFAYFLACFRVHGLHGLNGIDGMSDGGGLL* |
| Ga0070708_1001673343 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RKGVNDLTKTRLMYVLLIASLFAYILAYCHGGIGMSSGGGF* |
| Ga0070663_1006732472 | 3300005455 | Corn Rhizosphere | LTKSRLIYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL* |
| Ga0070699_1011717902 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VKDLTKTRLTYVLLIASLLAFALACMHGHGGGIGMSSGGGF* |
| Ga0070737_101003102 | 3300005524 | Surface Soil | LTKSRLIYALLIASLFAYLLGCLPGLWHITGMSDGGGL* |
| Ga0073909_100039942 | 3300005526 | Surface Soil | LTKSRLIYLLLIASLFAYFLACFRYHGHNGIDGMSDGGGLL* |
| Ga0073909_100364722 | 3300005526 | Surface Soil | LTKARLIHLLLIASLFAYFLACTRGHGGWGMSDGGGF* |
| Ga0070739_100111062 | 3300005532 | Surface Soil | VTNLTKTRLIYLLLIASLFAYFLACLHGPGWNGMSDGGGLFR* |
| Ga0070739_100342472 | 3300005532 | Surface Soil | LTKARLIYLVVIASLCAYLLATVLAGGMSDGGGL* |
| Ga0070730_1000460613 | 3300005537 | Surface Soil | LTKGRLIYVLLTASLFAYMLSCLRLWHIGGGFGMSDGGGH* |
| Ga0070695_1016191042 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TEGGDDLTKARLIHLLLIASLFAYFLACTRGHGGWGMSDGGGF* |
| Ga0066692_104704491 | 3300005555 | Soil | MTKTRLTYLLLIASLFAYFLACTRGLGTAGMSDGGGLL* |
| Ga0066670_109872782 | 3300005560 | Soil | VTDLTKARLIYLLLIASLFAYFLACMGFGGMSDGGGFR* |
| Ga0068855_1004785262 | 3300005563 | Corn Rhizosphere | LTKGRLIYVLLIASLFAYMLACYRGGHGMSDGGGH* |
| Ga0066705_104369322 | 3300005569 | Soil | LTKGRLIYVLLIASLFAYMLACFNLGHLFGGHGMSDGGGH* |
| Ga0066708_100952392 | 3300005576 | Soil | LTKSRLIYLLLIASLCAYFLARMPAFGHGMSDGGGL* |
| Ga0066691_106801041 | 3300005586 | Soil | MTKSRLTYLLLIASLFAYFLASMGFGGMSDGGGFH* |
| Ga0066903_1000345852 | 3300005764 | Tropical Forest Soil | MTKSRLIYVLLIASLLAFFLAHAHGGHGMSDGGGLL* |
| Ga0066903_1000435722 | 3300005764 | Tropical Forest Soil | VTKLTKARLIYLLLIASLFAYFLACIRHSGTNGMSDGGGLL* |
| Ga0066903_1005899443 | 3300005764 | Tropical Forest Soil | VTDLTKARFIYLLVLASLFAYFLACQGWWGMSDGGGFH* |
| Ga0066903_1007852152 | 3300005764 | Tropical Forest Soil | MSASKQGREVTTLSKSRLIYLLLIASLFAYFLACLPGLVHISGMSDGGGL* |
| Ga0066903_1010613172 | 3300005764 | Tropical Forest Soil | VTDLTKARLIYLLLIASLFAYFLACFGVGFGMSDGGGFH* |
| Ga0066903_1015854062 | 3300005764 | Tropical Forest Soil | VTNLTKARLIYLLLIASLFAYILACVRHPGPTGMSDGGGLF* |
| Ga0066903_1019789832 | 3300005764 | Tropical Forest Soil | LTKARLIYLLLIASLFAYVLACVRHSGTSGMSDGGGLL* |
| Ga0066903_1032377382 | 3300005764 | Tropical Forest Soil | LTKARLIYLLLIASLFAYMLACLRGPVWTGMSDGGGLL* |
| Ga0075278_10460781 | 3300005893 | Rice Paddy Soil | LTKARFIYLLLIASLFAFFLGCLKSGGFGMSDGGGFF* |
| Ga0070717_100190636 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LTKSRLIYVLLIASLCAYFLAGFHLRGGFGMSDGGGL* |
| Ga0070717_107892801 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KEVNDLTKSRLIYVLLIASLCAYFLACFHPRGGFGMSDGGGL* |
| Ga0066696_100899263 | 3300006032 | Soil | LTKARLIYLLLMAALFAYMLACIRPGMSDGGGFR* |
| Ga0066656_101655362 | 3300006034 | Soil | LTKSRLIYLLLIASLCAYFLAHMPAFGHGMSDGGGL* |
| Ga0075017_1000245714 | 3300006059 | Watersheds | LTKARLIYLLLIASLFAYVLACVHGRGIYGMSDGGGFL* |
| Ga0070712_1016065862 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LTKARLIYLLLIASLFAYTLASCRFGSFGMSDGGGL* |
| Ga0074059_100067261 | 3300006578 | Soil | ISLLLVASLFAYLLACARGVVPVGMSDGGGLHLL* |
| Ga0074060_118903662 | 3300006604 | Soil | MTKSRLISLLLVASLFAYLLACARGVVPVGMSDGGGLHLL* |
| Ga0079222_104179202 | 3300006755 | Agricultural Soil | LTSSRLIYVLLIASLFAYSLACFRYHGQNGIDGFSDGGGLL* |
| Ga0079222_114783052 | 3300006755 | Agricultural Soil | LLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGGLL* |
| Ga0066653_100349042 | 3300006791 | Soil | LTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLLHL* |
| Ga0066658_101335872 | 3300006794 | Soil | LTKGRLIYVLLIASLFAYMLACVRLPLDHFGHGMSDG |
| Ga0066659_106136882 | 3300006797 | Soil | VTKLTKSRLIYLLLIASLFAYFLACFRLSGFSPTGMSDGGGLL* |
| Ga0066659_111033351 | 3300006797 | Soil | VTKLTKSRLIYLLLIASLFAYILACSHVGFGMSDGGGLI* |
| Ga0066660_104318721 | 3300006800 | Soil | LTKARFIYLLVIASLLAYFLACGHPHGGMSSGGGF* |
| Ga0079221_106168742 | 3300006804 | Agricultural Soil | VTNLTKTRLITVLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGGLL* |
| Ga0079221_111261141 | 3300006804 | Agricultural Soil | KGRLIYVLLIASLFAYMFACLNLGHLFGFGHGMSDGGGH* |
| Ga0079220_116486892 | 3300006806 | Agricultural Soil | LTKSRLIYLLLIASLFAYTLACFRVSLPGIGTSGMSDGGGLL* |
| Ga0075425_1022306982 | 3300006854 | Populus Rhizosphere | LTKTRLIHLLLIASLFAYFLACLHPRLLGGSGMSDGGGF* |
| Ga0075434_1024594752 | 3300006871 | Populus Rhizosphere | VNGLTKTRLMYVLLIASLFAYILAYCHHGIGMSGGGGF* |
| Ga0073928_101662592 | 3300006893 | Iron-Sulfur Acid Spring | LTKARFIYLLLIASLFAYLLACVRIPGLDGMSDGGGFF* |
| Ga0066710_1001269382 | 3300009012 | Grasslands Soil | VTNLTKSRLIYLLLIASLCAYFLARLPAFGHGMSDGGGL |
| Ga0105240_111481012 | 3300009093 | Corn Rhizosphere | LLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV* |
| Ga0066709_1004772152 | 3300009137 | Grasslands Soil | LTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLL* |
| Ga0099792_101130994 | 3300009143 | Vadose Zone Soil | HGKEVTILTKSRLIYVLLIASLCAYFLAHMLSFGHGMSDGGGL* |
| Ga0105243_122059181 | 3300009148 | Miscanthus Rhizosphere | LTKSRLIYLVLLASLFAYFLACFRYHGHNGIDGMSDGGGLL* |
| Ga0105248_112462291 | 3300009177 | Switchgrass Rhizosphere | LTKSRLVYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL* |
| Ga0126380_118458021 | 3300010043 | Tropical Forest Soil | TKARFIYLLLIASLFAYLLACIRVPGLDGMSDGGGFHFL* |
| Ga0126380_120217552 | 3300010043 | Tropical Forest Soil | MTKSRIIYLLLIASLLAYFLACAHIPIGGHGMSDGGGL* |
| Ga0126373_122758591 | 3300010048 | Tropical Forest Soil | LNKTRFIYLLLIASLFAYLLACLGLPGVDGMSDGGGFMGL* |
| Ga0126373_126060512 | 3300010048 | Tropical Forest Soil | LTKARFIYLLLIASLFAYFLACIRGPGWNGMSDGGGFF* |
| Ga0126320_14669322 | 3300010146 | Soil | LTKSRLIYLLLIASLFAYLLAGYGFFGGFGMCDGGGL* |
| Ga0126319_13129661 | 3300010147 | Soil | VTNLTKSRLIYVLLIASLCAYFLARMPSFGHGMSDGGGL* |
| Ga0126318_101547332 | 3300010152 | Soil | LTKSRLIYLLLIASLFAYTLACFRISLPGIGTSGMSDGGGLL* |
| Ga0126318_108358082 | 3300010152 | Soil | VTDLTKARLIYLLLIASLFAYFLACMGHGGMSDGGGLH* |
| Ga0126318_108643422 | 3300010152 | Soil | LTKARLIYVLLIASLFAYMLACLRLPGHFGGHGMSDGGGH* |
| Ga0126318_109285012 | 3300010152 | Soil | LTKGRLIYVLLIASLFAYAFACLNLGHFIHPGWGMSDGGGH* |
| Ga0127503_102616242 | 3300010154 | Soil | LTKAKLTYLLLIASLFAYLLAGAIGPGAAGMSSGGGF* |
| Ga0127503_103337652 | 3300010154 | Soil | MTKTRLTYLLLIASLFAYFLACIHGIGTGGMSDGGGLL* |
| Ga0127503_103635192 | 3300010154 | Soil | VTNLTKARLTYLLLIASLFAYLLAGAIGPGAAGMSSGGGF* |
| Ga0127503_111756032 | 3300010154 | Soil | VTNLTKARLTYLLIIASLFAYLLAGAVGAAGMSSGGGF* |
| Ga0127503_112838022 | 3300010154 | Soil | VTNLTKARLIYLLLIASLFAYFLACFHHPGPTGMSDGG |
| Ga0134080_105367971 | 3300010333 | Grasslands Soil | VTDLTKARLIYLLLIASLFAYFLACMGFGGMSDCGGFR* |
| Ga0134063_103847282 | 3300010335 | Grasslands Soil | VTNLTRSRLIYLLLIASLFAYFLACMHMRFGGFGMSDGGGL* |
| Ga0126378_104085302 | 3300010361 | Tropical Forest Soil | LNKTRFIYLLLIASLFAYLLACLGLPGIDGMSDGGGFMGL* |
| Ga0126377_119531131 | 3300010362 | Tropical Forest Soil | RLISLLLIASLFAYILACLHGFHGGGFGMSDGGGF* |
| Ga0134125_108891662 | 3300010371 | Terrestrial Soil | VTNLTKTKLIYLVLLASLFAYSLACFRMLGLIGIHGMSDGGGFM* |
| Ga0126381_1001357652 | 3300010376 | Tropical Forest Soil | VTDLTKARLIYLLLLAALFAYFLASMGWGGMSDGGGLH* |
| Ga0126381_1021159052 | 3300010376 | Tropical Forest Soil | LTKARLIYLLLLVSLFAYFLACMGWGGMSDGGGFH* |
| Ga0126381_1043851061 | 3300010376 | Tropical Forest Soil | VNELTKSRLIYVLLIASLCAYFLACFHLRIGFGMSDGGG |
| Ga0134124_122685211 | 3300010397 | Terrestrial Soil | LTKSRLIYLVLLASLFAYFLACFRVHGLHGLNGFDGMSDGGGLL* |
| Ga0134123_102006432 | 3300010403 | Terrestrial Soil | LTKSRLIYLLLIASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL* |
| Ga0137383_111857482 | 3300012199 | Vadose Zone Soil | VTDLTKARLIYLLLIASLFAYFLACTRGLGTAGMSDGGGLL* |
| Ga0137376_105020452 | 3300012208 | Vadose Zone Soil | VNELTKGRLIYVLLIASLFAYMLACFNLGHLFGGHGMSDGGGH* |
| Ga0137378_103625833 | 3300012210 | Vadose Zone Soil | QRPFRTSVSKEGGDDLTKARFMYLLVIASLLAYFLACGHPHGGMSSGGGF* |
| Ga0137377_106911942 | 3300012211 | Vadose Zone Soil | LTKARFIYLLVIASLLAYFLACGYPHGGMSSGGGF* |
| Ga0150985_1083112052 | 3300012212 | Avena Fatua Rhizosphere | LTKGRLIYVLLIASLFAYMLACLNLGHLIGGRGMSDGGGH* |
| Ga0150985_1164587901 | 3300012212 | Avena Fatua Rhizosphere | VTNLTKTRLISVLLIASLFAYVLAFARVLGHIGINGMCDGGGLL* |
| Ga0137370_101133362 | 3300012285 | Vadose Zone Soil | VTNLTKSRLIYLLLIASLCAYFLARMPAFGHGMSDGGGL* |
| Ga0137369_107884471 | 3300012355 | Vadose Zone Soil | VTNLTKSRLIYLLLIVSLCAYFLARMPAFGHGMSDGGGL* |
| Ga0137371_113413871 | 3300012356 | Vadose Zone Soil | TEGGDELTKGRLIYVLLIASLFAYMLACFNLGHLFGGHGMSDGGGH* |
| Ga0134056_13193092 | 3300012397 | Grasslands Soil | LTKSRLIYLLLIASLCAYFLAHMPAFGHGMSDGGGLL* |
| Ga0157302_100659962 | 3300012915 | Soil | MEGGDELTKSRLIYLLLIASLFAYFLACFRFHGLNGIDGMSDGGGLL* |
| Ga0137359_109780392 | 3300012923 | Vadose Zone Soil | MTKTRLTYLLLIASLLAYFLACTRGLGTAGMSDGGGLL* |
| Ga0126375_108484372 | 3300012948 | Tropical Forest Soil | LNKARLIYLLLIASLFAYVLACVRHSGPTGMSDGGGLF* |
| Ga0164299_103632701 | 3300012958 | Soil | LTKSRLIYLLLIASLFAYFLACFRYHGQHGIDGMSDGGGLL* |
| Ga0164302_102097072 | 3300012961 | Soil | LTKSRLIYLLLIASLFAYFLACFRVHGHNGIDGFSDGGGLL* |
| Ga0126369_104362502 | 3300012971 | Tropical Forest Soil | VTDLTKARLIYLLLIASLFAYFLACIRHSGTNGMSDGGGLL* |
| Ga0126369_129470572 | 3300012971 | Tropical Forest Soil | LTKARFIYLLLIASLFAYLLACIRVPGLDGMSDGGGFHFL* |
| Ga0134076_105358042 | 3300012976 | Grasslands Soil | ELTRSRLIYLLLVASLFAYFLACFRVPGLNGIFGMSDGGGLL* |
| Ga0134087_101604102 | 3300012977 | Grasslands Soil | LTKSRFIYLLLIASLCAYFLAHMPAFGHGMSDGGGL* |
| Ga0157370_112113711 | 3300013104 | Corn Rhizosphere | QRKGGDEVNRSRLIFLLLIASLFAYSLAWFHLPGLQGIPGLSGTDGMSDGGGFR* |
| Ga0157369_108112531 | 3300013105 | Corn Rhizosphere | TRLITVLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGGLL* |
| Ga0120158_100767002 | 3300013772 | Permafrost | VNDLTKARFIQVLLIASLFAYIFACMHIPGMSDGGGW* |
| Ga0120132_10719902 | 3300013832 | Permafrost | LTKARLIYLLVIASLFAYILACVRLPGTDGMSDGGGLL* |
| Ga0157376_121960391 | 3300014969 | Miscanthus Rhizosphere | ELTKSRLIYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL* |
| Ga0173480_109924141 | 3300015200 | Soil | LTKSRLIYLVLLASLFAYFLACFRFHGLNGIDGMSDGGGLL* |
| Ga0137412_103095321 | 3300015242 | Vadose Zone Soil | LTKSRLIYVLLIASLCAYFLAHMPSFGHGMSDGGGL* |
| Ga0132255_1037651171 | 3300015374 | Arabidopsis Rhizosphere | KSRLIYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL* |
| Ga0187809_100437692 | 3300017937 | Freshwater Sediment | LTKARLIYLLLIASLFAYLLACVRVPGLDGMSDGGGFHFL |
| Ga0187775_102890822 | 3300017939 | Tropical Peatland | LTKARLISLLLIASLFAYFLACLHGIHGWHGMSDGGGF |
| Ga0187785_100985262 | 3300017947 | Tropical Peatland | MTKARLIYLLLIASLFAYMLACVRHHGPTGMSDGGGLLL |
| Ga0187785_104520563 | 3300017947 | Tropical Peatland | LTKARLIYLLLLVSLFAYFLACMGWGGMSDGGGFH |
| Ga0187785_105775992 | 3300017947 | Tropical Peatland | LTKSRLIYLLLIASLFAYFLSCVPGLWHITGMSDGGGLR |
| Ga0187779_100247443 | 3300017959 | Tropical Peatland | LTKTRFIYLLLIASLLAYFLACSHGHGIFGMSDGGGLL |
| Ga0187779_106987902 | 3300017959 | Tropical Peatland | MTKSRLIYLLLVASLFAYLLACVRFHGLDGMSDGGGL |
| Ga0187776_110702061 | 3300017966 | Tropical Peatland | GGDDVTKARLMYLLVIAAIFALALASLRPIGMSDGGGLLFR |
| Ga0187776_115188192 | 3300017966 | Tropical Peatland | VTDLTKARLITLLLMASLFAYILACIQFPGMSDGGGFR |
| Ga0187780_100162555 | 3300017973 | Tropical Peatland | LTKARFIYLLLIASLFAYFLACLRGPGWSGMSDGGGLF |
| Ga0187773_112556521 | 3300018064 | Tropical Peatland | LTKARLIYLLLMASLFAYILACMRAPGMSDGGGFR |
| Ga0066667_112028231 | 3300018433 | Grasslands Soil | VTDLTKARLIYLLLIASLFAYFLACMGFGGMSDGGGFR |
| Ga0066667_120233142 | 3300018433 | Grasslands Soil | LTKGRLIYVLLIASLFAYMLACFNLGHLFGGHGMSDGGGH |
| Ga0066662_102123262 | 3300018468 | Grasslands Soil | LTKGRLIYVLLIASLFAYMLACVRLPLDHFGHGMSDGGGH |
| Ga0066669_107505332 | 3300018482 | Grasslands Soil | LTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLLHL |
| Ga0173482_103508812 | 3300019361 | Soil | LTKSRLIYLVLLASLFAYFLACFRVHGLHGLNGIDGMSDGGGLL |
| Ga0173482_107048681 | 3300019361 | Soil | LTKSRLIYLLLIASLFAYFLACFRVHGLHGLNGIDGMSDG |
| Ga0193751_10216423 | 3300019888 | Soil | VNDLTKARFIQVLLIASLFAYIFACLHIPGMSDGGGW |
| Ga0197907_101188062 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LTKGRLIYVLLIASLFAYMLACYRGGHGMSDGGGH |
| Ga0197907_101778112 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VTNLTKARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV |
| Ga0206356_116797122 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRSRLIFLLLIASLFAYSLAWFHLPGLQGIPGLSGTDGMSDGGGLL |
| Ga0206349_13957142 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRSRLIFLLLIASLFAYSLAWFHLPGLHGIPGLSGTDGMSDGGGLL |
| Ga0206355_13712842 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | LLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV |
| Ga0206354_100827682 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LTKSRLIYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL |
| Ga0210402_117740922 | 3300021478 | Soil | VTTLTKSRLIYLLLIASLFAYFLACLPGLWQVSGMSDGGGL |
| Ga0126371_101001213 | 3300021560 | Tropical Forest Soil | LTKSRLIYVLLIASLCAYFLACFHLRIGFGMSDGGGL |
| Ga0224712_101450882 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VTNLTKTRLITVLLIASLFAYSLAWFRIPGLHGIPGLNGIDGMSDGGGLL |
| Ga0242662_101943223 | 3300022533 | Soil | MTKSRLISVLLVASLFAYLLACARGVVPVGMSDGGGLHLL |
| Ga0247693_10619051 | 3300024181 | Soil | LTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLL |
| Ga0247669_10770191 | 3300024182 | Soil | NLTKARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV |
| Ga0247672_10467822 | 3300024187 | Soil | VTDLTKARLIYLLLIASLFAYFLASMGWGGMSDGGGFH |
| Ga0247672_10607582 | 3300024187 | Soil | GKEVTKLTKSRLIYLLLIASLCAYFLACFRLPVGHGMSDGGGL |
| Ga0247661_10291061 | 3300024254 | Soil | GDDLTKARLIHLLLIASLFAYFLACTRGHGGWGMSDGGGF |
| Ga0247692_10310411 | 3300024279 | Soil | LTKSRLIYLLLIASLCAYFLACFRLPVGHGMSDGGGL |
| Ga0247666_10494471 | 3300024323 | Soil | ARLITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV |
| Ga0207707_106254211 | 3300025912 | Corn Rhizosphere | VNRSRLIFLLLIASLFAYSLAWFHLPGLQGIPGLSGTDGMSD |
| Ga0207671_104957821 | 3300025914 | Corn Rhizosphere | VNRSRLIFLLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV |
| Ga0207662_100867742 | 3300025918 | Switchgrass Rhizosphere | LTKSRLIYLLLIASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL |
| Ga0207646_100657824 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTNLTKVRLISLLLIASLFAYSLAYLGGFGMCDGGGLF |
| Ga0207694_101124632 | 3300025924 | Corn Rhizosphere | LTKSRLVYLVLLASLFAYFLACFRFHGLHGLNGIDGMSDGGGLL |
| Ga0207661_112742541 | 3300025944 | Corn Rhizosphere | LTKSRLIYLVLLASLFAYFLACFRFHGLHGLNGID |
| Ga0209027_10338252 | 3300026300 | Grasslands Soil | LTKSRLIYLLLTASLFAYFLACFRLSGFNPSGMSDGGGLL |
| Ga0209027_10370842 | 3300026300 | Grasslands Soil | LTKSRLIYLLLIASLCAYFLARIPAFGHGMSDGGGL |
| Ga0209468_11049962 | 3300026306 | Soil | DELTKSRLIYLLLIASLFAYFLACFRLSGFNPSGMSDGGGLL |
| Ga0209156_100564672 | 3300026547 | Soil | LTKSRLIYLLLIASLCAYFLAHMPAFGHGMSDGGGL |
| Ga0209577_102624521 | 3300026552 | Soil | EGGDDLTKARFMYLLVIASLLAYFLACGHPHGGMSSGGGF |
| Ga0209418_10034803 | 3300027371 | Forest Soil | LTKARLTYLLLIASLFAYFLACTRGHGGLGMSDGGGF |
| Ga0207981_10947862 | 3300027560 | Soil | LTKSRLIYLLLIASLFAYFLACFHHPGPTGMSDGGGL |
| Ga0209810_10116837 | 3300027773 | Surface Soil | LTKTRLIYLLLIASLFAYFLACLHGPGWNGMSDGGGLFR |
| Ga0209166_100030266 | 3300027857 | Surface Soil | LTKGRLIYVLLTASLFAYMLSCLRLWHIGGGFGMSDGGGH |
| Ga0209488_100299883 | 3300027903 | Vadose Zone Soil | VTNLTKSRLIYLLLIASLCAYFLARMPSFGHGMSDGGGL |
| Ga0307503_100069501 | 3300028802 | Soil | VTNLTKSRLIYLVLMASLLAYFLACFRHPIGGFGMSDGGGL |
| Ga0307277_100404962 | 3300028881 | Soil | LTKSRLIYLLLIASLFAYFLACFRVHGLNGIDGMSDGGGFLHL |
| Ga0247826_107362992 | 3300030336 | Soil | LTKSRLIYLVLLASLFAYFLACFRVHGLHGLNGFDGMSDGGGLL |
| Ga0075382_117745442 | 3300030917 | Soil | LTKSRLIYLLLIASLLAYFLACFRHPIGGFGMSDGGGL |
| Ga0170824_1044528722 | 3300031231 | Forest Soil | LTKARLIYLLLIASLFAYFLACIHPKYGGSGMSDGGGF |
| Ga0170824_1124484262 | 3300031231 | Forest Soil | LTKSRLIYLLLIASLFAYFLACFRLSGLSPSGMSDGGGLL |
| Ga0170824_1128098472 | 3300031231 | Forest Soil | MTNLTKARLMYLLLIASLFAYLLAGAIGPGAFGMSSGGGF |
| Ga0170824_1213311862 | 3300031231 | Forest Soil | LTKGRLIYVLLIASLFAYMLACLHIGQLFGGHGMSDGGGH |
| Ga0170820_122002052 | 3300031446 | Forest Soil | MTKSRLTYLLLIASLFAYLLASARGVVPVGMSDGGGLL |
| Ga0170820_146639621 | 3300031446 | Forest Soil | LTKARLIHLLIIASLFAYFLACTRGHGGFGMSDGGGF |
| Ga0170818_1018021561 | 3300031474 | Forest Soil | MTKSRLTYLLLIASLLAFFLASARGVVPVGMSDGGGLL |
| Ga0170818_1059707651 | 3300031474 | Forest Soil | LTKARLIYLLIIASLFAYILACTRGHGGFGMSDGGGF |
| Ga0170818_1118560861 | 3300031474 | Forest Soil | VTNLTKSRLIYLLLIASLLAYFLACFRHPIGGFGMSDGGGL |
| Ga0318534_100231782 | 3300031544 | Soil | LTKARFIYLLLIASLFAYFLACIRGPGWSGMSDGGGFF |
| Ga0310813_115636782 | 3300031716 | Soil | ITVLLIASLFAYSLAFFHFPGLHGIPGLNGIDGMSDGGGFV |
| Ga0307468_1023550392 | 3300031740 | Hardwood Forest Soil | VTNLTKARLMYLLLIASLFAYLLACLGGPVGAGMSSGGGF |
| Ga0308175_10000008367 | 3300031938 | Soil | LTKARFIYLLLIASLFAYFLACFHGGWGGMSNGGGF |
| Ga0308175_1001836362 | 3300031938 | Soil | LTKTRLISVLLIASLFAYVLAFARVLGHIGINGMCDGGGLL |
| Ga0308175_1007920491 | 3300031938 | Soil | VTDLTKAKLIYLVLLASLFAYTLACFRVPGLSGIYGMSDGGGFF |
| Ga0308175_1013848802 | 3300031938 | Soil | LTKSRLIYLLLIASLFAYFLACFRVHGFSPSGMSDGGGLLYL |
| Ga0308174_101024312 | 3300031939 | Soil | LTKSRLIYLLLIASLFAYLLAGYGFFGGFGMCDGGGL |
| Ga0318553_106767211 | 3300032068 | Soil | GKEVTTLKARLIYLLLIASLFAYLLACLHQRGPTGMSDGGGLY |
| Ga0318525_105274962 | 3300032089 | Soil | LTKARFIYLLLIASLFAYFLACIRGPGWTGMSDGGGFL |
| Ga0307471_1025689282 | 3300032180 | Hardwood Forest Soil | GKEVTDLTKHRLINLLLIASLFAFILASLYGPGQLGMSDGGGLI |
| Ga0335085_103756512 | 3300032770 | Soil | VNELTKSRLIYVLLIASLCAYFLACFHFRGGFGMSDGGGLL |
| Ga0335069_102727762 | 3300032893 | Soil | VNELTKSRLIYVLLIASLCAYFLACFHSRGGFGMSDGGGLL |
| Ga0335071_103650231 | 3300032897 | Soil | LTKARLIYLLLIASLFAYILACSRHAGPSGMSDGGGFF |
| Ga0318519_107191842 | 3300033290 | Soil | LTKARLMYLLVIASLFAYLLACSRGPGGFGMSDGGGF |
| ⦗Top⦘ |