| Basic Information | |
|---|---|
| Family ID | F022902 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 212 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 94.81 % |
| % of genes from short scaffolds (< 2000 bps) | 94.34 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.642 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.660 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.491 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 1.42 |
| PF08840 | BAAT_C | 0.47 |
| PF02321 | OEP | 0.47 |
| PF12680 | SnoaL_2 | 0.47 |
| PF02837 | Glyco_hydro_2_N | 0.47 |
| PF00263 | Secretin | 0.47 |
| PF13520 | AA_permease_2 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.11 % |
| Unclassified | root | N/A | 26.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_3035298 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 902 | Open in IMG/M |
| 2170459002|F0B48LX02J3ZO0 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 527 | Open in IMG/M |
| 2170459006|GBPF9FW01BGO2G | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 502 | Open in IMG/M |
| 2170459010|GIO7OMY01C5AM1 | Not Available | 530 | Open in IMG/M |
| 3300002244|JGI24742J22300_10029824 | Not Available | 950 | Open in IMG/M |
| 3300002244|JGI24742J22300_10043294 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300004114|Ga0062593_103403958 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300004463|Ga0063356_102041719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300005148|Ga0066819_1007603 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 724 | Open in IMG/M |
| 3300005330|Ga0070690_100981640 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 665 | Open in IMG/M |
| 3300005331|Ga0070670_100399172 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300005340|Ga0070689_102113928 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 515 | Open in IMG/M |
| 3300005347|Ga0070668_100207803 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1609 | Open in IMG/M |
| 3300005353|Ga0070669_101284410 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 633 | Open in IMG/M |
| 3300005354|Ga0070675_101403685 | Not Available | 644 | Open in IMG/M |
| 3300005355|Ga0070671_101738864 | Not Available | 554 | Open in IMG/M |
| 3300005356|Ga0070674_100724032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 852 | Open in IMG/M |
| 3300005356|Ga0070674_100901926 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 770 | Open in IMG/M |
| 3300005364|Ga0070673_101137539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300005365|Ga0070688_100320261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL12 | 1126 | Open in IMG/M |
| 3300005365|Ga0070688_101482823 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 551 | Open in IMG/M |
| 3300005457|Ga0070662_100387960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1151 | Open in IMG/M |
| 3300005459|Ga0068867_102345989 | Not Available | 507 | Open in IMG/M |
| 3300005544|Ga0070686_100301642 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1188 | Open in IMG/M |
| 3300005578|Ga0068854_100507259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1017 | Open in IMG/M |
| 3300005616|Ga0068852_101192465 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005618|Ga0068864_100816372 | Not Available | 917 | Open in IMG/M |
| 3300005618|Ga0068864_100846055 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300005618|Ga0068864_101609741 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 653 | Open in IMG/M |
| 3300005618|Ga0068864_102020322 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 583 | Open in IMG/M |
| 3300005719|Ga0068861_100283612 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300005719|Ga0068861_100765312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 903 | Open in IMG/M |
| 3300005842|Ga0068858_100675748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1004 | Open in IMG/M |
| 3300005843|Ga0068860_101856180 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 624 | Open in IMG/M |
| 3300005844|Ga0068862_102225227 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006031|Ga0066651_10012514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3482 | Open in IMG/M |
| 3300006048|Ga0075363_100573770 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 674 | Open in IMG/M |
| 3300006237|Ga0097621_100569901 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300006237|Ga0097621_102064839 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006237|Ga0097621_102258819 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 520 | Open in IMG/M |
| 3300006358|Ga0068871_100957193 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 796 | Open in IMG/M |
| 3300006358|Ga0068871_102027764 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006358|Ga0068871_102114132 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 536 | Open in IMG/M |
| 3300006604|Ga0074060_10942931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 897 | Open in IMG/M |
| 3300006606|Ga0074062_13019317 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 750 | Open in IMG/M |
| 3300006871|Ga0075434_101825757 | Not Available | 614 | Open in IMG/M |
| 3300006881|Ga0068865_100582932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 943 | Open in IMG/M |
| 3300009081|Ga0105098_10378872 | Not Available | 697 | Open in IMG/M |
| 3300009094|Ga0111539_10326730 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1785 | Open in IMG/M |
| 3300009094|Ga0111539_12572511 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 590 | Open in IMG/M |
| 3300009098|Ga0105245_10387019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL12 | 1394 | Open in IMG/M |
| 3300009098|Ga0105245_10756644 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1008 | Open in IMG/M |
| 3300009098|Ga0105245_10797105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 982 | Open in IMG/M |
| 3300009098|Ga0105245_10813914 | Not Available | 973 | Open in IMG/M |
| 3300009098|Ga0105245_11857018 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 655 | Open in IMG/M |
| 3300009098|Ga0105245_12438368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 576 | Open in IMG/M |
| 3300009148|Ga0105243_12374682 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 568 | Open in IMG/M |
| 3300009156|Ga0111538_11172687 | Not Available | 971 | Open in IMG/M |
| 3300009156|Ga0111538_12670005 | Not Available | 626 | Open in IMG/M |
| 3300009156|Ga0111538_13403551 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 553 | Open in IMG/M |
| 3300009176|Ga0105242_10204148 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1757 | Open in IMG/M |
| 3300009176|Ga0105242_11166977 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 788 | Open in IMG/M |
| 3300009176|Ga0105242_12272314 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 588 | Open in IMG/M |
| 3300009176|Ga0105242_13174264 | Not Available | 510 | Open in IMG/M |
| 3300009177|Ga0105248_11622338 | Not Available | 733 | Open in IMG/M |
| 3300009177|Ga0105248_12475137 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 591 | Open in IMG/M |
| 3300009177|Ga0105248_13317487 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 512 | Open in IMG/M |
| 3300009551|Ga0105238_10002586 | All Organisms → cellular organisms → Bacteria | 18035 | Open in IMG/M |
| 3300009551|Ga0105238_12313173 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 573 | Open in IMG/M |
| 3300009610|Ga0105340_1258180 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 749 | Open in IMG/M |
| 3300009678|Ga0105252_10571300 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 522 | Open in IMG/M |
| 3300010362|Ga0126377_10728616 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1046 | Open in IMG/M |
| 3300011119|Ga0105246_11829086 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 581 | Open in IMG/M |
| 3300011119|Ga0105246_12510952 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 507 | Open in IMG/M |
| 3300011400|Ga0137312_1013452 | Not Available | 1071 | Open in IMG/M |
| 3300011400|Ga0137312_1014292 | Not Available | 1050 | Open in IMG/M |
| 3300011400|Ga0137312_1024219 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 885 | Open in IMG/M |
| 3300011415|Ga0137325_1027807 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1145 | Open in IMG/M |
| 3300011422|Ga0137425_1098464 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 707 | Open in IMG/M |
| 3300011430|Ga0137423_1191758 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 614 | Open in IMG/M |
| 3300011439|Ga0137432_1187541 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 669 | Open in IMG/M |
| 3300011442|Ga0137437_1174747 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 745 | Open in IMG/M |
| 3300012159|Ga0137344_1044060 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 781 | Open in IMG/M |
| 3300012891|Ga0157305_10034375 | Not Available | 1006 | Open in IMG/M |
| 3300012896|Ga0157303_10069722 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 777 | Open in IMG/M |
| 3300012898|Ga0157293_10125218 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 695 | Open in IMG/M |
| 3300012899|Ga0157299_10289338 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 537 | Open in IMG/M |
| 3300012901|Ga0157288_10124319 | Not Available | 736 | Open in IMG/M |
| 3300012903|Ga0157289_10021072 | Not Available | 1424 | Open in IMG/M |
| 3300012903|Ga0157289_10077141 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 906 | Open in IMG/M |
| 3300012905|Ga0157296_10254579 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 591 | Open in IMG/M |
| 3300012908|Ga0157286_10405692 | Not Available | 530 | Open in IMG/M |
| 3300012909|Ga0157290_10391894 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 540 | Open in IMG/M |
| 3300012913|Ga0157298_10368699 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 535 | Open in IMG/M |
| 3300012913|Ga0157298_10379754 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 531 | Open in IMG/M |
| 3300013297|Ga0157378_11425670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300013306|Ga0163162_10685266 | Not Available | 1147 | Open in IMG/M |
| 3300013308|Ga0157375_10320190 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1715 | Open in IMG/M |
| 3300013308|Ga0157375_11251459 | Not Available | 871 | Open in IMG/M |
| 3300014325|Ga0163163_10757909 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1034 | Open in IMG/M |
| 3300014325|Ga0163163_12342044 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 593 | Open in IMG/M |
| 3300014325|Ga0163163_12762573 | Not Available | 548 | Open in IMG/M |
| 3300014326|Ga0157380_11916663 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 653 | Open in IMG/M |
| 3300014326|Ga0157380_12424886 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 590 | Open in IMG/M |
| 3300014326|Ga0157380_13343114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300014968|Ga0157379_10633372 | Not Available | 1000 | Open in IMG/M |
| 3300014969|Ga0157376_10038293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3900 | Open in IMG/M |
| 3300014969|Ga0157376_11649586 | Not Available | 676 | Open in IMG/M |
| 3300015200|Ga0173480_10519070 | Not Available | 717 | Open in IMG/M |
| 3300015201|Ga0173478_10024276 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1763 | Open in IMG/M |
| 3300015371|Ga0132258_12194883 | Not Available | 1386 | Open in IMG/M |
| 3300015374|Ga0132255_101915268 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 902 | Open in IMG/M |
| 3300016270|Ga0182036_11090438 | Not Available | 661 | Open in IMG/M |
| 3300017792|Ga0163161_10220169 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1470 | Open in IMG/M |
| 3300017792|Ga0163161_11013054 | Not Available | 709 | Open in IMG/M |
| 3300017792|Ga0163161_11739001 | Not Available | 553 | Open in IMG/M |
| 3300018067|Ga0184611_1317596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 539 | Open in IMG/M |
| 3300018067|Ga0184611_1347776 | Not Available | 509 | Open in IMG/M |
| 3300018067|Ga0184611_1353908 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 503 | Open in IMG/M |
| 3300018072|Ga0184635_10332087 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 588 | Open in IMG/M |
| 3300018073|Ga0184624_10351036 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 660 | Open in IMG/M |
| 3300018073|Ga0184624_10523040 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 514 | Open in IMG/M |
| 3300018081|Ga0184625_10284132 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 866 | Open in IMG/M |
| 3300018083|Ga0184628_10169206 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1140 | Open in IMG/M |
| 3300018083|Ga0184628_10279164 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 878 | Open in IMG/M |
| 3300018476|Ga0190274_11474011 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 771 | Open in IMG/M |
| 3300018476|Ga0190274_11532870 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 758 | Open in IMG/M |
| 3300018481|Ga0190271_11830490 | Not Available | 719 | Open in IMG/M |
| 3300018481|Ga0190271_12382171 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 633 | Open in IMG/M |
| 3300019361|Ga0173482_10081894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1131 | Open in IMG/M |
| 3300020009|Ga0193740_1012718 | Not Available | 1348 | Open in IMG/M |
| 3300020016|Ga0193696_1071694 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 902 | Open in IMG/M |
| 3300021363|Ga0193699_10331226 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 634 | Open in IMG/M |
| 3300021475|Ga0210392_10973318 | Not Available | 635 | Open in IMG/M |
| 3300022893|Ga0247787_1064062 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 555 | Open in IMG/M |
| 3300022899|Ga0247795_1001236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4289 | Open in IMG/M |
| 3300022911|Ga0247783_1200986 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 571 | Open in IMG/M |
| 3300022915|Ga0247790_10080036 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 785 | Open in IMG/M |
| 3300022915|Ga0247790_10191803 | Not Available | 540 | Open in IMG/M |
| 3300022917|Ga0247777_1170475 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 710 | Open in IMG/M |
| 3300023067|Ga0247743_1002584 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2036 | Open in IMG/M |
| 3300023079|Ga0247758_1147872 | Not Available | 649 | Open in IMG/M |
| 3300024254|Ga0247661_1023443 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1086 | Open in IMG/M |
| 3300024254|Ga0247661_1094490 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 564 | Open in IMG/M |
| 3300024283|Ga0247670_1097277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 543 | Open in IMG/M |
| 3300024286|Ga0247687_1060994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 572 | Open in IMG/M |
| 3300024310|Ga0247681_1004681 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1707 | Open in IMG/M |
| 3300024310|Ga0247681_1050973 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 635 | Open in IMG/M |
| 3300025899|Ga0207642_10349930 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 871 | Open in IMG/M |
| 3300025905|Ga0207685_10189127 | Not Available | 960 | Open in IMG/M |
| 3300025914|Ga0207671_10119009 | Not Available | 2017 | Open in IMG/M |
| 3300025925|Ga0207650_10526892 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 989 | Open in IMG/M |
| 3300025926|Ga0207659_10453118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL12 | 1081 | Open in IMG/M |
| 3300025927|Ga0207687_11170803 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 661 | Open in IMG/M |
| 3300025927|Ga0207687_11390315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 603 | Open in IMG/M |
| 3300025928|Ga0207700_11247319 | Not Available | 663 | Open in IMG/M |
| 3300025930|Ga0207701_10160626 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1989 | Open in IMG/M |
| 3300025930|Ga0207701_10524801 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1012 | Open in IMG/M |
| 3300025931|Ga0207644_11327620 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 604 | Open in IMG/M |
| 3300025934|Ga0207686_11575595 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 542 | Open in IMG/M |
| 3300025937|Ga0207669_10162555 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| 3300025937|Ga0207669_11086680 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 675 | Open in IMG/M |
| 3300025938|Ga0207704_10841999 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 768 | Open in IMG/M |
| 3300025938|Ga0207704_11893728 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 513 | Open in IMG/M |
| 3300025940|Ga0207691_10109782 | Not Available | 2454 | Open in IMG/M |
| 3300025941|Ga0207711_10711015 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 937 | Open in IMG/M |
| 3300025960|Ga0207651_11015959 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 741 | Open in IMG/M |
| 3300025960|Ga0207651_11046247 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 730 | Open in IMG/M |
| 3300025960|Ga0207651_11491094 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 609 | Open in IMG/M |
| 3300025960|Ga0207651_11962986 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 526 | Open in IMG/M |
| 3300025961|Ga0207712_11028272 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 732 | Open in IMG/M |
| 3300025972|Ga0207668_10116983 | Not Available | 2011 | Open in IMG/M |
| 3300026023|Ga0207677_11420493 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 639 | Open in IMG/M |
| 3300026078|Ga0207702_10736736 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 972 | Open in IMG/M |
| 3300026088|Ga0207641_10722276 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 982 | Open in IMG/M |
| 3300026089|Ga0207648_11950454 | Not Available | 549 | Open in IMG/M |
| 3300026089|Ga0207648_12167969 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 516 | Open in IMG/M |
| 3300026095|Ga0207676_11191506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 755 | Open in IMG/M |
| 3300026118|Ga0207675_100982150 | Not Available | 862 | Open in IMG/M |
| 3300026118|Ga0207675_101151245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300026118|Ga0207675_101784507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300026121|Ga0207683_10199321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1819 | Open in IMG/M |
| 3300026121|Ga0207683_10206082 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300026121|Ga0207683_10333925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1389 | Open in IMG/M |
| 3300026929|Ga0207461_1013716 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 504 | Open in IMG/M |
| 3300027523|Ga0208890_1051123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 655 | Open in IMG/M |
| 3300027533|Ga0208185_1075723 | Not Available | 797 | Open in IMG/M |
| 3300027821|Ga0209811_10024974 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1972 | Open in IMG/M |
| 3300027874|Ga0209465_10253897 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 880 | Open in IMG/M |
| 3300027907|Ga0207428_10713272 | Not Available | 717 | Open in IMG/M |
| 3300028281|Ga0247689_1010470 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300028293|Ga0247662_1002824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 2435 | Open in IMG/M |
| 3300028380|Ga0268265_10854695 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 890 | Open in IMG/M |
| 3300028704|Ga0307321_1121753 | Not Available | 541 | Open in IMG/M |
| 3300028790|Ga0307283_10246079 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 524 | Open in IMG/M |
| 3300028803|Ga0307281_10202660 | Not Available | 715 | Open in IMG/M |
| 3300028812|Ga0247825_11250625 | Not Available | 542 | Open in IMG/M |
| 3300028889|Ga0247827_11276984 | Not Available | 512 | Open in IMG/M |
| 3300031226|Ga0307497_10128282 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1026 | Open in IMG/M |
| 3300031226|Ga0307497_10168654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 924 | Open in IMG/M |
| 3300031455|Ga0307505_10287501 | Not Available | 769 | Open in IMG/M |
| 3300031547|Ga0310887_10541057 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 707 | Open in IMG/M |
| 3300031740|Ga0307468_100652348 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 870 | Open in IMG/M |
| 3300031793|Ga0318548_10332860 | Not Available | 745 | Open in IMG/M |
| 3300031799|Ga0318565_10166595 | Not Available | 1070 | Open in IMG/M |
| 3300032060|Ga0318505_10184061 | Not Available | 975 | Open in IMG/M |
| 3300032067|Ga0318524_10763336 | Not Available | 511 | Open in IMG/M |
| 3300032205|Ga0307472_102541083 | Not Available | 521 | Open in IMG/M |
| 3300034149|Ga0364929_0089959 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 960 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 8.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.13% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.36% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.42% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.47% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.47% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.47% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300022917 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300023079 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026929 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0074.00003420 | 2162886012 | Miscanthus Rhizosphere | NTMWVSIGLMGFSHAPIVQVTVAQQAKPDVELIAIAATFEQAGVTV |
| E1_00749180 | 2170459002 | Grass Soil | PSTATVRNTMWVSIGYTGFSHAPICQVTIAQQALPIVELISIAATYDGAGVNV |
| L01_03775980 | 2170459006 | Grass Soil | IRNTGWVSIGMTGFSHAPVVQVTVAQQAKPDVELISISAVYERLGVNV |
| F62_04848560 | 2170459010 | Grass Soil | AQWDQTYPNRLVTTNTRWVSDWGPTGFSHAPIVQITVAQRAKPSVDLISISATFERAGVN |
| JGI24742J22300_100298243 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | SHAPVVQVTIAQTAKPDIELISIAATFERLGVNV* |
| JGI24742J22300_100432943 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | PKNVIRNTGWVSIGMTGFSHAPIVQVTVAQQTKPEVDLINIAATFERDAIVV* |
| Ga0062593_1034039581 | 3300004114 | Soil | NRNTLWVSIGMSGFAHAPIIQVTIAQTLRPEVELVAVTATFEVAGVNV* |
| Ga0063356_1020417192 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV* |
| Ga0066819_10076032 | 3300005148 | Soil | SIGMTGFSHAPIVQVTVAQQAKPDVELIAIAAVYEPAGVNV* |
| Ga0070690_1009816401 | 3300005330 | Switchgrass Rhizosphere | LGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV* |
| Ga0070670_1003991721 | 3300005331 | Switchgrass Rhizosphere | RNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV* |
| Ga0070689_1021139281 | 3300005340 | Switchgrass Rhizosphere | APGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPNVELVALGATYEIAGVNV* |
| Ga0070668_1002078034 | 3300005347 | Switchgrass Rhizosphere | SIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV* |
| Ga0070669_1012844102 | 3300005353 | Switchgrass Rhizosphere | HRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV* |
| Ga0070675_1014036851 | 3300005354 | Miscanthus Rhizosphere | VSIGQTGYSHAPIVQVTVAQNARPVVDLISIAAIFERAGINV* |
| Ga0070671_1017388642 | 3300005355 | Switchgrass Rhizosphere | VSIGLTGFSHAPVVQVTVAQNAKPIVDMISIAATFERAGVNV* |
| Ga0070674_1007240321 | 3300005356 | Miscanthus Rhizosphere | WGTAIWDAGTPPPLVVRNTGWVSIGLTGFSHAPIVQVTVAQQAKPEVDLISIAATYERAGVNV* |
| Ga0070674_1009019261 | 3300005356 | Miscanthus Rhizosphere | DAIWDAGTPPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQNAKPEVDLISIAATFERMGINV* |
| Ga0070673_1011375391 | 3300005364 | Switchgrass Rhizosphere | VVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV* |
| Ga0070688_1003202611 | 3300005365 | Switchgrass Rhizosphere | VRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV* |
| Ga0070688_1014828231 | 3300005365 | Switchgrass Rhizosphere | APGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV* |
| Ga0070662_1003879603 | 3300005457 | Corn Rhizosphere | GMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV* |
| Ga0068867_1023459891 | 3300005459 | Miscanthus Rhizosphere | PPSVTVRNTGWVSIGVTGYSHAPIIQVTVAQRARPQVDLISIAATFERCGITV* |
| Ga0070686_1003016422 | 3300005544 | Switchgrass Rhizosphere | NTMWVSIGLMGFSHAPIVQVTVAQQAKPDVELIAIAATFEQAGVTV* |
| Ga0068854_1005072593 | 3300005578 | Corn Rhizosphere | MTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV* |
| Ga0070702_1017200161 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | TPSPPPSPADLDAYAQWDLGIPRPPSVRNTGWVSIGLTGFSHAPVVQVTVAQNAKPIVDMISIAATFERAGVNV* |
| Ga0068852_1011924651 | 3300005616 | Corn Rhizosphere | PAPATPTVRNTMWVSIGFTGFSHAPICQVTIAQQSAPDIELISIAATYDGAGVNV* |
| Ga0068864_1008163721 | 3300005618 | Switchgrass Rhizosphere | FAHAPIVQVTVAQVARPRVELISIATTQERGGVNV* |
| Ga0068864_1008460553 | 3300005618 | Switchgrass Rhizosphere | VPPKPVVRNTGWVSIGLTGYSHAPVVQVTVAQAAKPEVDLISIAATFERAGVNV* |
| Ga0068864_1016097411 | 3300005618 | Switchgrass Rhizosphere | APGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV* |
| Ga0068864_1020203221 | 3300005618 | Switchgrass Rhizosphere | RNTGWVSIGMTGYSHAPIVQVSVGQQAKPEVDLISIAATFERDGVNV* |
| Ga0068861_1002836124 | 3300005719 | Switchgrass Rhizosphere | ALVTPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV* |
| Ga0068861_1007653121 | 3300005719 | Switchgrass Rhizosphere | VKSTGWVSVGMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV* |
| Ga0068858_1006757483 | 3300005842 | Switchgrass Rhizosphere | LVTPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV* |
| Ga0068860_1018561802 | 3300005843 | Switchgrass Rhizosphere | SFRNTMWVSIGLMGFSHAPIVQVTVAQQAKPDVELIAIAATFEQAGVTV* |
| Ga0068862_1022252271 | 3300005844 | Switchgrass Rhizosphere | PARNRPANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAAIFEVAGTNV* |
| Ga0066651_100125144 | 3300006031 | Soil | VRLSPVRNTLWVSIGMTGFAHAPIVQVTVAQQATPDVELLALSTTYERAGVNV* |
| Ga0075363_1005737702 | 3300006048 | Populus Endosphere | VTRPAIRNTMWVSIGQTGFVHAPIVQVTIGQQAKPNVELIAIAATYEPAAINV* |
| Ga0097621_1005699013 | 3300006237 | Miscanthus Rhizosphere | WDAGTPPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV* |
| Ga0097621_1020648392 | 3300006237 | Miscanthus Rhizosphere | PPGPPTQRTTLWQSIGMSGFAHAPIVQVTVAQTSRPRVELIAITTTQERGGVNV* |
| Ga0097621_1022588192 | 3300006237 | Miscanthus Rhizosphere | GDAIWDAGTPPPLVVRNTGWVSIGITGFSHAPIVQVTVAQNAKPEVDLISIAATFERAGINV* |
| Ga0068871_1009571933 | 3300006358 | Miscanthus Rhizosphere | LWDKGIPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQAKPEVDLISIAATYERDAVVV* |
| Ga0068871_1020277641 | 3300006358 | Miscanthus Rhizosphere | VVRNTGWVSIGLTGFSHAPVIQVTVAQNAKPEVDLISIAATYERAGVNV* |
| Ga0068871_1021141322 | 3300006358 | Miscanthus Rhizosphere | LTGFSHAPIVQVTMAQQAKPEIELISVAGTFERLAITV* |
| Ga0074060_109429313 | 3300006604 | Soil | PTMRNTGWVSIGETGYSHAPVVQVTVAQQAKPTVELVSMTATYERLGVNV* |
| Ga0074062_130193172 | 3300006606 | Soil | SIGMTGFAHAPIVQVMVAQRAKPQVELLAIAATFDRAGVNV* |
| Ga0075434_1018257571 | 3300006871 | Populus Rhizosphere | AHAPIVQVYVGQQARPDVELVALGATYEIAGVNV* |
| Ga0068865_1005829321 | 3300006881 | Miscanthus Rhizosphere | LSLPSIRSTGWVSIGETGFSHAPIVQTTIAQQARPNVELISISAMYERVGVNV* |
| Ga0105098_103788722 | 3300009081 | Freshwater Sediment | KTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGTNV* |
| Ga0111539_103267302 | 3300009094 | Populus Rhizosphere | RASFRNTMWVSIGMTGFSHAPIVQVTVAQQAKPDVELIAIAATFEQEGVTV* |
| Ga0111539_125725112 | 3300009094 | Populus Rhizosphere | TPGRASFRNTMWVSIGMTGFSHAPIVQVTVAQQAKPDVELIAIAASFEQEGVTV* |
| Ga0105245_103870191 | 3300009098 | Miscanthus Rhizosphere | PAPVVRDTGWVSVGLTGYSHAPIVQVTVAQQAKPEVDLISVAATYERAGINV* |
| Ga0105245_107566441 | 3300009098 | Miscanthus Rhizosphere | KPVVRNTGWVSIGMTGFSHAPIVQVTVAQQAKPEVDLISIAATYERDAVVV* |
| Ga0105245_107971051 | 3300009098 | Miscanthus Rhizosphere | MSGFAHAPIVQVTVAQVARPRVELIAIATTQERGGVNV* |
| Ga0105245_108139142 | 3300009098 | Miscanthus Rhizosphere | GFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV* |
| Ga0105245_114470892 | 3300009098 | Miscanthus Rhizosphere | HWDYPTPPRASFRNTMWVSIGLMGFSHAPIVQVTVAQQAKPDVELIAIAATFEQAGVTV* |
| Ga0105245_118570182 | 3300009098 | Miscanthus Rhizosphere | AGTPPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQNAKPEVDLISIAATFERAGVNV* |
| Ga0105245_124383682 | 3300009098 | Miscanthus Rhizosphere | VSVGMTGYSHAPVVQVMVAQTAKPSVELVSITAVYERCGVNV* |
| Ga0105243_123746821 | 3300009148 | Miscanthus Rhizosphere | TTVRNTMWVSIGYTGFSHAPICQVTIAQAALPDVELISIAATYDAAGVNV* |
| Ga0111538_111726871 | 3300009156 | Populus Rhizosphere | TPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV* |
| Ga0111538_126700051 | 3300009156 | Populus Rhizosphere | GFSHAPIVQVTVAQQAKPEVDLISIAATFERAGINV* |
| Ga0111538_134035511 | 3300009156 | Populus Rhizosphere | IGMTGFSHAPIVQVTVAQQAKPDVELIAIAATFEQEGVTV* |
| Ga0105242_102041485 | 3300009176 | Miscanthus Rhizosphere | WVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV* |
| Ga0105242_111669773 | 3300009176 | Miscanthus Rhizosphere | SIGMSGFAHAPIIQVTIAQTLRPEVELVAVTATFEVAGVNV* |
| Ga0105242_122723141 | 3300009176 | Miscanthus Rhizosphere | SIGLTGFSHAPIVQVTVAQQAKPEVDLISIAATYERAGVNV* |
| Ga0105242_131742642 | 3300009176 | Miscanthus Rhizosphere | FSHAPICQVTIAQAALPDVELISIAATYAAAGVNV* |
| Ga0105248_116223382 | 3300009177 | Switchgrass Rhizosphere | SHAPICQVTVAQQAPPEVELISIAATFEPAGVNV* |
| Ga0105248_124751372 | 3300009177 | Switchgrass Rhizosphere | DAGTPPPLVVRNTGWVSIGITGFSHAPIVQVTVAQNAKPEVDLISIAATFERAGINV* |
| Ga0105248_133174872 | 3300009177 | Switchgrass Rhizosphere | MWVSIGETGFSHAPIVQVTIGQQFKPSVELISISATYIRMAANV* |
| Ga0105238_100025861 | 3300009551 | Corn Rhizosphere | NTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV* |
| Ga0105238_123131732 | 3300009551 | Corn Rhizosphere | MWVSIGYTGFSHAPICQVTIAQASPPDVELISIAATYDAAGVNV* |
| Ga0105340_12581802 | 3300009610 | Soil | ANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGTNV* |
| Ga0105252_105713002 | 3300009678 | Soil | DALWDEGVPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV* |
| Ga0126377_107286162 | 3300010362 | Tropical Forest Soil | MWVSIGMTGFSHAPVVQATIAQQAKPNVELIAISAVFERCGINV* |
| Ga0105246_118290861 | 3300011119 | Miscanthus Rhizosphere | WVSIGYTGFSHAPICQVTVAQQARPEVELISIAATFEPAGVNV* |
| Ga0105246_125109521 | 3300011119 | Miscanthus Rhizosphere | QSIGMSGFAHAPIVQVTVAQVARPTVELIAIATTQERGGVNV* |
| Ga0137312_10134523 | 3300011400 | Soil | DQPTAVAAPAVRSTGWVSIGKSGFVHAPIVQVTVAQQVKPSVELIAIAATFEPGGINV* |
| Ga0137312_10142922 | 3300011400 | Soil | SIGTTGYSHAPIVQITVAQTAKPEVDLISIAATFERAGVNV* |
| Ga0137312_10242192 | 3300011400 | Soil | AMSGFAHAPIVQVTVAQQARPRVELIAISTTQESGGVNV* |
| Ga0137325_10278072 | 3300011415 | Soil | LRNTMWVSIGKTGFSHAPIVQVTIAQQAKPTVELVSIAATFERAGVTV* |
| Ga0137425_10984642 | 3300011422 | Soil | DDAMWDKGIPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV* |
| Ga0137423_11917583 | 3300011430 | Soil | LWDANPPPKPTVRNTGWVSIGQTGFSHAPIVQITMAQQAKPQVELISIGVTYERAGANV* |
| Ga0137432_11875412 | 3300011439 | Soil | TYAQWDTGVTPLPVVRNTGWVSIGLTGYTHAPIVQVTVAQQARPEVDLISIACTYERDGINV* |
| Ga0137437_11747471 | 3300011442 | Soil | RNTLWVSIGKTGFSHAPIVQVTVAQAARPDVELVAIGATFEVAGVNV* |
| Ga0137344_10440602 | 3300012159 | Soil | WVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGTNV* |
| Ga0157305_100343751 | 3300012891 | Soil | NTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV* |
| Ga0157303_100697222 | 3300012896 | Soil | RNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV* |
| Ga0157293_101252181 | 3300012898 | Soil | RPQNRNTLWVSVGMSGFAHAPIIQVTIAQTLRPEVELVAVTATFEVAGVNV* |
| Ga0157299_102893382 | 3300012899 | Soil | LWDQPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV* |
| Ga0157288_101243192 | 3300012901 | Soil | IGPDPGPLDLWGQGLWDTALWDADPPPAPVVRNTGWVSVGVTGFTHAPILQIMVSQQAKPEVDFISVSATYGRAGINV* |
| Ga0157289_100210722 | 3300012903 | Soil | FAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV* |
| Ga0157289_100771411 | 3300012903 | Soil | QPARNRPANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAAIFEVAGTNV* |
| Ga0157296_102545792 | 3300012905 | Soil | PQNRNTLWVSIGMSGFAHAPIIQVTIAQTLRPEVELVAVTATFEVAGVNV* |
| Ga0157286_104056922 | 3300012908 | Soil | WDQGKWGQAMWDAETPAKPTARNTGWVSIGMTGFSHAPVVQATVAQQTRPEVEMISIAGTFERLGITI* |
| Ga0157290_103918942 | 3300012909 | Soil | SIWDAGTPPPPVVRNTGWVSIGMTGYSHAPIVQVTVAQQAKPEVEIISIAATYERVGVNV |
| Ga0157298_103686992 | 3300012913 | Soil | PPQVVRNTGWVSIGQTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV* |
| Ga0157298_103797541 | 3300012913 | Soil | PSPARPANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVCLQATFEQAGINV* |
| Ga0157378_114256701 | 3300013297 | Miscanthus Rhizosphere | GYSHAPLVQVTIAQTAKPDIELISIAATFERLGVNV* |
| Ga0163162_106852662 | 3300013306 | Switchgrass Rhizosphere | NTGWVSIGRTGFSHASIVQVTVAQQAKPEVDLISIAATFERAGVNV* |
| Ga0157375_103201904 | 3300013308 | Miscanthus Rhizosphere | SIGMTGFSHAPIVQVTVAQLTKPEVDLINIAATFERDAIVV* |
| Ga0157375_112514592 | 3300013308 | Miscanthus Rhizosphere | FSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV* |
| Ga0163163_107579091 | 3300014325 | Switchgrass Rhizosphere | SVVRNTGWVSIGMTGFSHAPIVQVTVAQQLKPEVDLISIAATYERDAVVV* |
| Ga0163163_123420441 | 3300014325 | Switchgrass Rhizosphere | DAGVPPKPVVRNTGWVSIGMTGYSHAPIVQVTVAQNARPVVDLISIAAIFERAGINV* |
| Ga0163163_127625731 | 3300014325 | Switchgrass Rhizosphere | FAHAPIVQVYVGQQARPDVELVALGATYELAGVNV* |
| Ga0157380_119166631 | 3300014326 | Switchgrass Rhizosphere | NTGWVSIGMTGFSHAPIVQVQVAQQAKPIVDLINIAATFERAGVNV* |
| Ga0157380_124248861 | 3300014326 | Switchgrass Rhizosphere | PLVVRNTGWVSIGLTGFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV* |
| Ga0157380_133431141 | 3300014326 | Switchgrass Rhizosphere | LWDDALWDEGVPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV* |
| Ga0157379_106333721 | 3300014968 | Switchgrass Rhizosphere | TGFSHAPICQVTIAQQSAPDIELISIAATYDGAGVNV* |
| Ga0157376_100382931 | 3300014969 | Miscanthus Rhizosphere | NTGWVSIGMTGFSHAPIVQVTVAQQTKPEVDLINIAATFERDAIVV* |
| Ga0157376_116495862 | 3300014969 | Miscanthus Rhizosphere | LTGFSHAPVVQVTVAQQAKPEVDLISIAATFERAGVNV* |
| Ga0173480_105190701 | 3300015200 | Soil | NTMWVSIGKSGFCHAPIVQITVAQQVKPDVELVAITATFEQGGVNV* |
| Ga0173478_100242762 | 3300015201 | Soil | MWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGTNV* |
| Ga0132258_121948831 | 3300015371 | Arabidopsis Rhizosphere | GWVSIGVTGHSHAPIVQLTIAQNSRPVFDLIAIGATFKRMGINV* |
| Ga0132255_1019152682 | 3300015374 | Arabidopsis Rhizosphere | DAGTPSAPVVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGINV* |
| Ga0182036_110904382 | 3300016270 | Soil | GFSHAPVVQVTVSQKVKPNVELICISALFERAGINV |
| Ga0163161_102201691 | 3300017792 | Switchgrass Rhizosphere | AAYAQWDQPGLGRPPHRNTLWVSIGMTSFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV |
| Ga0163161_110130541 | 3300017792 | Switchgrass Rhizosphere | MTGYSHAPVVQVTVAQQAKPDVELISIAATFERLGVNV |
| Ga0163161_117390012 | 3300017792 | Switchgrass Rhizosphere | AYAQWDTGVPPKPVVRNTGWVSIGQTGYSHAPVVQVTVAQAAKPEVDLISIAATFERAGVNV |
| Ga0184611_13175961 | 3300018067 | Groundwater Sediment | FTHAPIVQVTVGQQVKPTVEMIAIAATYERAGFTV |
| Ga0184611_13477761 | 3300018067 | Groundwater Sediment | NTGWVSIGSTGYSHALTVQVTVAQQAKPDVELIAIDALFWPVGTDV |
| Ga0184611_13539081 | 3300018067 | Groundwater Sediment | ASLGALTQRNTLWQSIGMSGFAHAPIVQVTVAQSSRPRVELIAITTTQERGGVNV |
| Ga0184635_103320871 | 3300018072 | Groundwater Sediment | SIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGVNV |
| Ga0184624_103510362 | 3300018073 | Groundwater Sediment | GRAPIRNTLWVSIGKTGFSHAPIVQVTIGQQSKPDVELIAVGATFEVAGVNV |
| Ga0184624_105230401 | 3300018073 | Groundwater Sediment | PATGRPPVRNTMWQSIGMSGFAHAPIVQVQIGQVARPTVELIAIGTTQERGGVNV |
| Ga0184625_101028663 | 3300018081 | Groundwater Sediment | KTGFSHAPILQVSVAQKIKPAVELVAIHAIFEQGGVNV |
| Ga0184625_102841322 | 3300018081 | Groundwater Sediment | WVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV |
| Ga0184628_101692061 | 3300018083 | Groundwater Sediment | QWDAGVARNAVIRNTGWVSIGVTGYTHAPIVQVMVAQHARPVVEIISVDATFERLGVNV |
| Ga0184628_102791641 | 3300018083 | Groundwater Sediment | WDDALWDEGVPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV |
| Ga0190274_114740112 | 3300018476 | Soil | RNTGWVSIGLTGYTHAPIVQVTVAQKSRPDVELIAIDATFERMGVNV |
| Ga0190274_115328702 | 3300018476 | Soil | MWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGVNV |
| Ga0190271_118304902 | 3300018481 | Soil | WDVAVWDGAPAPAHVVRNTGWVSIGVTGYSHAPIVQVRVAQASKPQVDLISIAATFERAGMNV |
| Ga0190271_123821711 | 3300018481 | Soil | TMWVSVGMTGFSHAPIVQVTVAQQAKPDVELIAIAATFEQEGVTV |
| Ga0173482_100818942 | 3300019361 | Soil | GMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV |
| Ga0193740_10127182 | 3300020009 | Soil | PTNVVRNTGWVSIGQTGFTHAPIIQVYVAQQAKPEVDLIAIAATFERAGITV |
| Ga0193696_10716943 | 3300020016 | Soil | WVSIGMTGFSHAPIVQVTVAQQAKPEVDLISIAATYERDAVVV |
| Ga0193699_103312261 | 3300021363 | Soil | ASAPVSRAQNTGWVSIGMTGYSHAPIVQVTVSQQAKPIVDLISIAATFERDAVVV |
| Ga0210392_109733181 | 3300021475 | Soil | SIGATGFSHAPVLQVTVAQQAKPNVELISIAATFERLGVNV |
| Ga0247787_10640622 | 3300022893 | Soil | TPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV |
| Ga0247795_10012361 | 3300022899 | Soil | LWDQESALVTPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV |
| Ga0247783_12009862 | 3300022911 | Plant Litter | NVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV |
| Ga0247790_100800361 | 3300022915 | Soil | PARPANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVCLQATFEQAGINV |
| Ga0247790_101918031 | 3300022915 | Soil | FSHAPIVQVTMAQNAKPEVELISIAGTFERLAITV |
| Ga0247777_11704752 | 3300022917 | Plant Litter | DEGVPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQAKPVVDLINIAATFERAGVNV |
| Ga0247743_10025841 | 3300023067 | Soil | VRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV |
| Ga0247758_11478722 | 3300023079 | Plant Litter | PAIRSTRWVSIGTTGYTHAPVVQVTVAQTARPTVEMVAIDAVFERQGVNV |
| Ga0247661_10234431 | 3300024254 | Soil | GRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV |
| Ga0247661_10944901 | 3300024254 | Soil | ATVRNTMWVSIGFTGFSHAPICQVTIAQAALPDVELISIAATYDAAGVNV |
| Ga0247670_10972772 | 3300024283 | Soil | TPVMKNTMWVSVGETGFSHAPIVQVTVAQQATPNVELISIGATYERLGVNV |
| Ga0247687_10609942 | 3300024286 | Soil | MWVSVGETGFSHAPIVQVTVAQQATPNVELISIGATYERLGVNV |
| Ga0247681_10046812 | 3300024310 | Soil | DAPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV |
| Ga0247681_10509732 | 3300024310 | Soil | VSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV |
| Ga0207642_103499301 | 3300025899 | Miscanthus Rhizosphere | GLWDDAVWDASTPPKPVVRNTGWVSIGMTGFSHAPVVQVTVAQQAKPEVDLISIAATYERDAVVV |
| Ga0207685_101891272 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VSIGFTGFSHAPICQVTIAQQSAPDIELISIAATYDGAGVNV |
| Ga0207671_101190094 | 3300025914 | Corn Rhizosphere | GWVSIGLTGYSHAPVVQVTVAQQAKPDVELISISAVYERLGVNV |
| Ga0207650_105268922 | 3300025925 | Switchgrass Rhizosphere | ALWDQPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV |
| Ga0207659_104531182 | 3300025926 | Miscanthus Rhizosphere | TPVVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV |
| Ga0207687_111708032 | 3300025927 | Miscanthus Rhizosphere | PPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQNAKPEVDLISIAATFERGGINV |
| Ga0207687_113903152 | 3300025927 | Miscanthus Rhizosphere | SVRSTGWVSVGMTGYSHAPVVQVMVAQTAKPSVELVSITAVYERCGVNV |
| Ga0207700_112473191 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TGFSHAPVVQVTVAQAARPNVELISIAATFERLGVNV |
| Ga0207701_101606262 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RNTLWVSIGKTGFSHAPIVQVTVGQQAKPDVELVAIAAIFEVAGTNV |
| Ga0207701_105248012 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RNTGWVSIGMTGYSHAPIVQVSVGQQAKPEVDLISIAATFERDGVNV |
| Ga0207644_113276202 | 3300025931 | Switchgrass Rhizosphere | RNTGWVSIGLTGFSHAPVVQVTVAQNAKPIVDMISIAATFERAGVNV |
| Ga0207686_115755951 | 3300025934 | Miscanthus Rhizosphere | VRNTMWVSIGMTGYSHAPIVQVTVAQNARPIVDLISIAATFERAGVNV |
| Ga0207669_101625551 | 3300025937 | Miscanthus Rhizosphere | TTGWVSIGITGFSHAPIVQVTVGQNARPNVELISIDALYTRGGVNV |
| Ga0207669_110866801 | 3300025937 | Miscanthus Rhizosphere | NTMWVSIGKTGFSHAPIVQVTVGQQAKPDVELVAIAATFEVAGTNV |
| Ga0207704_108419992 | 3300025938 | Miscanthus Rhizosphere | GASASLNLSDEALSDDAIWDAGVTPIAVVRNTGWVSIGMTGYSHAPVVQVTVAQQARPQVDLISIAATFERCGITV |
| Ga0207704_118937282 | 3300025938 | Miscanthus Rhizosphere | VRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV |
| Ga0207691_101097822 | 3300025940 | Miscanthus Rhizosphere | VSIGVTGYSHAPIIQVTVAQRARPQVDLISIAATFERCGITV |
| Ga0207711_107110152 | 3300025941 | Switchgrass Rhizosphere | GLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV |
| Ga0207651_110159591 | 3300025960 | Switchgrass Rhizosphere | PHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV |
| Ga0207651_110462472 | 3300025960 | Switchgrass Rhizosphere | VVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV |
| Ga0207651_114910941 | 3300025960 | Switchgrass Rhizosphere | WVSIGLTGFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV |
| Ga0207651_119629861 | 3300025960 | Switchgrass Rhizosphere | SIGKTGFSHAPIVQVTIGQQAKPDVELIAVGATFEVAGVNV |
| Ga0207712_110282721 | 3300025961 | Switchgrass Rhizosphere | TPPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV |
| Ga0207668_101169833 | 3300025972 | Switchgrass Rhizosphere | VSVGMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV |
| Ga0207677_114204931 | 3300026023 | Miscanthus Rhizosphere | VPTVRNTMWVSIGMTGFSHAPICQVTIAQQSAPDIELISIAATYDGAGVNV |
| Ga0207702_107367361 | 3300026078 | Corn Rhizosphere | FSHAPIVQTTIAQQARPNVELISISAMYERVGVNV |
| Ga0207641_107222763 | 3300026088 | Switchgrass Rhizosphere | MTGYSHAPICQVTVAQTAKPNVELLAIAAVYDPAGVNV |
| Ga0207648_119504542 | 3300026089 | Miscanthus Rhizosphere | APPSVTVRNTGWVSIGVTGYSHAPIIQVTVAQRARPQVDLISIAATFERCGITV |
| Ga0207648_121679691 | 3300026089 | Miscanthus Rhizosphere | IWDAGTPPPLVVRNTGWVSIGLTGFSHAPVIQVTVAQNAKPEVDLISIAATFERAGVNV |
| Ga0207676_111915062 | 3300026095 | Switchgrass Rhizosphere | MWVSIGKTGFSHAPIVQVTVAQQAKPDVELVCLQATFEQAGINV |
| Ga0207675_1009821503 | 3300026118 | Switchgrass Rhizosphere | VKSTGWVSVGMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV |
| Ga0207675_1011512451 | 3300026118 | Switchgrass Rhizosphere | VTGYTHAPIVQITVGQIAKPSVELVAIDVTYQRAGVNV |
| Ga0207675_1017845071 | 3300026118 | Switchgrass Rhizosphere | SGFAHAPVVQVTIAQIARPAVELVALHTTQERGGVNV |
| Ga0207683_101993213 | 3300026121 | Miscanthus Rhizosphere | PSTPAVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV |
| Ga0207683_102060823 | 3300026121 | Miscanthus Rhizosphere | VPPAKTVTNTGWVSIGMTGFSHAPIVQVTVAQAVRPEVDLINIAATYERDAIVV |
| Ga0207683_103339251 | 3300026121 | Miscanthus Rhizosphere | VGLTGYSHAPIVQVTVAQQAKPEVDLISVAATYERAGINV |
| Ga0207461_10137162 | 3300026929 | Soil | NTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV |
| Ga0208890_10511232 | 3300027523 | Soil | ETGYSHAPVVQVTVAQQAKPTVELVSMTATYERLGVNV |
| Ga0208185_10757231 | 3300027533 | Soil | TGWVSIGTTGYSHAPIVQITVAQTAKPEVDLISIAATFERAGVNV |
| Ga0209811_100249741 | 3300027821 | Surface Soil | LWVSIGKTGFAHAPIIQVTVAQQRTPDVELIALTATYEPAGVNV |
| Ga0209465_102538972 | 3300027874 | Tropical Forest Soil | WVSIGMTGFAHAPIVQVTVAQQAKPNVELIALAATFERAGVNV |
| Ga0207428_107132721 | 3300027907 | Populus Rhizosphere | PGQAPAKNTMWVSVGETGFSHAPICQVTVGQQAKPDVELISISATFVRMGANV |
| Ga0247689_10104701 | 3300028281 | Soil | GRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV |
| Ga0247662_10028241 | 3300028293 | Soil | LWDQPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV |
| Ga0268265_108546952 | 3300028380 | Switchgrass Rhizosphere | DQPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV |
| Ga0307321_11217532 | 3300028704 | Soil | YSHAPIVQVTVSQQAKPIVDLISIAATFERDAVVV |
| Ga0307283_102460791 | 3300028790 | Soil | EAYAQWDTGVTPLPVIRNTGWVSIGLTGFSHAPIVQITVAQKLKPEVDLINIAATFERDGVNV |
| Ga0307281_102026601 | 3300028803 | Soil | VSIGMTGYSHAPIVQVSVGQQAKPEVDLISIAATFERDGVNV |
| Ga0247825_112506252 | 3300028812 | Soil | QPAPTTVPIRNTRWVSIGRTGYTHAPVVQVYVGQQARPEVELIAIDVTFNRMGVTV |
| Ga0247827_112769841 | 3300028889 | Soil | VSIGKSGFAHAPIVQVQVAQQAKPNVELIALHTTQETGGVNV |
| Ga0307497_101282821 | 3300031226 | Soil | WDAGEPLSPIVGNTGWVSIGLTGFSHAPIIQVTMAQQAKPEVELISIAGVFERLAITV |
| Ga0307497_101686543 | 3300031226 | Soil | KNTGWVSIGEVGFSHAPICQVTVAQQGNPNVELVSIAATFERLGVNV |
| Ga0307505_102875011 | 3300031455 | Soil | GYSHAPVVQVTMHQRAKPDVELISISATYERCGVNV |
| Ga0310887_105410571 | 3300031547 | Soil | SIGETGFSHAPIVQVTIAQQAKPNVELISIAAMYEKLGANV |
| Ga0307468_1006523482 | 3300031740 | Hardwood Forest Soil | NVNRNTMWVSVGMSGFSHAPIVQITVAQQATPDVELVAIAATYERAGINV |
| Ga0318548_103328602 | 3300031793 | Soil | GFTHAPVVQATISQQAKPNIELISISAAFERAGINV |
| Ga0318565_101665952 | 3300031799 | Soil | VRNTMWVSIGRTGFSLAPVVQVTVAQRAPPEVELITVNAVFDRAGIDV |
| Ga0318505_101840612 | 3300032060 | Soil | VRNTMWVSIGVTGFTHAPVVQATVSQQAKPNIELISISAAFERAGINV |
| Ga0318524_107633361 | 3300032067 | Soil | TMWVSIGVTGFTHAPVVQATISQQAKPNIELISISAAFERAGINV |
| Ga0307472_1025410832 | 3300032205 | Hardwood Forest Soil | TAIWDAGVAPPKVVRNTGWVSIGVTGFSHAPVVQVTVAQQARPEVDLISIAATFERMGIN |
| Ga0364929_0089959_790_960 | 3300034149 | Sediment | AAAAPKPVVRNTGWVSIGMTGFSHAPIVQVTVAQQAKPEVDLISIAATYERDAVVV |
| ⦗Top⦘ |