| Basic Information | |
|---|---|
| Family ID | F022866 |
| Family Type | Metagenome |
| Number of Sequences | 212 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKRHIDNLLPALVLVRIGQELGTDSPAARAVHDLLELLASVAGVFTR |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.26 % |
| % of genes near scaffold ends (potentially truncated) | 14.15 % |
| % of genes from short scaffolds (< 2000 bps) | 61.32 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.925 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (21.226 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.019 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.943 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.00% β-sheet: 0.00% Coil/Unstructured: 48.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 8.02 |
| PF03837 | RecT | 5.66 |
| PF09250 | Prim-Pol | 4.25 |
| PF01555 | N6_N4_Mtase | 2.83 |
| PF13455 | MUG113 | 2.83 |
| PF02899 | Phage_int_SAM_1 | 2.36 |
| PF12728 | HTH_17 | 1.89 |
| PF10520 | Lipid_desat | 1.89 |
| PF04448 | DUF551 | 1.42 |
| PF01726 | LexA_DNA_bind | 0.94 |
| PF13479 | AAA_24 | 0.94 |
| PF02767 | DNA_pol3_beta_2 | 0.94 |
| PF13589 | HATPase_c_3 | 0.94 |
| PF01844 | HNH | 0.47 |
| PF05065 | Phage_capsid | 0.47 |
| PF05063 | MT-A70 | 0.47 |
| PF10431 | ClpB_D2-small | 0.47 |
| PF12850 | Metallophos_2 | 0.47 |
| PF12840 | HTH_20 | 0.47 |
| PF11367 | DUF3168 | 0.47 |
| PF03796 | DnaB_C | 0.47 |
| PF07659 | DUF1599 | 0.47 |
| PF03354 | TerL_ATPase | 0.47 |
| PF05135 | Phage_connect_1 | 0.47 |
| PF02086 | MethyltransfD12 | 0.47 |
| PF00712 | DNA_pol3_beta | 0.47 |
| PF00271 | Helicase_C | 0.47 |
| PF00145 | DNA_methylase | 0.47 |
| PF10145 | PhageMin_Tail | 0.47 |
| PF02768 | DNA_pol3_beta_3 | 0.47 |
| PF12802 | MarR_2 | 0.47 |
| PF00149 | Metallophos | 0.47 |
| PF10544 | T5orf172 | 0.47 |
| PF05119 | Terminase_4 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 5.66 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 2.83 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.83 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 2.83 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 2.36 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 2.36 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 1.89 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.47 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.47 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.47 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.47 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.47 |
| COG3747 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.47 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.47 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.92 % |
| All Organisms | root | All Organisms | 32.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10016317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2762 | Open in IMG/M |
| 3300002161|JGI24766J26685_10000683 | All Organisms → cellular organisms → Bacteria | 9793 | Open in IMG/M |
| 3300002161|JGI24766J26685_10009147 | Not Available | 2684 | Open in IMG/M |
| 3300002471|metazooDRAFT_1432177 | Not Available | 558 | Open in IMG/M |
| 3300002835|B570J40625_100012499 | Not Available | 15212 | Open in IMG/M |
| 3300002835|B570J40625_100103737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3493 | Open in IMG/M |
| 3300002835|B570J40625_101316743 | Not Available | 599 | Open in IMG/M |
| 3300004772|Ga0007791_10055178 | Not Available | 1277 | Open in IMG/M |
| 3300004773|Ga0007795_10018315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2411 | Open in IMG/M |
| 3300005525|Ga0068877_10071431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2231 | Open in IMG/M |
| 3300005525|Ga0068877_10125993 | Not Available | 1584 | Open in IMG/M |
| 3300005525|Ga0068877_10544546 | Not Available | 637 | Open in IMG/M |
| 3300005527|Ga0068876_10007013 | All Organisms → cellular organisms → Bacteria | 7618 | Open in IMG/M |
| 3300005527|Ga0068876_10061763 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
| 3300005527|Ga0068876_10071222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2095 | Open in IMG/M |
| 3300005527|Ga0068876_10089632 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300005527|Ga0068876_10193302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300005528|Ga0068872_10658123 | Not Available | 552 | Open in IMG/M |
| 3300005581|Ga0049081_10005975 | All Organisms → cellular organisms → Bacteria | 4598 | Open in IMG/M |
| 3300005581|Ga0049081_10008685 | Not Available | 3856 | Open in IMG/M |
| 3300005581|Ga0049081_10028851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2107 | Open in IMG/M |
| 3300005581|Ga0049081_10086824 | Not Available | 1171 | Open in IMG/M |
| 3300005581|Ga0049081_10117279 | Not Available | 986 | Open in IMG/M |
| 3300005581|Ga0049081_10161191 | Not Available | 817 | Open in IMG/M |
| 3300005581|Ga0049081_10318587 | Not Available | 533 | Open in IMG/M |
| 3300005582|Ga0049080_10082137 | Not Available | 1102 | Open in IMG/M |
| 3300005805|Ga0079957_1016848 | All Organisms → cellular organisms → Bacteria | 5237 | Open in IMG/M |
| 3300005805|Ga0079957_1024678 | All Organisms → cellular organisms → Bacteria | 4101 | Open in IMG/M |
| 3300005805|Ga0079957_1027585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3816 | Open in IMG/M |
| 3300005805|Ga0079957_1090140 | Not Available | 1703 | Open in IMG/M |
| 3300005805|Ga0079957_1132874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas viscosa | 1294 | Open in IMG/M |
| 3300005805|Ga0079957_1154737 | Not Available | 1161 | Open in IMG/M |
| 3300005805|Ga0079957_1285554 | Not Available | 749 | Open in IMG/M |
| 3300005805|Ga0079957_1336095 | Not Available | 667 | Open in IMG/M |
| 3300006030|Ga0075470_10000354 | Not Available | 15303 | Open in IMG/M |
| 3300006030|Ga0075470_10003082 | Not Available | 5182 | Open in IMG/M |
| 3300006030|Ga0075470_10003219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5074 | Open in IMG/M |
| 3300006030|Ga0075470_10025478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1831 | Open in IMG/M |
| 3300006030|Ga0075470_10039154 | Not Available | 1461 | Open in IMG/M |
| 3300006030|Ga0075470_10041810 | Not Available | 1411 | Open in IMG/M |
| 3300006030|Ga0075470_10045514 | Not Available | 1348 | Open in IMG/M |
| 3300006030|Ga0075470_10068438 | Not Available | 1079 | Open in IMG/M |
| 3300006030|Ga0075470_10126440 | Not Available | 755 | Open in IMG/M |
| 3300006030|Ga0075470_10130334 | Not Available | 741 | Open in IMG/M |
| 3300006030|Ga0075470_10177358 | Not Available | 616 | Open in IMG/M |
| 3300006641|Ga0075471_10000269 | Not Available | 29648 | Open in IMG/M |
| 3300006641|Ga0075471_10386466 | Not Available | 703 | Open in IMG/M |
| 3300006805|Ga0075464_10094645 | Not Available | 1709 | Open in IMG/M |
| 3300006805|Ga0075464_10156106 | Not Available | 1342 | Open in IMG/M |
| 3300006805|Ga0075464_10566022 | Not Available | 698 | Open in IMG/M |
| 3300006917|Ga0075472_10646144 | Not Available | 531 | Open in IMG/M |
| 3300006917|Ga0075472_10669762 | Not Available | 521 | Open in IMG/M |
| 3300007094|Ga0102532_1033806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6172 | Open in IMG/M |
| 3300007363|Ga0075458_10205369 | Not Available | 604 | Open in IMG/M |
| 3300007735|Ga0104988_10894 | Not Available | 36688 | Open in IMG/M |
| 3300008055|Ga0108970_10278781 | Not Available | 1311 | Open in IMG/M |
| 3300008107|Ga0114340_1002984 | Not Available | 21410 | Open in IMG/M |
| 3300008108|Ga0114341_10014492 | Not Available | 20397 | Open in IMG/M |
| 3300008116|Ga0114350_1000636 | Not Available | 32682 | Open in IMG/M |
| 3300008116|Ga0114350_1018344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2945 | Open in IMG/M |
| 3300008120|Ga0114355_1005247 | All Organisms → cellular organisms → Bacteria | 7722 | Open in IMG/M |
| 3300008120|Ga0114355_1220657 | Not Available | 586 | Open in IMG/M |
| 3300008266|Ga0114363_1011970 | Not Available | 7920 | Open in IMG/M |
| 3300008266|Ga0114363_1028109 | Not Available | 2401 | Open in IMG/M |
| 3300008266|Ga0114363_1060426 | Not Available | 1474 | Open in IMG/M |
| 3300008266|Ga0114363_1066421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1384 | Open in IMG/M |
| 3300008266|Ga0114363_1072843 | Not Available | 2313 | Open in IMG/M |
| 3300008266|Ga0114363_1078107 | Not Available | 1241 | Open in IMG/M |
| 3300008266|Ga0114363_1109388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300008266|Ga0114363_1189186 | Not Available | 644 | Open in IMG/M |
| 3300008448|Ga0114876_1181681 | Not Available | 731 | Open in IMG/M |
| 3300008450|Ga0114880_1158249 | Not Available | 807 | Open in IMG/M |
| 3300009180|Ga0114979_10294983 | Not Available | 964 | Open in IMG/M |
| 3300009184|Ga0114976_10273396 | Not Available | 910 | Open in IMG/M |
| 3300010354|Ga0129333_10000497 | Not Available | 32350 | Open in IMG/M |
| 3300010354|Ga0129333_10364458 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300010354|Ga0129333_10674181 | Not Available | 891 | Open in IMG/M |
| 3300010370|Ga0129336_10356262 | Not Available | 804 | Open in IMG/M |
| 3300010370|Ga0129336_10563524 | Not Available | 610 | Open in IMG/M |
| 3300010885|Ga0133913_13037430 | Not Available | 1117 | Open in IMG/M |
| 3300012012|Ga0153799_1011640 | Not Available | 1921 | Open in IMG/M |
| 3300012013|Ga0153805_1057606 | Not Available | 658 | Open in IMG/M |
| 3300012017|Ga0153801_1048187 | Not Available | 751 | Open in IMG/M |
| 3300013014|Ga0164295_10031099 | Not Available | 4071 | Open in IMG/M |
| 3300013087|Ga0163212_1039795 | Not Available | 1613 | Open in IMG/M |
| 3300013372|Ga0177922_10243967 | Not Available | 1156 | Open in IMG/M |
| 3300013372|Ga0177922_10760435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15963 | Open in IMG/M |
| 3300013372|Ga0177922_10776554 | Not Available | 1337 | Open in IMG/M |
| 3300017736|Ga0181365_1094199 | Not Available | 728 | Open in IMG/M |
| 3300017736|Ga0181365_1132259 | Not Available | 596 | Open in IMG/M |
| 3300017774|Ga0181358_1138657 | Not Available | 840 | Open in IMG/M |
| 3300017777|Ga0181357_1034365 | All Organisms → Viruses → Predicted Viral | 1997 | Open in IMG/M |
| 3300018416|Ga0181553_10652216 | Not Available | 553 | Open in IMG/M |
| 3300020167|Ga0194035_1001856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10755 | Open in IMG/M |
| 3300020498|Ga0208050_1000202 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae | 11117 | Open in IMG/M |
| 3300020498|Ga0208050_1014349 | Not Available | 858 | Open in IMG/M |
| 3300020506|Ga0208091_1003469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2250 | Open in IMG/M |
| 3300020506|Ga0208091_1006145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1598 | Open in IMG/M |
| 3300020506|Ga0208091_1022424 | Not Available | 729 | Open in IMG/M |
| 3300020516|Ga0207935_1002950 | All Organisms → cellular organisms → Bacteria | 3364 | Open in IMG/M |
| 3300020518|Ga0208721_1000338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10558 | Open in IMG/M |
| 3300020518|Ga0208721_1006685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1650 | Open in IMG/M |
| 3300020521|Ga0208482_1015869 | Not Available | 1062 | Open in IMG/M |
| 3300020527|Ga0208232_1053909 | Not Available | 503 | Open in IMG/M |
| 3300020536|Ga0207939_1021812 | Not Available | 889 | Open in IMG/M |
| 3300020547|Ga0208361_1002279 | All Organisms → cellular organisms → Bacteria | 3559 | Open in IMG/M |
| 3300020551|Ga0208360_1000714 | Not Available | 7310 | Open in IMG/M |
| 3300020553|Ga0208855_1002640 | All Organisms → cellular organisms → Bacteria | 3791 | Open in IMG/M |
| 3300020553|Ga0208855_1003752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3039 | Open in IMG/M |
| 3300020571|Ga0208723_1021676 | Not Available | 991 | Open in IMG/M |
| 3300021079|Ga0194055_10021335 | Not Available | 3880 | Open in IMG/M |
| 3300021438|Ga0213920_1000388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37192 | Open in IMG/M |
| 3300021470|Ga0194051_1022505 | Not Available | 2490 | Open in IMG/M |
| 3300022746|Ga0228701_1001759 | Not Available | 14110 | Open in IMG/M |
| 3300022752|Ga0214917_10014637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6880 | Open in IMG/M |
| 3300023174|Ga0214921_10065421 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
| 3300023179|Ga0214923_10053132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3067 | Open in IMG/M |
| 3300023179|Ga0214923_10081613 | Not Available | 2273 | Open in IMG/M |
| 3300025578|Ga0208864_1040945 | Not Available | 1256 | Open in IMG/M |
| 3300025585|Ga0208546_1001206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8149 | Open in IMG/M |
| 3300025585|Ga0208546_1002239 | Not Available | 5790 | Open in IMG/M |
| 3300025585|Ga0208546_1005733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3436 | Open in IMG/M |
| 3300025585|Ga0208546_1009676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2559 | Open in IMG/M |
| 3300025585|Ga0208546_1015939 | Not Available | 1928 | Open in IMG/M |
| 3300025585|Ga0208546_1053847 | Not Available | 951 | Open in IMG/M |
| 3300025635|Ga0208147_1169584 | Not Available | 500 | Open in IMG/M |
| 3300025732|Ga0208784_1248055 | Not Available | 512 | Open in IMG/M |
| 3300025848|Ga0208005_1002476 | Not Available | 5879 | Open in IMG/M |
| 3300025848|Ga0208005_1063594 | Not Available | 1146 | Open in IMG/M |
| 3300025848|Ga0208005_1244380 | Not Available | 554 | Open in IMG/M |
| 3300027659|Ga0208975_1001290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10755 | Open in IMG/M |
| 3300027659|Ga0208975_1004266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5376 | Open in IMG/M |
| 3300027659|Ga0208975_1053222 | Not Available | 1239 | Open in IMG/M |
| 3300027659|Ga0208975_1055437 | Not Available | 1209 | Open in IMG/M |
| 3300027659|Ga0208975_1066660 | Not Available | 1081 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1011816 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 7826 | Open in IMG/M |
| 3300027763|Ga0209088_10089151 | Not Available | 1430 | Open in IMG/M |
| 3300027793|Ga0209972_10011080 | Not Available | 6014 | Open in IMG/M |
| 3300027793|Ga0209972_10233843 | Not Available | 836 | Open in IMG/M |
| 3300027805|Ga0209229_10090718 | Not Available | 1375 | Open in IMG/M |
| 3300027805|Ga0209229_10131206 | Not Available | 1130 | Open in IMG/M |
| 3300027806|Ga0209985_10091217 | Not Available | 1585 | Open in IMG/M |
| 3300027806|Ga0209985_10305608 | Not Available | 717 | Open in IMG/M |
| 3300027816|Ga0209990_10090031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1500 | Open in IMG/M |
| 3300027816|Ga0209990_10176379 | Not Available | 1001 | Open in IMG/M |
| 3300029930|Ga0119944_1000067 | Not Available | 15722 | Open in IMG/M |
| 3300029930|Ga0119944_1014350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium 37-65-8 | 1140 | Open in IMG/M |
| 3300031758|Ga0315907_10044196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3946 | Open in IMG/M |
| 3300031758|Ga0315907_10082052 | Not Available | 2779 | Open in IMG/M |
| 3300031758|Ga0315907_10157407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1921 | Open in IMG/M |
| 3300031758|Ga0315907_10169139 | Not Available | 1844 | Open in IMG/M |
| 3300031758|Ga0315907_10268643 | Not Available | 1409 | Open in IMG/M |
| 3300031758|Ga0315907_10455812 | Not Available | 1020 | Open in IMG/M |
| 3300031758|Ga0315907_10510542 | Not Available | 949 | Open in IMG/M |
| 3300031758|Ga0315907_10796677 | Not Available | 706 | Open in IMG/M |
| 3300031758|Ga0315907_11169244 | Not Available | 541 | Open in IMG/M |
| 3300031784|Ga0315899_10474747 | Not Available | 1203 | Open in IMG/M |
| 3300031787|Ga0315900_10489978 | Not Available | 936 | Open in IMG/M |
| 3300031787|Ga0315900_10757357 | Not Available | 677 | Open in IMG/M |
| 3300031857|Ga0315909_10078346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2927 | Open in IMG/M |
| 3300031857|Ga0315909_10097588 | Not Available | 2543 | Open in IMG/M |
| 3300031857|Ga0315909_10116929 | Not Available | 2262 | Open in IMG/M |
| 3300031857|Ga0315909_10169828 | Not Available | 1768 | Open in IMG/M |
| 3300031857|Ga0315909_10198537 | Not Available | 1592 | Open in IMG/M |
| 3300031857|Ga0315909_10240525 | Not Available | 1398 | Open in IMG/M |
| 3300031857|Ga0315909_10489782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300031951|Ga0315904_10032225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6088 | Open in IMG/M |
| 3300031951|Ga0315904_10063292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4054 | Open in IMG/M |
| 3300031951|Ga0315904_11290520 | Not Available | 553 | Open in IMG/M |
| 3300031963|Ga0315901_10765438 | Not Available | 705 | Open in IMG/M |
| 3300032093|Ga0315902_10943642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 657 | Open in IMG/M |
| 3300032116|Ga0315903_10509611 | Not Available | 948 | Open in IMG/M |
| 3300033816|Ga0334980_0069376 | Not Available | 1480 | Open in IMG/M |
| 3300033816|Ga0334980_0356068 | Not Available | 560 | Open in IMG/M |
| 3300033981|Ga0334982_0018344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4095 | Open in IMG/M |
| 3300033981|Ga0334982_0027048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3295 | Open in IMG/M |
| 3300033981|Ga0334982_0029586 | Not Available | 3132 | Open in IMG/M |
| 3300033981|Ga0334982_0045980 | Not Available | 2430 | Open in IMG/M |
| 3300033981|Ga0334982_0101286 | Not Available | 1518 | Open in IMG/M |
| 3300033981|Ga0334982_0319471 | Not Available | 725 | Open in IMG/M |
| 3300033981|Ga0334982_0432756 | Not Available | 592 | Open in IMG/M |
| 3300033993|Ga0334994_0108711 | Not Available | 1616 | Open in IMG/M |
| 3300033993|Ga0334994_0336173 | Not Available | 753 | Open in IMG/M |
| 3300033997|Ga0310131_087689 | Not Available | 566 | Open in IMG/M |
| 3300034012|Ga0334986_0021361 | Not Available | 4405 | Open in IMG/M |
| 3300034012|Ga0334986_0330245 | Not Available | 798 | Open in IMG/M |
| 3300034023|Ga0335021_0095659 | Not Available | 1732 | Open in IMG/M |
| 3300034062|Ga0334995_0201119 | Not Available | 1384 | Open in IMG/M |
| 3300034062|Ga0334995_0237494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1237 | Open in IMG/M |
| 3300034062|Ga0334995_0307950 | Not Available | 1034 | Open in IMG/M |
| 3300034063|Ga0335000_0010424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7201 | Open in IMG/M |
| 3300034063|Ga0335000_0101769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1965 | Open in IMG/M |
| 3300034068|Ga0334990_0200911 | Not Available | 1089 | Open in IMG/M |
| 3300034072|Ga0310127_022468 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
| 3300034092|Ga0335010_0037840 | Not Available | 3589 | Open in IMG/M |
| 3300034092|Ga0335010_0133941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1594 | Open in IMG/M |
| 3300034101|Ga0335027_0006181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10499 | Open in IMG/M |
| 3300034101|Ga0335027_0014531 | Not Available | 6785 | Open in IMG/M |
| 3300034101|Ga0335027_0015287 | All Organisms → cellular organisms → Bacteria | 6598 | Open in IMG/M |
| 3300034101|Ga0335027_0037501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4005 | Open in IMG/M |
| 3300034101|Ga0335027_0048547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD3-C76 | 3448 | Open in IMG/M |
| 3300034101|Ga0335027_0067392 | Not Available | 2829 | Open in IMG/M |
| 3300034103|Ga0335030_0354262 | Not Available | 966 | Open in IMG/M |
| 3300034106|Ga0335036_0154362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
| 3300034106|Ga0335036_0620012 | Not Available | 653 | Open in IMG/M |
| 3300034109|Ga0335051_0244530 | Not Available | 884 | Open in IMG/M |
| 3300034109|Ga0335051_0359861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
| 3300034109|Ga0335051_0560621 | Not Available | 525 | Open in IMG/M |
| 3300034112|Ga0335066_0084319 | Not Available | 2035 | Open in IMG/M |
| 3300034122|Ga0335060_0263795 | Not Available | 955 | Open in IMG/M |
| 3300034166|Ga0335016_0400860 | Not Available | 801 | Open in IMG/M |
| 3300034280|Ga0334997_0726835 | Not Available | 603 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.23% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.08% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.60% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.77% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.83% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.36% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.89% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.42% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.94% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.94% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.47% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.47% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.47% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020518 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020521 | Freshwater microbial communities from Lake Mendota, WI - 26SEP2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021470 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-20m | Environmental | Open in IMG/M |
| 3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033997 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-FT7-sol | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100163175 | 3300001282 | Freshwater | TMERLLSQLMPALVLVRIGQELGTDSPAARAVHDLLELLAAVPWKILG* |
| JGI24766J26685_1000068316 | 3300002161 | Freshwater And Sediment | MKRRWNAALQSLVLVRLGQELGADSPATRAIHDLLELLASVAGVLTR* |
| JGI24766J26685_100091475 | 3300002161 | Freshwater And Sediment | MKSRIENLLPALVLVRIGQELGTDSPAARALHDLLELLASVAGILTR* |
| metazooDRAFT_14321771 | 3300002471 | Lake | MKRTINNLLPALVLVRLGQELGTDSPATHAVHDVLELLASLLGVFCR* |
| B570J40625_10001249913 | 3300002835 | Freshwater | MERLLSQLMPALVLVRIGQELGTDSPAARAVHDLLELLAAVPWKILG* |
| B570J40625_1001037374 | 3300002835 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDFLELLASLAGIFPR* |
| B570J40625_1013167432 | 3300002835 | Freshwater | MNRHLDNLIPALVLVRIGQELGCDSNAARAIHDLLELLTAIPFRFLFAPF* |
| Ga0007791_100551783 | 3300004772 | Freshwater | MMKRRWNAALQSLVLVRLGQELGCDSPATRALHDLLELLASVAGVFSR* |
| Ga0007795_100183155 | 3300004773 | Freshwater | AALQSLVLVRLGQELGTDSPAARAVHDLLEFLAALAGALPVDTF* |
| Ga0068877_100714314 | 3300005525 | Freshwater Lake | MKRHWNTAIVAMTLVRIGQELGTDSPAARAVHDLLDLLSSVAGILAR* |
| Ga0068877_101259933 | 3300005525 | Freshwater Lake | MHRISNLMPALVLIRIGQELGTDSPAARAVHDLLELLSAVPWKILGGP* |
| Ga0068877_105445461 | 3300005525 | Freshwater Lake | MRRTIDRLLPALVLVRLGQELGTDSPATQAVHDLLELLAAFFGLVTR* |
| Ga0068876_1000701310 | 3300005527 | Freshwater Lake | MNRLSHMMPALVLIRIGQELGSDSPAARAVHDLLELLSAVPWKILG* |
| Ga0068876_100617633 | 3300005527 | Freshwater Lake | MKRTINNLLPAMVLVRLGQELGTDSPAARAVHDLLELLASVAGVFSR* |
| Ga0068876_100712224 | 3300005527 | Freshwater Lake | MHRLSNLMPALVLIRIGQELGTNSPAARAVHDLLELLAAVPWKILG* |
| Ga0068876_100896321 | 3300005527 | Freshwater Lake | MHRIANLMPALVLVRIGQELGTNSPAARAVHDLLELL |
| Ga0068876_101933022 | 3300005527 | Freshwater Lake | MHRLSNLMPALVLIRIGQELGTNSPAARAVHDLLELLASVAGVVSR* |
| Ga0068872_106581232 | 3300005528 | Freshwater Lake | MPAKEGHAMNRLSHMMPALVLIRIGQELGSDSPAARAVHDLLELLSAVPWKILG* |
| Ga0049081_1000597510 | 3300005581 | Freshwater Lentic | MRRTINNLLPGLVLVRLGQELGTDGPACRAIHDVLELLASLVGILAR* |
| Ga0049081_100086856 | 3300005581 | Freshwater Lentic | MRRTINNLLPGLVLVRIGQELGTDSPAARALHDLLELIASLPFKVF* |
| Ga0049081_100288511 | 3300005581 | Freshwater Lentic | MHRISNLMSALVLVRIGQELGTDSPAARAVHDLLELLASVAGIFPR* |
| Ga0049081_100868241 | 3300005581 | Freshwater Lentic | MQRRWNAALHSLVLVRLGQELGCDSPAARAVHDLLELLASVAGVFHR* |
| Ga0049081_101172792 | 3300005581 | Freshwater Lentic | MHRISNLMPALVLVRIGQELGTDSPAARAVHDLLELLASVAGVLAR* |
| Ga0049081_101611912 | 3300005581 | Freshwater Lentic | MKRHIDNLLPALVLVRIGQELGTDSPAARAIHDVLELLASIPYLSLF* |
| Ga0049081_103185872 | 3300005581 | Freshwater Lentic | RSQDSLAKEGHMKRTINNLLPAMVLVRLGQELGTDSPAARAVHDLLELLASVAGVFSR* |
| Ga0049080_100821371 | 3300005582 | Freshwater Lentic | MHRLSNLMPALVLVRIGQELGTDSPAARAVHDLLELLATLAGIFPR* |
| Ga0079957_10168484 | 3300005805 | Lake | MRRTINNLLPGLVLVRLGQELGTDCPSTRAIHDVLELLASLVGILAR* |
| Ga0079957_10246787 | 3300005805 | Lake | MQRTIDRLLPALVLVRIGQELGTDSPAARALHDLLELLAAIPFRFCS* |
| Ga0079957_10275853 | 3300005805 | Lake | MRRKIDAMLPALVLIRIGQELGTDSPAARALHDLLELLASVAGVLSR* |
| Ga0079957_10901403 | 3300005805 | Lake | MRRSINNLLPALVLIRIGQELGTDGPAARAIHDVLELLAALAGALTR* |
| Ga0079957_11328743 | 3300005805 | Lake | MRRKIDHLLPALVLIRIGQELGTDSPAARALHDLLELLASVAGCFRS* |
| Ga0079957_11547373 | 3300005805 | Lake | MHRISNLMPALVLIRIGQELGTDSPAARAVHDLLDLLSAVPWKILGGP* |
| Ga0079957_12855541 | 3300005805 | Lake | ATTATCESEAKEGHMRRTINNMLPALVLVRIGQELGMDSPAARAVHDLLELLTALPWKFFG* |
| Ga0079957_13360951 | 3300005805 | Lake | MTALVLIRLGQELGTDSPAARAVHDLLEMLASVAGILSR* |
| Ga0075470_1000035415 | 3300006030 | Aqueous | MRRTIDRMFPALVLVRIGQELGTDSPAARALHDLIELLAALPWKFL* |
| Ga0075470_100030827 | 3300006030 | Aqueous | MRRTINNLLPGLVLVRLGQELGTDGPACRAIHDVLELMASLVGILAR* |
| Ga0075470_100032195 | 3300006030 | Aqueous | MTRHYNAAITALTLVRIGQELGCDSPAARALHDFLELLASVAGVISR* |
| Ga0075470_100254783 | 3300006030 | Aqueous | MKRRWNAALQSLVLVRLGQELGCDSPAARALHDLLELLASVAGVISR* |
| Ga0075470_100391543 | 3300006030 | Aqueous | MRRTINNLLPALVLVRLGQELGTDSPAARALHDLLEMLASVPWSFLGLTNYR* |
| Ga0075470_100418103 | 3300006030 | Aqueous | MRRTINNLLPALVLVRLGQELGSDSPAARALHDLLEFLTSLPVRFLG* |
| Ga0075470_100455141 | 3300006030 | Aqueous | HRILWPRRATMTRHWNAALQSLVLVRLGQELGCDSAAARAVHDLLELLANVAGILAR* |
| Ga0075470_100684383 | 3300006030 | Aqueous | MRRTINNLLPALVLVRFGQELGTDSPVARALHDLLEMLASVPWSFLGLTNYR* |
| Ga0075470_101264402 | 3300006030 | Aqueous | MHRISNLMPALVLIRIGQELGTDSPAARAVHDLLELLASVPWKILGSP* |
| Ga0075470_101303342 | 3300006030 | Aqueous | MRRTIDRLLPALVLVRLGQELGTDSPAARALHDLLEFLASFPVSFLG* |
| Ga0075470_101773582 | 3300006030 | Aqueous | MHRRWNDALQSLVLVRLGQELGCDSPAARALHDLLELLAAIPFKFFG* |
| Ga0075471_1000026914 | 3300006641 | Aqueous | MTRHWNAALQSLVLVRLGQELGCDSAAARAVHDLLELLANVAGILAR* |
| Ga0075471_103864661 | 3300006641 | Aqueous | MRRTINNLLPALVLVRLGQELGTDSPAARALHDLLEFLASFPVSFLG* |
| Ga0075464_100946453 | 3300006805 | Aqueous | MKRHIDNLLPALVLVRIGQELGTDSPATRAIHDLLELLASVA |
| Ga0075464_101561062 | 3300006805 | Aqueous | MQRRLSNLMPALVLIRIGQELGTDSPAARAVHDLLELVASVPWKILGCP* |
| Ga0075464_105660221 | 3300006805 | Aqueous | QSLVLVRIGQELGTDSPVARALHDLIELIASIPWKFL* |
| Ga0075472_106461442 | 3300006917 | Aqueous | MRRTIDRLLPALVLIRLGQELGTASPATQAVHDVLELLASFAGVLTR* |
| Ga0075472_106697622 | 3300006917 | Aqueous | MRRTINNLLPALVLVRLGQELGIDSPAARALHDLLEMLASVPWSFLGLTNYR* |
| Ga0102532_10338068 | 3300007094 | Freshwater Lake | VKRNWNAAICALTLIRIGQELGTDSPACRAVHDLIELLASVAGVFPR* |
| Ga0075458_102053692 | 3300007363 | Aqueous | MKRRWNAALQSLVLVRLGQELGCDSPAARALHDLLELLATVASAFSPLTK* |
| Ga0104988_108942 | 3300007735 | Freshwater | MRRTIDSLLPALVLIRLGQELGTASPATQAVHDVLELLAAFLGLLTP* |
| Ga0108970_102787812 | 3300008055 | Estuary | MTRRWNAALHSLVLVRLGQELGCDSPAARAVHDLLELLASVAGVFHR* |
| Ga0114340_10029844 | 3300008107 | Freshwater, Plankton | MEGRMRRTIDRMFPALVLVRIGQELGTDSPAARALHDLIELLAALPWKFL* |
| Ga0114341_1001449222 | 3300008108 | Freshwater, Plankton | MFPALVLVRIGQELGTDSPAARALHDLIELLAALPWKFL* |
| Ga0114350_100063629 | 3300008116 | Freshwater, Plankton | MRRTLDNLLPALVLIRIGQELGTDSPASRALHDLLELLASVAGLVAR* |
| Ga0114350_10183446 | 3300008116 | Freshwater, Plankton | MKRHWNTAIVAMTLVRIGQELGTDSPAARAVHDLLDLLSSVAGIL |
| Ga0114355_100524710 | 3300008120 | Freshwater, Plankton | MQRRWNAALQSLVLVRLGQELGCDSPAARALHDVLEFLASVAGVFSR* |
| Ga0114355_12206572 | 3300008120 | Freshwater, Plankton | AKEGHAMHRISNLMPALVLIRIGQELGTDSPAARAVHDLLELLSAVPWKILGGP* |
| Ga0114363_101197013 | 3300008266 | Freshwater, Plankton | MEGRMRRTIDRMFPALVLVRIGQELGTDSPAARALHDVIELLAALPWKFM* |
| Ga0114363_10281091 | 3300008266 | Freshwater, Plankton | MKRHWNTAMQSLVLVRLGQELGTASPTTQAIHDLLELLASLASALTR* |
| Ga0114363_10604262 | 3300008266 | Freshwater, Plankton | MRRTIDRLLPALVLVRLGQELGTASPATQAVHDLLELLASLVGVFAR* |
| Ga0114363_10664212 | 3300008266 | Freshwater, Plankton | MHRIANLMPALVLVRIGQELGTNSPAARAVHDLLELLSAVPWKILGSP* |
| Ga0114363_10728436 | 3300008266 | Freshwater, Plankton | MHRISNLMPALVLIRIGQELGTDSPAARAVHDLLELLASVAGIFPR* |
| Ga0114363_10781072 | 3300008266 | Freshwater, Plankton | MRRTIDRLLPALVLVRLGQELGTASPATQAVHDLLELLASLASALTR* |
| Ga0114363_11093881 | 3300008266 | Freshwater, Plankton | MRRTIDRLLPALVLVRLGQELGTDSPATQAVHDLLELLASLAAALTR* |
| Ga0114363_11891862 | 3300008266 | Freshwater, Plankton | MTRAFDRLLPALVLVRLGQELGADSPAARAVHDLLELLATFAGALTR* |
| Ga0114876_11816812 | 3300008448 | Freshwater Lake | MHRRWNDALQSLVLVRLGQELGCDSPAARALHDLLELLAAIPFKFLG* |
| Ga0114880_11582492 | 3300008450 | Freshwater Lake | MNRHWNTAMSALVLIRIGQELGTASPATQAVHDLLELLASLAGVLAR* |
| Ga0114979_102949832 | 3300009180 | Freshwater Lake | MKRHIDNLLPALVLVRIGQELGTDSPATRAIHDLLELLASVAGVLTR* |
| Ga0114976_102733962 | 3300009184 | Freshwater Lake | MSRAFDRLLPALVLVRIGQELGTNSPAAQAVHDLLELLATFAGALTR* |
| Ga0129333_100004979 | 3300010354 | Freshwater To Marine Saline Gradient | MKRHLDNLLPALVLVRIGQELGTDSPAARAIHDLLELLAALPWRLFG* |
| Ga0129333_103644582 | 3300010354 | Freshwater To Marine Saline Gradient | MRRTLDNLLPALVLVRIGQELGTDSPAARVIHDVLELIAALPWKLF* |
| Ga0129333_106741811 | 3300010354 | Freshwater To Marine Saline Gradient | MNRISNLMPALVLVRIGQELGTDSPAARAVHDLLELLASVPWKILG* |
| Ga0129336_103562621 | 3300010370 | Freshwater To Marine Saline Gradient | MKRHLDNLLPALVLVRIGQELGTDSPAARAIHDLLELLA |
| Ga0129336_105635241 | 3300010370 | Freshwater To Marine Saline Gradient | MKRTIDDLLPALVLIRIGQELGTDSPAARAVHDLLELLASLAGALTL* |
| Ga0133913_130374301 | 3300010885 | Freshwater Lake | MKRTVNNLLPALVLVRLGQELGTHSPATRALHDLIELLASVAGVFFR* |
| Ga0153799_10116401 | 3300012012 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDALELLASLAGILP |
| Ga0153805_10576062 | 3300012013 | Surface Ice | MKRHIDNLIPALVLVRIGQELGTDSPAARAVHDLLELLASVAGVLPS* |
| Ga0153801_10481872 | 3300012017 | Freshwater | AKEGHVMHRISNLMPALVLVRIGQELGTDSPAARAIHDLLEILAALPWRFLG* |
| Ga0164295_100310996 | 3300013014 | Freshwater | MKRNWNAALQSLVLVRLGQELGCDSPATRALHDLLDLLASVAGILAK* |
| Ga0163212_10397953 | 3300013087 | Freshwater | MKRHIDKLFTALVLVRLGQELGTASPVARAVHDLLGVLANTLGLLVP* |
| Ga0177922_102439673 | 3300013372 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDLLELLASLAGIFPR* |
| Ga0177922_107604352 | 3300013372 | Freshwater | MHRISSLMPALVLVRIGQELGTDSPAARAIHDLLEILAALPWRFLG* |
| Ga0177922_107765541 | 3300013372 | Freshwater | MHRTFDRLLPALVLVRIGQELGADSPAARAVHDLLELFATFAGALTR* |
| Ga0181365_10941993 | 3300017736 | Freshwater Lake | VLTEQRRKDGSMKRHIDNLLPALVLVRIGQELGTDSPAARALHDFLEVLASVAGIFSR |
| Ga0181365_11322593 | 3300017736 | Freshwater Lake | KRHIDNLLPALVLVRIGQELGTDSPATRTIHDLLEMLASVAGILSR |
| Ga0181358_11386571 | 3300017774 | Freshwater Lake | MKRHIDNLLPALVLVRIGQELGTDSPAARALHDFLEVLASVAGILTR |
| Ga0181357_10343651 | 3300017777 | Freshwater Lake | KDGSMKRHIDNLLPALVLVRIGQELGTDSPAARALHDFLEVLASVAGILTR |
| Ga0181553_106522161 | 3300018416 | Salt Marsh | RLLPALVLVRIGQELGTDSPAARAVHDLLELLAALPWHFLG |
| Ga0194035_10018567 | 3300020167 | Anoxic Zone Freshwater | MKRHINNLLPALVLVRIGQELGTDSPAARALHDFLEVLASVAGILTR |
| Ga0208050_100020218 | 3300020498 | Freshwater | MHRISNLMPALVLVRIGQELGTNSPAARAVHDLLELLSAVPWKILGSP |
| Ga0208050_10143492 | 3300020498 | Freshwater | MKRRWNSAMSALVLVRIGQELGTDSPAARAVHDLLELLASVAGVLAR |
| Ga0208091_10034691 | 3300020506 | Freshwater | MHRLSNLMPALVLVRIGQELGTDSPAARAVHDLLELLA |
| Ga0208091_10061452 | 3300020506 | Freshwater | MERLLSQLMPALVLIRIGQELGTDSPAARAVHDLLELLAAVPWKILG |
| Ga0208091_10224242 | 3300020506 | Freshwater | MNRLSNLMPALVLVRIGQELGTNSPAARAVHDLLELLASVAGVVSR |
| Ga0207935_10029503 | 3300020516 | Freshwater | MERLLSQLMPALVLVRIGQELGTDSPAARAVHDLLELLAAVPWKILG |
| Ga0208721_10003382 | 3300020518 | Freshwater | MHRLSNLMPALVLIRIGQELGTNSPAARAVHDLLELLASVAGVVSR |
| Ga0208721_10066854 | 3300020518 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDFLELLASLAGIFPR |
| Ga0208482_10158693 | 3300020521 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDLLELLASLAGIFPR |
| Ga0208232_10539092 | 3300020527 | Freshwater | MHRLSNLMPALVLVRIGQELGTNSPAARAVHDLLELLASVAGVVSR |
| Ga0207939_10218122 | 3300020536 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDLLELLASVAGVLAR |
| Ga0208361_10022796 | 3300020547 | Freshwater | MERRLSQLMPALVLIRLGQELGTDSPAARSIHGLIELLVGLPAAWFR |
| Ga0208360_10007142 | 3300020551 | Freshwater | MHRISNLMPALVLVRIGQELGTNSPAARAVHDLLELLSAVPWKILG |
| Ga0208855_10026405 | 3300020553 | Freshwater | MHRLSNLMPALVLVRIGQELGTNSPAARAVHDLLELLAAVPWKILG |
| Ga0208855_10037523 | 3300020553 | Freshwater | MHRISNLMPALVLIRIGQELGTDSPAARAVHDLLELLASVAGVLAR |
| Ga0208723_10216761 | 3300020571 | Freshwater | ALVLVRIGQELGTNSPAARAVHDLLELLAAVPWKILS |
| Ga0194055_100213355 | 3300021079 | Anoxic Zone Freshwater | MKRTIDNLLPALVLVRLGQELGTDSPATRAIHDLLELLASVAGISSR |
| Ga0213920_100038830 | 3300021438 | Freshwater | MTRRCNAALQSLVLVRIGQELGCDSAAARAVHDLLELLANVAGVLAR |
| Ga0194051_10225051 | 3300021470 | Anoxic Zone Freshwater | MKRHINNLLPALVLVRIGQELGTDSPAARALHDFLE |
| Ga0228701_100175915 | 3300022746 | Freshwater | MHRTFDRLLHALVLVRIGQELGTDSPAARAVHDLLELLAALPWHFLG |
| Ga0214917_100146378 | 3300022752 | Freshwater | MRRTINNLLPALVLVRLGQELGTDGPACRAIHDVLKLVASLLGILAR |
| Ga0214921_100654214 | 3300023174 | Freshwater | MTRHWNAALQSLVLVRLGQELGCDSAAARAVHDLLELLANVAGILAR |
| Ga0214923_100531323 | 3300023179 | Freshwater | MKRHIDRLLQALVLIRIGQELGTDSSAARTIHDLVELFAALPWKFF |
| Ga0214923_100816135 | 3300023179 | Freshwater | MHRTFDRLLPALVLVRIGQELGTDSPAARAVHDLLELLAALPWHFLS |
| Ga0208864_10409453 | 3300025578 | Freshwater | MKRRWNAALQSLVLVRLGQELGCDSPATRALHDLLELLASVAGVFSR |
| Ga0208546_100120613 | 3300025585 | Aqueous | MKRRWNAALQSLVLVRLGQELGCDSPAARALHDLLELLASVAGVISR |
| Ga0208546_100223911 | 3300025585 | Aqueous | MRRTINNLLPALVLVRLGQELGTDSPAARALHDLLEMLASVPWSFLGLTNYR |
| Ga0208546_10057338 | 3300025585 | Aqueous | MTRHYNAAITALTLVRIGQELGCDSPAARALHDFLELLASVAGVISR |
| Ga0208546_10096762 | 3300025585 | Aqueous | MRRTINNLLPGLVLVRLGQELGTDGPACRAIHDVLELMASLVGILAR |
| Ga0208546_10159393 | 3300025585 | Aqueous | MRRTINNLLPALVLVRLGQELGSDSPAARALHDLLEFLTSLPVRFLG |
| Ga0208546_10538473 | 3300025585 | Aqueous | MRRTINNLLPALVLVRFGQELGTDSPVARALHDLLEMLASVPWSFLGLTNYR |
| Ga0208147_11695841 | 3300025635 | Aqueous | MRRTIKDLLPAMVLVRIGQELGTDSPAARALHDLLDLLGSLSGVLAR |
| Ga0208784_12480551 | 3300025732 | Aqueous | MRRTIDRLLPALVLIRLGQELGTASPATQAVHDVLELLASFAGVLTR |
| Ga0208005_100247611 | 3300025848 | Aqueous | MRRTIDRLLPALVLVRLGQELGTDSPAARALHDLLEFLASFPVSFLG |
| Ga0208005_10635942 | 3300025848 | Aqueous | MHRISNLMPALVLIRIGQELGTDSPAARAVHDLLELLASVPWKILGSP |
| Ga0208005_12443802 | 3300025848 | Aqueous | MRRTIDRLLPALVLVRLGQELGTDSPAARALHDLLEFLASFPVSFL |
| Ga0208975_10012904 | 3300027659 | Freshwater Lentic | MRRTINNLLPGLVLVRIGQELGTDSPAARALHDLLELIASLPFKVF |
| Ga0208975_10042669 | 3300027659 | Freshwater Lentic | MHRLSNLMPALVLVRIGQELGTDSPAARAVHDLLELLATLAGIFPR |
| Ga0208975_10532221 | 3300027659 | Freshwater Lentic | MRRTINNLLPGLVLVRLGQELGTDGPACRAIHDVLELLASLVGILAR |
| Ga0208975_10554371 | 3300027659 | Freshwater Lentic | MQRRWNAALHSLVLVRLGQELGCDSPAARAVHDLLELLASVAGVFHR |
| Ga0208975_10666602 | 3300027659 | Freshwater Lentic | MKRHIDNLLPALVLVRIGQELGTDSPAARAIHDVLELLASIPYLSLF |
| (restricted) Ga0247836_10118163 | 3300027728 | Freshwater | MRRHIDRLLQALVLIRLGQELGTDTQMARTIHDLVELFASLPSKFF |
| Ga0209088_100891514 | 3300027763 | Freshwater Lake | MKRHIDNLLPALVLVRIGQELGTDSPATRAIHDLLELLASVAGVLTR |
| Ga0209972_1001108012 | 3300027793 | Freshwater Lake | MKRHWNTAIVAMTLVRIGQELGTDSPAARAVHDLLDLLSSVAGILAR |
| Ga0209972_102338432 | 3300027793 | Freshwater Lake | RQSRRRVTAKEGHVMHRLSNLMPALVLIRIGQELGTNSPAARAVHDLLELLASVAGVVSR |
| Ga0209229_100907183 | 3300027805 | Freshwater And Sediment | MKSRIENLLPALVLVRIGQELGTDSPAARALHDLLELLASVAGILTR |
| Ga0209229_101312063 | 3300027805 | Freshwater And Sediment | MKRRWNAALQSLVLVRLGQELGADSPATRAIHDLLELLASVAGVLTR |
| Ga0209985_100912173 | 3300027806 | Freshwater Lake | MHRISNLMPALVLIRIGQELGTDSPAARAVHDLLELLSAVPWKILGGP |
| Ga0209985_103056082 | 3300027806 | Freshwater Lake | MRRTIDRLLPALVLVRLGQELGTDSPATQAVHDLLELLAAFFGLVTR |
| Ga0209990_100900313 | 3300027816 | Freshwater Lake | MKRTINNLLPAMVLVRLGQELGTDSPAARAVHDLLELLASVAGVFSR |
| Ga0209990_101763791 | 3300027816 | Freshwater Lake | MTRRWNSAMSALVLIRIGQELGTNSPAARAVHDLLELL |
| Ga0119944_10000675 | 3300029930 | Aquatic | MRRTIDRLLPALVLVRLGQELGTASPVTRAIHDLLDLLATVAGVFRG |
| Ga0119944_10143504 | 3300029930 | Aquatic | MKRHWNAAMSALVLIRLGQELGTASPATQAIHDVLELLASLAGVLAR |
| Ga0315907_100441962 | 3300031758 | Freshwater | MRRTLDNLLPALVLIRIGQELGCDSPASRALHDLLELLASVAGLVAR |
| Ga0315907_100820524 | 3300031758 | Freshwater | MKRHWNTAMQSLVLVRLGQELGTASPTTQAIHDLLELLASLASALTR |
| Ga0315907_101574072 | 3300031758 | Freshwater | MHRIANLMPALVLVRIGQELGTNSPAARAVHDLLELLSAVPWKILGSP |
| Ga0315907_101691392 | 3300031758 | Freshwater | MHRLSNLMPALVLIRIGQELGTNSPAARAVHDLLELLAAVPWKILS |
| Ga0315907_102686432 | 3300031758 | Freshwater | MQRRWNAALQSLVLVRLGQELGCDSPAARALHDVLEFLASVAGVFSR |
| Ga0315907_104558122 | 3300031758 | Freshwater | MRRTIDRLLPALVLVRLGQELGTASPATQAVHDLLELLASLASALTR |
| Ga0315907_105105421 | 3300031758 | Freshwater | MRRTLDNLLPALVLIRIGQELGTDSPASRALHDLLELLASVAGLVAR |
| Ga0315907_107966772 | 3300031758 | Freshwater | MRRTLDNLLPALVLIRIGQELGCDSPASRALHDLLELLASVAGVLHR |
| Ga0315907_111692441 | 3300031758 | Freshwater | TIDRLLPALVLVRLGQELGTASPATQAVHDLLELLASLVGVFAR |
| Ga0315899_104747472 | 3300031784 | Freshwater | MEGRMRRTIDRMFPALVLVRIGQELGTDSPAARALHDLIELLAALPWKFL |
| Ga0315900_104899783 | 3300031787 | Freshwater | MRRTIDRLLPALVLVRLGQELGTDSPATQAVHDLLELLASLVGVFAR |
| Ga0315900_107573572 | 3300031787 | Freshwater | MNRTFDRLLPALVLVRLGQELGADSPAARAVHDLLELLATFAGALTR |
| Ga0315909_100783463 | 3300031857 | Freshwater | MRRTIDRMFPALVLVRIGQELGTDSPAARALHDVIELLAALPWKFM |
| Ga0315909_100975881 | 3300031857 | Freshwater | MQRTFDRLLPALVLVRIGQELGTDSPAARAVHDLLELLATFAGALTR |
| Ga0315909_101169295 | 3300031857 | Freshwater | MRRSIDRLLPALVLVRLGQELGTASPATQAVHDVLELLAAFIGLLPR |
| Ga0315909_101698283 | 3300031857 | Freshwater | MHRISNLMPALVLIRIGQELGTDSPAARAVHDLLELLASVAGIFPR |
| Ga0315909_101985373 | 3300031857 | Freshwater | MRRTIDRLLPALVLVRLGQELGTASPATQAVHDLLELLASLVGVFAR |
| Ga0315909_102405254 | 3300031857 | Freshwater | MHRLSNLMPALVLIRIGQELGVNSPAARAVHDLLELLSAVPWKILGSP |
| Ga0315909_104897821 | 3300031857 | Freshwater | MRRTIDRLLPALVLVRLGQELGTDSPATQAVHDLLELLASLAAALTR |
| Ga0315904_100322253 | 3300031951 | Freshwater | MQRRWNAALQSLVLVRLGQELGCDSPAARALHDLLELLASVAGILAR |
| Ga0315904_100632924 | 3300031951 | Freshwater | MRRTLDNLLPALVLVRLGQELGTDSPAARAVHDLLEFLASLAGALTR |
| Ga0315904_112905201 | 3300031951 | Freshwater | MRRTLNNLLPAIVLVRIGQELGTDSPAARALHDLLDLLASVAGVLAR |
| Ga0315901_107654381 | 3300031963 | Freshwater | MTRAFDRLLPALVLVRLGQELGADSPAARAVHDLLELLATFAGALTR |
| Ga0315902_109436421 | 3300032093 | Freshwater | MRRHYNAAITALTLVRLGQELGTYSPAARAVHDLLELLATFAGALTR |
| Ga0315903_105096112 | 3300032116 | Freshwater | MNRHWNTAMSALVLIRIGQELGTASPATQAVHDLLELLASLAGVLAR |
| Ga0334980_0069376_985_1125 | 3300033816 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAIHDLLELLAGLAGALTR |
| Ga0334980_0356068_2_118 | 3300033816 | Freshwater | TALTLVRLGQELGTDSGAARAVHDLLELLCGIASALAR |
| Ga0334982_0018344_2085_2225 | 3300033981 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDLLELLAAMPWKFLG |
| Ga0334982_0027048_1394_1537 | 3300033981 | Freshwater | MHRTFDRLLPALVLVRLGQELGADSPAARAVHDLLELLATFAGALTR |
| Ga0334982_0029586_1212_1358 | 3300033981 | Freshwater | MTMHRISNLMPALVLVRIGQELGTNSPAARAVHDLLELLASVAGVVSR |
| Ga0334982_0045980_1391_1534 | 3300033981 | Freshwater | MNRHWNHAMQSLVLIRIGQELGTDSPAAQALHDLLELLAAIPFRFLG |
| Ga0334982_0101286_948_1091 | 3300033981 | Freshwater | MRRTINNLLPGLVLVRIGQELGTDSPAARAIHDVLELLAALPWKFLG |
| Ga0334982_0319471_524_664 | 3300033981 | Freshwater | MHRISNLMPALVLVRIGQELGTNSPAARAVHDLLELLAAVPWKILS |
| Ga0334982_0432756_264_404 | 3300033981 | Freshwater | MHRLSNLMPALVLVRIGQELGTNSPAARAVHDLLELLSAVPWKILG |
| Ga0334994_0108711_1426_1578 | 3300033993 | Freshwater | MTMHRISNLMPALVLVRIGQELGTNSPAARAVHDLLELLSAVPWKILGSP |
| Ga0334994_0336173_256_396 | 3300033993 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDLLELLASVAGALAR |
| Ga0310131_087689_189_314 | 3300033997 | Fracking Water | MPALVLIRIGQELGTDSPAARAVHDLLELLASVPWKILGSP |
| Ga0334986_0021361_2731_2883 | 3300034012 | Freshwater | MNRHLDNLIPALVLVRIGQELGCDSNAARAIHDLLELLTAIPFRFLFAPF |
| Ga0334986_0330245_688_798 | 3300034012 | Freshwater | MHRLSNLMPALVLVRIGQELGTNSPAARAVHDLLELL |
| Ga0335021_0095659_583_726 | 3300034023 | Freshwater | MKRHIDNLLPALVLVRIGQELGTDSPAARAVHDLLELLASVAGVFSR |
| Ga0334995_0201119_1071_1217 | 3300034062 | Freshwater | MHRLSNLMPALVLVRIGQELGTNSPAARAVHDLLELLSAVPWKILGSP |
| Ga0334995_0237494_1089_1235 | 3300034062 | Freshwater | MHRLSNLMPALVLIRIGQELGTNSPAARAVHDLLELLSAVPWKILGSP |
| Ga0334995_0307950_468_608 | 3300034062 | Freshwater | MKRLSQLMPALVLIRIGQELGTDTPAARAVHDLLELLASVAGVLPC |
| Ga0335000_0010424_1519_1683 | 3300034063 | Freshwater | LAKEGLEMQRRWNAALQSLVLVRIGQELGTYSPAARALHDLLELLASVASVFHR |
| Ga0335000_0101769_1494_1652 | 3300034063 | Freshwater | MEGQTMSRNWDRVIQSLVLVRMGQELGTDSRAARAVHDLLDLLTTVAASIFQ |
| Ga0334990_0200911_469_621 | 3300034068 | Freshwater | MKRHIDNLLPALVLVRIGQELGTDSPATRAIHDLLELLASVAGVAGVLTR |
| Ga0310127_022468_3040_3183 | 3300034072 | Fracking Water | MKRTIDTLLPALVLIRIGQELGTDSPAARVVHDLIVLLLALPLKFSG |
| Ga0335010_0037840_485_625 | 3300034092 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAIHDLLEILAALPWRFLG |
| Ga0335010_0133941_1322_1468 | 3300034092 | Freshwater | MTMHRLSNLMPALVLVRIGQELGTNSPAARAVHDLLELLASVAGVVSR |
| Ga0335027_0006181_4832_4975 | 3300034101 | Freshwater | MRRTINNLLPGLVLVRLGQELGTDCPSTRAIHDVLELLASLLGILAR |
| Ga0335027_0014531_6441_6584 | 3300034101 | Freshwater | MKRHIDNLLPALVLVRIGQELGTDSPVARAIHDVLELLASIPYRSLF |
| Ga0335027_0015287_29_172 | 3300034101 | Freshwater | MKRHIDNLLPALVLVRIGQELGTDSPVARAIHDLLELLASIPYRFLF |
| Ga0335027_0037501_29_172 | 3300034101 | Freshwater | MKRHIDNLLPALVLVRIGQELGTDSPVARAIHDVLELLASIPYRFLL |
| Ga0335027_0048547_3042_3185 | 3300034101 | Freshwater | MNRTFDRLLPALVLVRIGQELGADSPAARAVHDLLELLATFAGALTR |
| Ga0335027_0067392_2140_2286 | 3300034101 | Freshwater | MTMHRISNLMPALVLVRIGQELGTNSPAARAVHDLLELLASVAGVVLR |
| Ga0335030_0354262_701_847 | 3300034103 | Freshwater | MHRLSNLMPALVLIRIGQELGTDSPAARAVHDLLDLLSAVPWKILCGP |
| Ga0335036_0154362_1173_1313 | 3300034106 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAVHDLLELLAAVPWKILG |
| Ga0335036_0620012_518_652 | 3300034106 | Freshwater | MHRISNLMPALVLVRIGQELGTDSPAARAIHDLLEILAALPWRFL |
| Ga0335051_0244530_247_390 | 3300034109 | Freshwater | MRRTINKTLPALVLVRIGQELGTDSPAARAIHDLLEILAALPWRFLG |
| Ga0335051_0359861_1_129 | 3300034109 | Freshwater | MNRTFDRLLPALVLVRIGQELGADSPAARAVHDLLELLATFAG |
| Ga0335051_0560621_416_523 | 3300034109 | Freshwater | MNRHLDNLIPALVLVRIGQELGCDSNAARAIHDLLE |
| Ga0335066_0084319_537_680 | 3300034112 | Freshwater | MKRHIDNLLPALVLVRIGQELGTDSPAARAVHDLLELLASVAGVFTR |
| Ga0335060_0263795_820_945 | 3300034122 | Freshwater | MPALVLVRIGQELGTNSPAARAVHDLLELLSAVPWKILGSP |
| Ga0335016_0400860_9_128 | 3300034166 | Freshwater | MPALVLIRIGQELGTDSPAARAVHDLLELLASVAGVLAR |
| Ga0334997_0726835_400_546 | 3300034280 | Freshwater | MHRLSNLMPALVLIRIGQELGTDSPAARAVHDLLDLLSAVPWKIFGIP |
| ⦗Top⦘ |