Metagenome Family F022805

Overview

Basic Information

• Family ID: F022805
• Family Type: Metagenome
• Number of Sequences: 212
• Average Sequence Length: 39 residues
• Representative Sequence: MLKCFGDLIGRTVEAYVNDIVVKSKWADHLVADLEQTFAKL
• Number of Associated Samples: 76
• Number of Associated Scaffolds: 212

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Eukaryota
• % of genes with valid RBS motifs: 2.83 %
• % of genes near scaffold ends (potentially truncated): 34.43 %
• % of genes from short scaffolds (< 2000 bps): 100.00 %
• Associated GOLD sequencing projects: 76
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Eukaryota (57.547 % of family members)
• NCBI Taxonomy ID: 2759
• Taxonomy: All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.698 % of family members)
• Environment Ontology (ENVO): Unclassified (97.170 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (97.170 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 56.52%
  β-sheet: 0.00%
  Coil/Unstructured: 43.48%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 212 Family Scaffolds
PF13456	RVT_3	0.47
PF00078	RVT_1	0.47
PF02992	Transposase_21	0.47

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.96 %
Unclassified	root	N/A	41.04 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.96 %
Unclassified	root	N/A	41.04 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	57.55 %
Unclassified	root	N/A	41.04 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.42 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	57.55 %
Unclassified	root	N/A	41.04 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.42 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	57.55 %
Unclassified	root	N/A	41.04 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.42 %

Level 6

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	57.55 %
Unclassified	root	N/A	41.04 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	1.42 %

Level 7

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	57.55 %
Unclassified	root	N/A	41.04 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	1.42 %

Level 8

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	57.08 %
Unclassified	root	N/A	41.04 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	1.42 %

Level 9

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya	1.42 %

Level 10

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 11

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 12

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 13

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 14

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 15

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 16

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 17

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 18

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	56.13 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 19

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	56.13 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	16.98 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	2.83 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	16.98 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	2.83 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	16.98 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	1.42 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.94 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	16.98 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	1.42 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.94 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	16.98 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1.42 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.94 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	16.98 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1.42 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.94 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005338|Ga0068868_101843025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	572
3300009148|Ga0105243_13127612	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	501
3300011119|Ga0105246_12395160	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	518
3300013296|Ga0157374_11634013	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	669
3300013297|Ga0157378_12641221	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	555
3300014969|Ga0157376_12236244	Not Available	586
3300015267|Ga0182122_1061822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	526
3300015267|Ga0182122_1069444	Not Available	508
3300015268|Ga0182154_1056700	Not Available	543
3300015269|Ga0182113_1082169	Not Available	530
3300015269|Ga0182113_1094007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	508
3300015269|Ga0182113_1096277	Not Available	504
3300015274|Ga0182188_1003522	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1065
3300015274|Ga0182188_1030654	Not Available	606
3300015275|Ga0182172_1028994	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	664
3300015275|Ga0182172_1038250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	616
3300015275|Ga0182172_1071561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	513
3300015276|Ga0182170_1010455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	875
3300015276|Ga0182170_1032980	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	643
3300015277|Ga0182128_1020430	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	736
3300015277|Ga0182128_1034477	Not Available	640
3300015277|Ga0182128_1040145	Not Available	613
3300015277|Ga0182128_1058841	Not Available	550
3300015279|Ga0182174_1040623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	628
3300015281|Ga0182160_1019384	Not Available	758
3300015281|Ga0182160_1067259	Not Available	537
3300015281|Ga0182160_1078709	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	512
3300015281|Ga0182160_1079794	Not Available	510
3300015282|Ga0182124_1019385	Not Available	753
3300015282|Ga0182124_1043861	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	605
3300015283|Ga0182156_1026629	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	711
3300015283|Ga0182156_1035093	Not Available	658
3300015283|Ga0182156_1047893	Not Available	603
3300015285|Ga0182186_1060212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	554
3300015285|Ga0182186_1061413	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	550
3300015286|Ga0182176_1019896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	794
3300015286|Ga0182176_1060668	Not Available	561
3300015286|Ga0182176_1067579	Not Available	543
3300015287|Ga0182171_1043128	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	622
3300015287|Ga0182171_1066420	Not Available	549
3300015287|Ga0182171_1073641	Not Available	532
3300015288|Ga0182173_1022330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	738
3300015288|Ga0182173_1032995	Not Available	663
3300015288|Ga0182173_1048130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	597
3300015289|Ga0182138_1033023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	671
3300015289|Ga0182138_1053927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	584
3300015289|Ga0182138_1079901	Not Available	520
3300015289|Ga0182138_1083110	Not Available	514
3300015291|Ga0182125_1060579	Not Available	576
3300015292|Ga0182141_1020660	Not Available	776
3300015292|Ga0182141_1038205	Not Available	656
3300015294|Ga0182126_1013242	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	884
3300015294|Ga0182126_1056332	Not Available	591
3300015294|Ga0182126_1097604	Not Available	500
3300015295|Ga0182175_1013506	Not Available	889
3300015295|Ga0182175_1060309	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	584
3300015295|Ga0182175_1077126	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	543
3300015296|Ga0182157_1104358	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	500
3300015298|Ga0182106_1008500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1042
3300015298|Ga0182106_1017756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	843
3300015298|Ga0182106_1026474	Not Available	751
3300015298|Ga0182106_1070455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	565
3300015298|Ga0182106_1095790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	514
3300015299|Ga0182107_1007369	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1076
3300015299|Ga0182107_1018258	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	838
3300015299|Ga0182107_1097519	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	514
3300015300|Ga0182108_1077300	Not Available	556
3300015300|Ga0182108_1079585	Not Available	551
3300015302|Ga0182143_1042391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	660
3300015302|Ga0182143_1050044	Not Available	629
3300015302|Ga0182143_1083976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	538
3300015303|Ga0182123_1002955	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1313
3300015303|Ga0182123_1056859	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	592
3300015303|Ga0182123_1061860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	577
3300015303|Ga0182123_1066334	Not Available	566
3300015303|Ga0182123_1084265	Not Available	527
3300015303|Ga0182123_1098918	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	502
3300015304|Ga0182112_1036608	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	689
3300015304|Ga0182112_1044744	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	651
3300015304|Ga0182112_1050411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	629
3300015304|Ga0182112_1052130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	623
3300015304|Ga0182112_1100613	Not Available	510
3300015305|Ga0182158_1021175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	799
3300015305|Ga0182158_1049475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	630
3300015305|Ga0182158_1055492	Not Available	609
3300015305|Ga0182158_1062410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	589
3300015307|Ga0182144_1087797	Not Available	537
3300015308|Ga0182142_1066166	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	598
3300015314|Ga0182140_1045107	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	671
3300015314|Ga0182140_1072029	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	584
3300015314|Ga0182140_1075107	Not Available	576
3300015314|Ga0182140_1084618	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	556
3300015314|Ga0182140_1102074	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	523
3300015321|Ga0182127_1035762	Not Available	739
3300015321|Ga0182127_1057601	Not Available	641
3300015321|Ga0182127_1066902	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	613
3300015321|Ga0182127_1072793	Not Available	598
3300015321|Ga0182127_1106913	Not Available	528
3300015322|Ga0182110_1023638	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	829
3300015322|Ga0182110_1032489	Not Available	756
3300015322|Ga0182110_1058631	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	636
3300015322|Ga0182110_1093513	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	551
3300015323|Ga0182129_1060788	Not Available	612
3300015323|Ga0182129_1072478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	581
3300015323|Ga0182129_1076015	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	573
3300015329|Ga0182135_1155545	Not Available	501
3300015341|Ga0182187_1079357	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	699
3300015341|Ga0182187_1100270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	645
3300015341|Ga0182187_1114217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	616
3300015341|Ga0182187_1128158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	592
3300015341|Ga0182187_1184669	Not Available	518
3300015343|Ga0182155_1032109	Not Available	991
3300015343|Ga0182155_1061561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	799
3300015343|Ga0182155_1108113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	658
3300015343|Ga0182155_1130499	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	616
3300015343|Ga0182155_1142530	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	596
3300015344|Ga0182189_1036931	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	967
3300015344|Ga0182189_1100390	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	684
3300015344|Ga0182189_1117766	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	646
3300015344|Ga0182189_1132411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	619
3300015344|Ga0182189_1148735	Not Available	593
3300015344|Ga0182189_1190970	Not Available	539
3300015344|Ga0182189_1209212	Not Available	520
3300015344|Ga0182189_1209951	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	520
3300015345|Ga0182111_1040982	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	975
3300015345|Ga0182111_1117782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	667
3300015345|Ga0182111_1205473	Not Available	538
3300015345|Ga0182111_1230494	Not Available	514
3300015345|Ga0182111_1244813	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	502
3300015346|Ga0182139_1169094	Not Available	582
3300015346|Ga0182139_1240738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	506
3300015346|Ga0182139_1244519	Not Available	502
3300015347|Ga0182177_1193901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	554
3300015347|Ga0182177_1212261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	535
3300015347|Ga0182177_1230323	Not Available	518
3300015351|Ga0182161_1078040	Not Available	814
3300015351|Ga0182161_1096137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	752
3300015351|Ga0182161_1247344	Not Available	518
3300015351|Ga0182161_1254831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	512
3300015355|Ga0182159_1118260	Not Available	801
3300015355|Ga0182159_1154780	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	717
3300015355|Ga0182159_1234562	Not Available	600
3300015355|Ga0182159_1241929	Not Available	592
3300015355|Ga0182159_1258041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	575
3300015355|Ga0182159_1258095	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	575
3300015355|Ga0182159_1291202	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	546
3300015355|Ga0182159_1305324	Not Available	534
3300015361|Ga0182145_1180779	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	515
3300015361|Ga0182145_1182900	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	513
3300017404|Ga0182203_1086357	Not Available	620
3300017404|Ga0182203_1148622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	519
3300017407|Ga0182220_1057582	Not Available	602
3300017407|Ga0182220_1082187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	545
3300017409|Ga0182204_1038679	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	707
3300017410|Ga0182207_1076846	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	665
3300017410|Ga0182207_1113634	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	585
3300017410|Ga0182207_1117710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	578
3300017411|Ga0182208_1089294	Not Available	566
3300017411|Ga0182208_1116565	Not Available	520
3300017413|Ga0182222_1054035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	603
3300017413|Ga0182222_1093824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	522
3300017415|Ga0182202_1085578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	589
3300017415|Ga0182202_1103898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	554
3300017417|Ga0182230_1052184	Not Available	719
3300017420|Ga0182228_1057438	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	677
3300017420|Ga0182228_1084221	Not Available	587
3300017424|Ga0182219_1039641	Not Available	744
3300017424|Ga0182219_1099637	Not Available	560
3300017424|Ga0182219_1122237	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	525
3300017424|Ga0182219_1123425	Not Available	523
3300017424|Ga0182219_1129137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	516
3300017424|Ga0182219_1136294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	507
3300017425|Ga0182224_1038470	Not Available	794
3300017425|Ga0182224_1045201	Not Available	757
3300017425|Ga0182224_1056398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	707
3300017425|Ga0182224_1120266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	559
3300017427|Ga0182190_1073707	Not Available	663
3300017427|Ga0182190_1147832	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	522
3300017430|Ga0182192_1041572	Not Available	819
3300017433|Ga0182206_1101085	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	582
3300017436|Ga0182209_1119211	Not Available	569
3300017438|Ga0182191_1073267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	683
3300017438|Ga0182191_1086784	Not Available	646
3300017442|Ga0182221_1065887	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	675
3300017442|Ga0182221_1066119	Not Available	674
3300017442|Ga0182221_1142857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	532
3300017442|Ga0182221_1151371	Not Available	522
3300017443|Ga0182193_1091654	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	655
3300017443|Ga0182193_1175219	Not Available	524
3300017443|Ga0182193_1183364	Not Available	515
3300017680|Ga0182233_1104194	Not Available	527
3300017681|Ga0182226_1063692	Not Available	674
3300017683|Ga0182218_1092298	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	589
3300017683|Ga0182218_1101266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	573
3300017683|Ga0182218_1120132	Not Available	543
3300017683|Ga0182218_1138468	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	519
3300017683|Ga0182218_1149352	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	507
3300017684|Ga0182225_1053299	Not Available	684
3300017684|Ga0182225_1089306	Not Available	584
3300017684|Ga0182225_1102073	Not Available	561
3300017684|Ga0182225_1110533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	547
3300017684|Ga0182225_1139344	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	508
3300017685|Ga0182227_1064027	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	670
3300017685|Ga0182227_1108625	Not Available	547
3300017686|Ga0182205_1067536	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	687
3300017686|Ga0182205_1075981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	661
3300017686|Ga0182205_1125915	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	559
3300017689|Ga0182231_1069085	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	669
3300017690|Ga0182223_1053280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	636
3300017690|Ga0182223_1102966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	530
3300017690|Ga0182223_1114076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	515
3300017690|Ga0182223_1115797	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	513

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.17%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.47%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.36%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.47%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.47%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.70%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.47%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.47%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068868_1018430252	3300005338	Miscanthus Rhizosphere	RCMTKCFGDLIGRTVEAYMDDIIVKSKQTDQLVADLEQTFRKL*
Ga0105243_131276123	3300009148	Miscanthus Rhizosphere	MLKCFKDLIGKTVEAYKDDIVVKSKQADQLVVDLEQTFMKL*
Ga0105246_123951602	3300011119	Miscanthus Rhizosphere	MLKCFNDLIGQTIEAYVDDIVVKSKWADQVIDDLEQ
Ga0157374_116340133	3300013296	Miscanthus Rhizosphere	MLNCFGDLIGWTIEAYVDDIIVKSKWAGHLVADLEQTFAKL*
Ga0157378_126412211	3300013297	Miscanthus Rhizosphere	MLKCFGDLIEQTIEAYVYDIMVKSKWADHLIADLEQTFAKL*
Ga0157376_122362442	3300014969	Miscanthus Rhizosphere	MLNCFGDLIGWTVEAYVNNIVVKSKRADHLVVDL*
Ga0182122_10618222	3300015267	Miscanthus Phyllosphere	MLKCFGDRIGQTVEAYIDDIVVKSKWANQLIADIEQTFTKL*
Ga0182122_10694443	3300015267	Miscanthus Phyllosphere	CFGDLIRQTVEAYVDDIMVKFKRADQVITDLEQTFAKL*
Ga0182154_10567002	3300015268	Miscanthus Phyllosphere	MTKCFGDLIGQTIEAYVDNIVVKSKYTNQLVADLEQTFRKL
Ga0182113_10821691	3300015269	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVDDIMVKSKLVDHLIADLE*
Ga0182113_10940071	3300015269	Miscanthus Phyllosphere	MLKCFKGLIGRTIEAYMDDIVVKSKWADRVIADLE*
Ga0182113_10962771	3300015269	Miscanthus Phyllosphere	MLKCFGNLIGWTIEAYVDDIIVKSEWADHFIADLEQTFAKL*
Ga0182188_10035221	3300015274	Miscanthus Phyllosphere	MLKCFEDLIGRTVEAYADDIVVKSKWADQVNANLEQTFAKL*
Ga0182188_10306541	3300015274	Miscanthus Phyllosphere	MLKCFRDLIRWTVEAYVDDIMVKSKWADHLIADLEQTFAKL*
Ga0182172_10289941	3300015275	Miscanthus Phyllosphere	MLNCFGDLIGRTVEAYIDDIVVKSKRADHLVADLEQTFAKL*
Ga0182172_10382503	3300015275	Miscanthus Phyllosphere	MTKCFGDLIGWTIEAYMDDIVVKSKQTDQLVVDLEQTFRKLQ*
Ga0182172_10715612	3300015275	Miscanthus Phyllosphere	MLRCFGDLIGQTIEAYVDDIVVKSKQVDHLVADLE*
Ga0182170_10104552	3300015276	Miscanthus Phyllosphere	MTKCFGDLIRWTIEAYVDDIVVKSKRTDQLMADLEQTFRKL*
Ga0182170_10329802	3300015276	Miscanthus Phyllosphere	MLKCFRDLIRRTVDAYVDDIVVKSKQANHLIADLEQTFAKL*
Ga0182128_10204302	3300015277	Miscanthus Phyllosphere	DLIGQTIEAYMDDTVVKSKCADQLVADLEQTFAKL*
Ga0182128_10344772	3300015277	Miscanthus Phyllosphere	MLKCFRDLIGQTVEGYVDDIMVKSKWADQVIANLE*
Ga0182128_10401452	3300015277	Miscanthus Phyllosphere	MLNYFGDLIGRTVEAYVDDIVVKSKRAEHLVANLEQTFVKL*
Ga0182128_10588411	3300015277	Miscanthus Phyllosphere	MLKCFGDLIKRTVVAYVDDIMVKSKWTDQLIDDLDRTFMK
Ga0182174_10406231	3300015279	Miscanthus Phyllosphere	LNYFGDLIGWNVEAYVDDIVVKSKWADHLVADLERTFAKL*
Ga0182160_10193842	3300015281	Miscanthus Phyllosphere	MTKCFGDLIRWTIEAYVDDIVVKSKQTDQLVANLE*
Ga0182160_10672591	3300015281	Miscanthus Phyllosphere	LIRWTVEAYVDDIMVKTKQANHLVADLEQTFAKL*
Ga0182160_10787092	3300015281	Miscanthus Phyllosphere	CFGDLIGRTIEAYIDDIVVKSKRADHLVADLEQTFAKL*
Ga0182160_10797942	3300015281	Miscanthus Phyllosphere	MLKSFRDLIRRIVEAYVDDIVVKSKWADHLIADLRQTFVKL*
Ga0182124_10193851	3300015282	Miscanthus Phyllosphere	MLKCFGDLIGQTIEVYVDDIMVKSKWTDQVIADLEQTFTKL*
Ga0182124_10438612	3300015282	Miscanthus Phyllosphere	MLKCFEDLIRWTIEAYIDDIVVKSKPTDQVIANLEQ
Ga0182156_10266292	3300015283	Miscanthus Phyllosphere	MLNCFRDLIGRTVEAYIDDIIVKSKRADHLVDVLEQTFAKL*
Ga0182156_10350932	3300015283	Miscanthus Phyllosphere	MLKCFRDLIGQTVEDYIDDIMVKSKRTDQLVADLEQTFTKLRANGIKL
Ga0182156_10478931	3300015283	Miscanthus Phyllosphere	MLKCFGDLIRQTVEAYINDIVVKSKWANQVVADLEQTFTKL*
Ga0182186_10602123	3300015285	Miscanthus Phyllosphere	CMLKCFGYLIGQTIEAYMDDIVVKFKQANKLIADLEQTFTKL*
Ga0182186_10614132	3300015285	Miscanthus Phyllosphere	VTQVFGEHIRRTIEAYMDDIMVKSKWADQVIADLGQTFTKH*
Ga0182176_10198961	3300015286	Miscanthus Phyllosphere	MLNCFGDLIGWTIEAYVDDIMVKTKWADHHVANLE*
Ga0182176_10606681	3300015286	Miscanthus Phyllosphere	MLKYFGDLIGQTVETYVDDIVVKSKRADQVIADLE*
Ga0182176_10675792	3300015286	Miscanthus Phyllosphere	MLKCFGDLIGWTIEAYMDDIVAKSKRADHLVADLEQTFTKL*
Ga0182171_10431281	3300015287	Miscanthus Phyllosphere	MLKFFGDLIGRTVEAYLDDIEVKSKWADQLVADLE
Ga0182171_10664201	3300015287	Miscanthus Phyllosphere	LLKCFRDLIGQTIEAYMDDIMIKSKQAYQVVADLEQTFTKV*
Ga0182171_10736412	3300015287	Miscanthus Phyllosphere	MLKCFGDLIGQTVEAYVDNIVVKSKWTDQVVADLEQTFTKL*
Ga0182173_10223301	3300015288	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVDDIMVKSKWTDQVIGDLDRTFVKL*
Ga0182173_10329951	3300015288	Miscanthus Phyllosphere	MLKCFGDLIGQTVKAYFDDIVVKSKATDQVIADLEQTFTKL*
Ga0182173_10481301	3300015288	Miscanthus Phyllosphere	YQHCMLKCFGNLIRWTIEAYVDNNVVKSKQADHLVADLE*
Ga0182138_10330232	3300015289	Miscanthus Phyllosphere	MLKCFGNLIGQTIEAYVGEIIVKSKHTDELVTDLELTFAKL*
Ga0182138_10539272	3300015289	Miscanthus Phyllosphere	MLKCFGDLIRWTVEAYIDDIVVKSEWADHLVAYLEQTFAKL*
Ga0182138_10799012	3300015289	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVNDIVVKSKWADHLVADLEQTFAKL*
Ga0182138_10831101	3300015289	Miscanthus Phyllosphere	MLKCFGDLIRRTIEAYIDDIVVMSKWTDQIIAYLE*
Ga0182125_10605791	3300015291	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYVDDIMVQSKWADQVVADLGQTFAKL*
Ga0182141_10206602	3300015292	Miscanthus Phyllosphere	MLKCFRDLIGHTIEAYVDDIMVKSKAIDQVVANLEQTFMKL*
Ga0182141_10382051	3300015292	Miscanthus Phyllosphere	MLKCFGDLIRQTIEAYVDDIMVKSKWADQLIADLEQTFVKL*
Ga0182126_10132423	3300015294	Miscanthus Phyllosphere	MLKCFGNLIGRTVEAYVDNIVVKSKWADKLVANLE
Ga0182126_10563321	3300015294	Miscanthus Phyllosphere	KCFGDLIRRTAEAYIDDIVVKSRWADHVVADLEQTFAKL*
Ga0182126_10976041	3300015294	Miscanthus Phyllosphere	MLKCFGDLIERTIEAYVDDIMIKSKWADRLVADLEQTFAKL*
Ga0182175_10135061	3300015295	Miscanthus Phyllosphere	MFRGLIRRTIEAYMDDIVVKSKRADQVIADLEQTFVKF*
Ga0182175_10603092	3300015295	Miscanthus Phyllosphere	MLKCFGDLIGQTVEAYVDDIVVKSKRTDHLIADLE
Ga0182175_10771261	3300015295	Miscanthus Phyllosphere	LKCFGDLIWWTVEAYVDDIVVKSKWADQVITNLEQTFVKL*
Ga0182157_11043582	3300015296	Miscanthus Phyllosphere	FRDLIKRTVEAYVDDIVVKSKWADHLVADLEQTFAKL*
Ga0182106_10085003	3300015298	Miscanthus Phyllosphere	MLKCFRDLIGRTIEAYIDDIVVKSKWADHLMTNLEQTFTKL*
Ga0182106_10177562	3300015298	Miscanthus Phyllosphere	MLKCFRDLIGQTVVAYVDDIVVKSKRADLAVANLEQTFPKTL
Ga0182106_10264741	3300015298	Miscanthus Phyllosphere	FEDLIRRTVEAYIDDIVVKSKQADHLIADLEQTFTKL*
Ga0182106_10704552	3300015298	Miscanthus Phyllosphere	MLKCFGDLIGWIIEGYVDDIVVKSKWAHQVVADLEQTFMKL*
Ga0182106_10957901	3300015298	Miscanthus Phyllosphere	MPKCFEDLIGWIVEAYVDYIMVKSKWADQVVADLE*
Ga0182107_10073691	3300015299	Miscanthus Phyllosphere	CFGDLIRRAVEAYVDDIVVKSKRAGHLVADLEQTFVKL*
Ga0182107_10182583	3300015299	Miscanthus Phyllosphere	MLKCFGDLIRQTVEAYMDDIVVISKWANQVIADLE*
Ga0182107_10975191	3300015299	Miscanthus Phyllosphere	MLKCFRDLIGRTIDAYVDDIVVKSKRADHLIADLEQTFAKL*
Ga0182108_10773001	3300015300	Miscanthus Phyllosphere	MSKCFGDLIRRTIEAYMDDIMIKPKRVDQVIDDLEQTFTKLRANNIK
Ga0182108_10795851	3300015300	Miscanthus Phyllosphere	MLKCFGDLIGWTIEANVDNIVVKSKWADHLITNLEQTFTKL*
Ga0182143_10423911	3300015302	Miscanthus Phyllosphere	CFGDLIGRTVEAYIDDIMVKSKLANHLIADLEQTFMKL*
Ga0182143_10500441	3300015302	Miscanthus Phyllosphere	MLKCFGDLIGQTIKAYVDDIMVKSKWADQLIANLEQTFAKL*
Ga0182143_10839763	3300015302	Miscanthus Phyllosphere	RYMLKCFRGLIRRTIEAYIDDIVVKSKWVDQVIADLE*
Ga0182123_10029551	3300015303	Miscanthus Phyllosphere	MTKCFGDLIGWTIEAYVDDIVVKSKCTNELVTDLELTFMKL*
Ga0182123_10568591	3300015303	Miscanthus Phyllosphere	MTKCFGDLIRQTIEAYVDNIVVKSKQTDQLVADLEQTFR
Ga0182123_10618601	3300015303	Miscanthus Phyllosphere	LKCFGDLIGQTIEAYMDEIVVKSKRADQVIADLEQTVKKL*
Ga0182123_10663341	3300015303	Miscanthus Phyllosphere	MLKCFEDLIGQTIEAYVDDIMVKSKQTDQLIANLE*
Ga0182123_10842652	3300015303	Miscanthus Phyllosphere	MLKCFRDLIKRTVEAYIYHIMVKSKRMDQLIDDLE*
Ga0182123_10989181	3300015303	Miscanthus Phyllosphere	MLKCFRDLLRQTIEAYMYDIVVKSKWADQVVADLEQTFAKL*
Ga0182112_10366082	3300015304	Miscanthus Phyllosphere	MLKCFGNLIGRTIEAYIDDIMVKSEWADHFIADLEQTFAKL*
Ga0182112_10447441	3300015304	Miscanthus Phyllosphere	MLKCFGDLIGRTVGAYIDDIVVKSKRIDQLVDDLE*
Ga0182112_10504112	3300015304	Miscanthus Phyllosphere	GDLIGRTIEAYVDDIMVKSKRADHLVADLEQTFAKL*
Ga0182112_10521302	3300015304	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVGDIVVKSKQADQVVADLEQTFTKLRA
Ga0182112_11006131	3300015304	Miscanthus Phyllosphere	MLKSFRDLIGRTVEAYVDDIMVKSKWADQVVADLEQTFAKL*
Ga0182158_10211751	3300015305	Miscanthus Phyllosphere	MLKCFGDLIGWTIEAYVDDIVVKSKWADQVIADLE*
Ga0182158_10494751	3300015305	Miscanthus Phyllosphere	MLNCFEDLIKWTIEAYVDNIMVKSKQANHLVADLEQTFAKL*
Ga0182158_10554921	3300015305	Miscanthus Phyllosphere	MTKCFGDLIRWTIEAYVDDIVVKSKQIDQLVADLE*
Ga0182158_10624102	3300015305	Miscanthus Phyllosphere	MLKCFGDLIEHTVEAYIDDIVVKSKRADHLVADLEQTFAKL*
Ga0182144_10877971	3300015307	Miscanthus Phyllosphere	MDLIGWTVEAYVDDIVVKSKWADQLIADLEQTFVKL*
Ga0182142_10661661	3300015308	Miscanthus Phyllosphere	MLKCFGDLIGRTVVAYVDDIVVKSKWDDQVIANLEQTFTKL*
Ga0182140_10451071	3300015314	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYIDDIVVKSKWVDQLIADLE*
Ga0182140_10720291	3300015314	Miscanthus Phyllosphere	MTKCFGDLLGRTIEAYMDDIIVKSKQTDQLMVDLEPTFMKL*
Ga0182140_10751072	3300015314	Miscanthus Phyllosphere	RCMLKCFRDLIERTIVAYVGNIGVKCRWADHLVADLEETYAKL*
Ga0182140_10846181	3300015314	Miscanthus Phyllosphere	CILKCLRDLIGRTVEAYVDDIVVKSKWADHLLANLVQTFAKI*
Ga0182140_11020741	3300015314	Miscanthus Phyllosphere	MLKCFGDLIEWTVEAYVDDIVVKSKWADQIVANLEQTFAKL*
Ga0182127_10357621	3300015321	Miscanthus Phyllosphere	MLKCFGDLIGRTIGAYVDDIVVKSKWTDQLVHDLEQTFSKL*
Ga0182127_10576011	3300015321	Miscanthus Phyllosphere	MLKCFRDLIGWTVEAYIDDIIVKSKWANHLVANLE*
Ga0182127_10669022	3300015321	Miscanthus Phyllosphere	MLKCFGDLIGRTVETYVDDILIKSKWADQVIADLEQTFMKL*
Ga0182127_10727932	3300015321	Miscanthus Phyllosphere	MLKCFRDLIGQTIEAYIDDIIVKSKWVDHLIADLE*
Ga0182127_11069131	3300015321	Miscanthus Phyllosphere	MLKCFRDLIGQTFEAYVDDIMVKSKWADHLLANLVQTFAKL*
Ga0182110_10236383	3300015322	Miscanthus Phyllosphere	MLKCFGDLIRWTVEAYVDDIVVKSKQAGHLVANLEQTFAKL*
Ga0182110_10324891	3300015322	Miscanthus Phyllosphere	MIKCFGNLIGRTIEAYMDDIVVRSMQAENLIADLELT
Ga0182110_10586311	3300015322	Miscanthus Phyllosphere	KCFKDLIGWTIEAYVDDIMVKSKWADHLVADLEQTFTKL*
Ga0182110_10935132	3300015322	Miscanthus Phyllosphere	MLKCFGDLIGQTIDAYIDDIMVMSKWADQLVADLEQTFMKL*
Ga0182129_10607881	3300015323	Miscanthus Phyllosphere	MLKCFGDLIERTIEVYVDDIVVKSKWADEVMVDIE*
Ga0182129_10724782	3300015323	Miscanthus Phyllosphere	MLKCFRDLIGRTVEAYVNDIVVKSKRADQVIADLEQTFAKL*
Ga0182129_10760152	3300015323	Miscanthus Phyllosphere	MLRCFGDLIGRTVEAYVDDIVVKSKRADHLVADLKQ
Ga0182135_11555451	3300015329	Switchgrass Phyllosphere	MIKCFGDLIRRTVEAYVNDIVAKTKQAGRLVAGLELTF
Ga0182187_10793573	3300015341	Miscanthus Phyllosphere	MIKCFRDLMGWTVEAYVDNIVVKSKQTDQLMADLEQTFKKL*
Ga0182187_11002703	3300015341	Miscanthus Phyllosphere	CCMPKCFEDLIGWIVEAYVDYIMVKSKWADQVVADLE*
Ga0182187_11142171	3300015341	Miscanthus Phyllosphere	MLKCFGDLIWRTVEANVDDIVVKSKQADHLVADLEQTFAKL*
Ga0182187_11281583	3300015341	Miscanthus Phyllosphere	MLKCFGDLIGRTVAAYVDNIVVKSKWADHLIADLEQTFAKL*
Ga0182187_11846692	3300015341	Miscanthus Phyllosphere	MTKCFGDLIERTVEAYVDNIVVKSKQTNQLMADLE*
Ga0182155_10321092	3300015343	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVDDIGVKSKWTDQLVDDLE*
Ga0182155_10615612	3300015343	Miscanthus Phyllosphere	MTKCFGDLLGRTVEAYMDDIIVKSKQTDQLMVDLEPTFMKL*
Ga0182155_11081132	3300015343	Miscanthus Phyllosphere	MLKYFRDLIGQTVEAYMDDIVVKSKWANQIIANLEQTFAKL*
Ga0182155_11304991	3300015343	Miscanthus Phyllosphere	MLKCFKDLIRRTIEAYVDDIVVKSKWADQVMVNLEQTFMKL*
Ga0182155_11425301	3300015343	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYIDDIVVKSKRADHLIADLE*
Ga0182189_10369312	3300015344	Miscanthus Phyllosphere	MLKCFGDLIGQTIEAYVDNIMIKSKRADQLIADLKQTFVIL*
Ga0182189_11003902	3300015344	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYVDNIMVKSKRADQLVADLEQTFAKL*
Ga0182189_11177662	3300015344	Miscanthus Phyllosphere	MPKCFGDLIGETIKAYVDDIVVKTKRANQLMADLKRTFEKL*
Ga0182189_11324111	3300015344	Miscanthus Phyllosphere	MLKCFGNLIGQTIEAYVGEIIVKSKHTDELVTDLELTFVKL*
Ga0182189_11487352	3300015344	Miscanthus Phyllosphere	MLKCFGNLIGRTIEAYMDDIVVRSMQAENLIADLELTFERLKKYCIKLN
Ga0182189_11909701	3300015344	Miscanthus Phyllosphere	MTKCFGDLIRQTVEAYVDDIVVKTKQTIQLMANLEQTFKKL*
Ga0182189_12092121	3300015344	Miscanthus Phyllosphere	MLRCFGDLIGWTIEAYIDDIVVKSKRVDHLVADLEQTFTKL*
Ga0182189_12099511	3300015344	Miscanthus Phyllosphere	LRCFGDLIGWTVEAYVDNIIVMSKRADHLVANLEQTFAKL*
Ga0182111_10409823	3300015345	Miscanthus Phyllosphere	MLKCFRDLIRRTVEAYVDNIMVKSKWANRLVANLE
Ga0182111_11177821	3300015345	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYVDDIVVKSKWVDQVVADLE*
Ga0182111_12054732	3300015345	Miscanthus Phyllosphere	FEDLIKWTIEAYVDNIMVKSKQANHLVADLEQTFAKL*
Ga0182111_12304941	3300015345	Miscanthus Phyllosphere	MLRCFGDLIGRTVGAYVDDIVVKSKWDDHLVADLEQTF
Ga0182111_12448131	3300015345	Miscanthus Phyllosphere	MLKCFGELIGQTVEAYVDDIMVKSKLTDQVIADLE*
Ga0182139_11690942	3300015346	Miscanthus Phyllosphere	MLKCFRDLIGQTVEAYVDDIVVKSKQADQVVANLE*
Ga0182139_12407381	3300015346	Miscanthus Phyllosphere	MLKCFDDLIRPTIEAYIDDIVVKSKQANHLITDLEQTFTKL*
Ga0182139_12445192	3300015346	Miscanthus Phyllosphere	MLRCFGDLIGETVEAYVDDIVVKSKRADQLVADLE
Ga0182177_11939011	3300015347	Miscanthus Phyllosphere	MLKCFGNLIGRTIEAYVDDIVVRSMQAKNLIADLELTF
Ga0182177_12122612	3300015347	Miscanthus Phyllosphere	MPNYFGGLIGRIIEVYVDDIIVKSKRADHLIADLKQTFTKL
Ga0182177_12303232	3300015347	Miscanthus Phyllosphere	MLKCFRDLIRQTIEAYVDDIMVKSKWTDQVIAGLEQTFVKL*
Ga0182161_10780402	3300015351	Miscanthus Phyllosphere	MLKCFGDLIGQTVEAYIDDIMVKSKQADHLVTDLKQTFTKL*
Ga0182161_10961371	3300015351	Miscanthus Phyllosphere	MLKCFGGLIGRTIKAYMDDIVVKSKRVDQVIADLEQTFTKL*
Ga0182161_12473441	3300015351	Miscanthus Phyllosphere	MLKCFRDLIEWTVEAYVDDIVVKSNWADHLIANLEQTFTKL*
Ga0182161_12548311	3300015351	Miscanthus Phyllosphere	YQHCMLKCFGDLIRWTIEAYVDDIMVKSKWADQLIANLEQTFTKL*
Ga0182159_11182601	3300015355	Miscanthus Phyllosphere	MLKCFGNLIDQIVEAYVDDIVVKSKCTDELVTDLELTFAKL*
Ga0182159_11547802	3300015355	Miscanthus Phyllosphere	CMLKCFGDLIGRTIEAYVDDIMVKSKPIDQVIADLE*
Ga0182159_12345622	3300015355	Miscanthus Phyllosphere	MLKCFGDLIRRTVEAYVDDIVVKSKLVDHLIADLE*
Ga0182159_12419291	3300015355	Miscanthus Phyllosphere	MVKCFRDLIGRIVEAYVDDIMVKFKWANQVVANLEQTLVKL*
Ga0182159_12580411	3300015355	Miscanthus Phyllosphere	MLKCFEDLIGWTIEAYVDDIVVKSKWADHLVANSEQTFAKL*
Ga0182159_12580952	3300015355	Miscanthus Phyllosphere	MLKCFRDLIGQTVEAYVDDIMVKSKWANQVTADLEQTFAKL*
Ga0182159_12912022	3300015355	Miscanthus Phyllosphere	MLKCFRDLIVWTVEAYIDDIMVKSKWADQVMADLEQTFVKL*
Ga0182159_13053242	3300015355	Miscanthus Phyllosphere	MLNCFGDLIGQTVEAYVNNIVVKSKQADHLVADLE*
Ga0182145_11807793	3300015361	Miscanthus Phyllosphere	LKCFGDLIGRTVEAYIDDIMVKSKWVDHLVVDLEQTFAKL*
Ga0182145_11829001	3300015361	Miscanthus Phyllosphere	MLKCFGDVIGWTIEAYIDNIVVKSKWADQLIADLE*
Ga0182203_10863572	3300017404	Miscanthus Phyllosphere	DLIWRTVEAYLDDIMVKSKQANHLIADLELTFAKL
Ga0182203_11486221	3300017404	Miscanthus Phyllosphere	QHCMLNCFGDLIRRTIEVYVDDIIVKSKQTDHLVADLEQTFAKL
Ga0182220_10575821	3300017407	Miscanthus Phyllosphere	MLKCFGDLIRQTVEAYVDDIVVKTKWADQLVADLEQTSMKL
Ga0182220_10821871	3300017407	Miscanthus Phyllosphere	KCFRDLIGWTVEAYVDHIVVKSKWADHLVADLEQTFVKL
Ga0182204_10386792	3300017409	Miscanthus Phyllosphere	CMLKCFGDLIGRTVEAYVDDIMVKSKHADQVIADLGQTFMKL
Ga0182207_10768462	3300017410	Miscanthus Phyllosphere	MLKCFGDLIRQTVEAYINDIVVKSKWANQVVADLEQTFTKL
Ga0182207_11136341	3300017410	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVDDIMVKSKLVDHLIADLE
Ga0182207_11177101	3300017410	Miscanthus Phyllosphere	TYQCCMLKCFGDLIGQTIDAYMDDIMVKSKWVDQLIADLEQTFAKL
Ga0182208_10892942	3300017411	Miscanthus Phyllosphere	MLKCFGDLIGQTVEAYVDNIVVRSKWADQLIANLEQTFTKL
Ga0182208_11165652	3300017411	Miscanthus Phyllosphere	MLKCFKDLIGRTVEAYIDDIVVKSKWVDHVVTDLEQTFAKL
Ga0182222_10540351	3300017413	Miscanthus Phyllosphere	MLKCFRDLIGRTVEAYMDDIVVKSKRDDQVIADLEQTFVKL
Ga0182222_10938241	3300017413	Miscanthus Phyllosphere	MLKCFEDLIGQTIEAYVDDIVVKSKWANQVIADLEQTFSKL
Ga0182202_10855781	3300017415	Miscanthus Phyllosphere	RCMLNCFRDLIGRTIEDYVDDIIVKSKWADHLVVDLEQTFAKL
Ga0182202_11038983	3300017415	Miscanthus Phyllosphere	YQCCMLKCFGDLIGETVETNVDDIVVKSKRADQVISDLEQTIVKL
Ga0182230_10521841	3300017417	Miscanthus Phyllosphere	MLKCFRDLIGRTIEAYVDNIVVKSKQADHLVADLEQTFSKL
Ga0182228_10574383	3300017420	Miscanthus Phyllosphere	FGDLIGRTVESYVDDIVVKSKQVDQLVADLEQTFTKL
Ga0182228_10842212	3300017420	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVGDIVVKSKQADQVVADLEQTFAKL
Ga0182219_10396411	3300017424	Miscanthus Phyllosphere	MLKCFRDLIGQTIEAYVDDIVVKSKWADQVIADLE
Ga0182219_10996371	3300017424	Miscanthus Phyllosphere	DLIGRTVEAYVDNIVVKSKQTDQLMADLEQTFKKL
Ga0182219_11222373	3300017424	Miscanthus Phyllosphere	CCMLKCFGDLIGQIVDACMDDIVVKSKWVDQLIADLEQTFAKL
Ga0182219_11234252	3300017424	Miscanthus Phyllosphere	LKCLEDLIEQTIEAYIDDIVVKSKWADQVVANLDQTFVKL
Ga0182219_11291372	3300017424	Miscanthus Phyllosphere	MLKCFGNLIGRTVEAYVDDIVVKSKLADHLIANLE
Ga0182219_11362941	3300017424	Miscanthus Phyllosphere	DLIGRTVDAYVDDIMVKSKQVEHLVANLEQTFAKL
Ga0182224_10384702	3300017425	Miscanthus Phyllosphere	MLKYFGYLIRRTIEAYVDDIVVMYKWADQVVADLEQTFTKL
Ga0182224_10452012	3300017425	Miscanthus Phyllosphere	MLKCFKDLIGQTVEAYKDDIVVKSKQADQLVVDLEQTFVKL
Ga0182224_10563982	3300017425	Miscanthus Phyllosphere	MLKCFGNLIGQTVEAYVDDIVVKSKHTDKLVTDHELTFTKL
Ga0182224_11202661	3300017425	Miscanthus Phyllosphere	YMLKCFGDLIGQTVEAYMDDIMVKSKWVDQVIVDLNRPS
Ga0182190_10737072	3300017427	Miscanthus Phyllosphere	LGGPETNLCGDLIERTIEAYVDDIVVKSKQTNQLVADLEQTFRKL
Ga0182190_11478322	3300017427	Miscanthus Phyllosphere	MTKCFGDLIGRTVEAYVDDIVVKSKQIDQLMADLE
Ga0182192_10415722	3300017430	Miscanthus Phyllosphere	MLKCFGDLIGRTVGAYIDDIVVKSKWTDQLVVDLE
Ga0182206_11010852	3300017433	Miscanthus Phyllosphere	MLKCFGDLIGWTVEAYVDDIVVKSNWADQVVADLE
Ga0182209_11192112	3300017436	Miscanthus Phyllosphere	CFGNLVGQTIEAYVDEIIVKSKHTNELVTDLELTFVKL
Ga0182191_10732671	3300017438	Miscanthus Phyllosphere	MLKCFRDLIGRTIETYVDDIVVKSKWADQVIADLE
Ga0182191_10867841	3300017438	Miscanthus Phyllosphere	MLKCFEDLIGRTIEAYIDDIVVKSKCANQVIADLEQTFTKL
Ga0182221_10658872	3300017442	Miscanthus Phyllosphere	MFRGLIGRTIEAYVDDIMVKSKRADQVIADLEQTFAKL
Ga0182221_10661191	3300017442	Miscanthus Phyllosphere	LKCFGDLIGQTIEAYMDDIVVKSKWADQVVADLEQTFAKL
Ga0182221_11428572	3300017442	Miscanthus Phyllosphere	LKCFRDLIGRTIKAYVDDIVVKSKRANHLIADLEQTFTKL
Ga0182221_11513711	3300017442	Miscanthus Phyllosphere	KCFRDLIRRTIKAYVDDIVVKSKQINQLMTDLEQTFNKL
Ga0182193_10916541	3300017443	Miscanthus Phyllosphere	MLKYFGNLIGQTIEAYVDDIVVKSKRTDQLMADLEQTFRKL
Ga0182193_11752191	3300017443	Miscanthus Phyllosphere	MLKCFGDLIGQTIYAYVDDIMVNSKWVDQVIADLEQTFTKL
Ga0182193_11833641	3300017443	Miscanthus Phyllosphere	QRYMLKCFGDLIRQTIEAYVGDIVVKSKQADQVIADLEQTFAKL
Ga0182233_11041941	3300017680	Miscanthus Phyllosphere	MLRCFGDLIGWTIEAYIDDIIVKSKWADHLIADLE
Ga0182226_10636922	3300017681	Miscanthus Phyllosphere	MLKCFGDLIGWTVEAYIDDIVVKSKWANHLVANLKQTFAKL
Ga0182218_10922982	3300017683	Miscanthus Phyllosphere	MLKCFGDLIGRTIKAYVDDIMVKSKRVDQVVADLEQTFAKL
Ga0182218_11012662	3300017683	Miscanthus Phyllosphere	LGGPETNLCGDLIERTIEAYVDDIIVKSKQTDQLVADLEQTFRKL
Ga0182218_11201321	3300017683	Miscanthus Phyllosphere	MLKCFGDLIRQIIEAYVDDIMVKSKWADQLIADLEQTFAKL
Ga0182218_11384682	3300017683	Miscanthus Phyllosphere	MLKCFEDLIGRTVEANVDDIVVKSKRANQLIADLE
Ga0182218_11493523	3300017683	Miscanthus Phyllosphere	MLKCFRDHIGRTVEAYVDDIMVKSKWVGHLVADLEQTFTKL
Ga0182225_10532991	3300017684	Miscanthus Phyllosphere	MTKCFGDLLGRTIEAYMDDIIVKSKQTDQLMVDLEPTFMKL
Ga0182225_10893062	3300017684	Miscanthus Phyllosphere	YQCCMLKCFRDLIRQTIEAYIDDIVVKSKWADQVIADLEQTFMKL
Ga0182225_11020731	3300017684	Miscanthus Phyllosphere	MLKCFGDIIGWTIEAYIDDIVVKSKPADQVMADLE
Ga0182225_11105331	3300017684	Miscanthus Phyllosphere	QRSMLKCFGDVIGWIVEDYMDDIVVKSKWADQLVADLEQTFAKL
Ga0182225_11393442	3300017684	Miscanthus Phyllosphere	FRNLIEQTVEANVDNIVVKSKWANHLIADLGQTFVKL
Ga0182227_10640271	3300017685	Miscanthus Phyllosphere	MLKCFGDLIGRTVDAYVDDIVVKSKRADQVIADLK
Ga0182227_11086251	3300017685	Miscanthus Phyllosphere	MLKCFGDLIERTVEANINDIMVKSKQADHLIADLEQTFAKL
Ga0182205_10675361	3300017686	Miscanthus Phyllosphere	MLRCFRDLIGRTVEAYIDDIVVKSKWADLLIADLEQTFAKL
Ga0182205_10759812	3300017686	Miscanthus Phyllosphere	MTKCFGDLIRRTVEAYVDDIVAKSKRTDQLMADLEQTFRKL
Ga0182205_11259152	3300017686	Miscanthus Phyllosphere	MLKCFEDLIRRTVEAYVDDIMVKSKWADLVIADLEQTFAKL
Ga0182231_10690852	3300017689	Miscanthus Phyllosphere	MLKCFRDLIGWTVDAYVDDIVVKSKRADHLVADLEQTFAKL
Ga0182223_10532802	3300017690	Miscanthus Phyllosphere	MLKCFGDLIERTIEAYVDDIMVKSKWVDHLVADLE
Ga0182223_11029661	3300017690	Miscanthus Phyllosphere	MLKCFGDLIGWTIEAYIDNIVVKSKWADQLIANLE
Ga0182223_11140762	3300017690	Miscanthus Phyllosphere	MLNYFGDLIRRTIEAYIDDIVVKSKQADHLVADLEKTFAKL
Ga0182223_11157971	3300017690	Miscanthus Phyllosphere	FKDLIGWTIEAYVDDIVVKSKRANHLVADLEQTFEKL