NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022758

Metagenome / Metatranscriptome Family F022758

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022758
Family Type Metagenome / Metatranscriptome
Number of Sequences 213
Average Sequence Length 60 residues
Representative Sequence MALPATGSTISMGTVRNYFGLSGTISLSTLGNYISPSVTTNIKLSATFGGWQNPNSTGSS
Number of Associated Samples 155
Number of Associated Scaffolds 213

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.36 %
% of genes near scaffold ends (potentially truncated) 23.94 %
% of genes from short scaffolds (< 2000 bps) 69.95 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.850 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(20.657 % of family members)
Environment Ontology (ENVO) Unclassified
(58.216 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.732 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.73%    β-sheet: 0.00%    Coil/Unstructured: 77.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 213 Family Scaffolds
PF13884Peptidase_S74 47.42
PF00293NUDIX 7.04
PF03452Anp1 1.88
PF16778Phage_tail_APC 1.41
PF05992SbmA_BacA 0.94
PF07733DNA_pol3_alpha 0.47
PF07068Gp23 0.47
PF16724T4-gp15_tss 0.47
PF13847Methyltransf_31 0.47
PF01391Collagen 0.47
PF03237Terminase_6N 0.47
PF07230Portal_Gp20 0.47
PF08722Tn7_TnsA-like_N 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 213 Family Scaffolds
COG0587DNA polymerase III, alpha subunitReplication, recombination and repair [L] 0.47
COG2176DNA polymerase III, alpha subunit (gram-positive type)Replication, recombination and repair [L] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.63 %
UnclassifiedrootN/A17.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10001256All Organisms → cellular organisms → Bacteria20705Open in IMG/M
3300000101|DelMOSum2010_c10075310Not Available1527Open in IMG/M
3300000225|SI34jun09_120mDRAFT_1065673Not Available634Open in IMG/M
3300000254|SI34jun09_100mDRAFT_1003372All Organisms → cellular organisms → Bacteria5430Open in IMG/M
3300000928|OpTDRAFT_10085560All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300000928|OpTDRAFT_10189772All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561396Open in IMG/M
3300001834|ACM2_1000712All Organisms → Viruses852Open in IMG/M
3300001846|ACM22_1048132All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156683Open in IMG/M
3300001846|ACM22_1124265All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561957Open in IMG/M
3300003216|JGI26079J46598_1091157All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156560Open in IMG/M
3300003539|FS891DNA_10577143Not Available511Open in IMG/M
3300003540|FS896DNA_10807173Not Available675Open in IMG/M
3300004097|Ga0055584_100387929All Organisms → Viruses → Predicted Viral1444Open in IMG/M
3300004097|Ga0055584_100481411All Organisms → Viruses → Predicted Viral1290Open in IMG/M
3300005402|Ga0066855_10063065All Organisms → Viruses → Predicted Viral1135Open in IMG/M
3300005404|Ga0066856_10000476All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED15614902Open in IMG/M
3300005837|Ga0078893_11744872All Organisms → cellular organisms → Bacteria1776Open in IMG/M
3300005837|Ga0078893_11798578All Organisms → Viruses6604Open in IMG/M
3300005941|Ga0070743_10099174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156979Open in IMG/M
3300005941|Ga0070743_10204007Not Available648Open in IMG/M
3300006011|Ga0066373_10212131Not Available565Open in IMG/M
3300006164|Ga0075441_10021093All Organisms → Viruses → Predicted Viral2694Open in IMG/M
3300006164|Ga0075441_10081707All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561251Open in IMG/M
3300006164|Ga0075441_10173500Not Available808Open in IMG/M
3300006164|Ga0075441_10206081Not Available731Open in IMG/M
3300006164|Ga0075441_10231564All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156683Open in IMG/M
3300006165|Ga0075443_10074799All Organisms → Viruses → Predicted Viral1151Open in IMG/M
3300006191|Ga0075447_10018239All Organisms → Viruses → Predicted Viral2812Open in IMG/M
3300006191|Ga0075447_10074693All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561205Open in IMG/M
3300006334|Ga0099675_1036189All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561703Open in IMG/M
3300006484|Ga0070744_10000022Not Available41610Open in IMG/M
3300006484|Ga0070744_10013752All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562401Open in IMG/M
3300006735|Ga0098038_1006217All Organisms → Viruses → Predicted Viral4842Open in IMG/M
3300006752|Ga0098048_1000020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales108488Open in IMG/M
3300006752|Ga0098048_1041933All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561458Open in IMG/M
3300006789|Ga0098054_1128525All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156941Open in IMG/M
3300006793|Ga0098055_1005138All Organisms → cellular organisms → Bacteria → Proteobacteria6331Open in IMG/M
3300006793|Ga0098055_1235914All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156690Open in IMG/M
3300006902|Ga0066372_10079542All Organisms → Viruses → Predicted Viral1657Open in IMG/M
3300006902|Ga0066372_10219418All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561048Open in IMG/M
3300006902|Ga0066372_10957334Not Available522Open in IMG/M
3300006924|Ga0098051_1010080All Organisms → Viruses → Predicted Viral2891Open in IMG/M
3300006947|Ga0075444_10006118All Organisms → cellular organisms → Bacteria → Proteobacteria6911Open in IMG/M
3300006947|Ga0075444_10416262Not Available503Open in IMG/M
3300007623|Ga0102948_1003043Not Available6390Open in IMG/M
3300007637|Ga0102906_1182908Not Available566Open in IMG/M
3300007651|Ga0102900_1004843All Organisms → Viruses → Predicted Viral2958Open in IMG/M
3300007758|Ga0105668_1042520Not Available1857Open in IMG/M
3300008050|Ga0098052_1110305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → unclassified Cellulomonadaceae → Cellulomonadaceae bacterium TMED981114Open in IMG/M
3300008938|Ga0103741_1094628All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156601Open in IMG/M
3300008954|Ga0115650_1329937All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156778Open in IMG/M
3300008961|Ga0102887_1002243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1568393Open in IMG/M
3300008961|Ga0102887_1093322Not Available955Open in IMG/M
3300008993|Ga0104258_1023916All Organisms → Viruses → Predicted Viral1141Open in IMG/M
3300008993|Ga0104258_1036748All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156919Open in IMG/M
3300009049|Ga0102911_1230264All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156521Open in IMG/M
3300009079|Ga0102814_10065937All Organisms → Viruses → Predicted Viral1993Open in IMG/M
3300009080|Ga0102815_10017879All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1563966Open in IMG/M
3300009086|Ga0102812_10569500All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium DOLZORAL124_38_8620Open in IMG/M
3300009130|Ga0118729_1043848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562619Open in IMG/M
3300009130|Ga0118729_1090721All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561517Open in IMG/M
3300009130|Ga0118729_1105389All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561360Open in IMG/M
3300009420|Ga0114994_10020806All Organisms → cellular organisms → Bacteria → Proteobacteria4617Open in IMG/M
3300009420|Ga0114994_10581880All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156735Open in IMG/M
3300009420|Ga0114994_10582127All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156734Open in IMG/M
3300009436|Ga0115008_10045085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED2143441Open in IMG/M
3300009436|Ga0115008_10446948All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156920Open in IMG/M
3300009436|Ga0115008_10828301All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156680Open in IMG/M
3300009481|Ga0114932_10118507All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1641Open in IMG/M
3300009592|Ga0115101_1120264All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561471Open in IMG/M
3300009593|Ga0115011_10290646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M1239Open in IMG/M
3300009593|Ga0115011_11029350All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156699Open in IMG/M
3300009599|Ga0115103_1546179All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1565200Open in IMG/M
3300009606|Ga0115102_10192643All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562967Open in IMG/M
3300009677|Ga0115104_10586224Not Available536Open in IMG/M
3300010149|Ga0098049_1049322All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561345Open in IMG/M
3300010151|Ga0098061_1013944All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1563398Open in IMG/M
3300011312|Ga0138349_1044089All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156604Open in IMG/M
3300012412|Ga0138266_1173455All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561031Open in IMG/M
3300012525|Ga0129353_1953114All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562197Open in IMG/M
3300012920|Ga0160423_10581390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage759Open in IMG/M
3300012920|Ga0160423_10956721Not Available574Open in IMG/M
3300012935|Ga0138257_1112380All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156845Open in IMG/M
3300012954|Ga0163111_10224041All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561636Open in IMG/M
3300013113|Ga0171647_1140333All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300016751|Ga0182062_1132712All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156706Open in IMG/M
3300017706|Ga0181377_1000110All Organisms → cellular organisms → Bacteria → Proteobacteria32085Open in IMG/M
3300017706|Ga0181377_1009492All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562381Open in IMG/M
3300017729|Ga0181396_1016843All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1455Open in IMG/M
3300017737|Ga0187218_1106322Not Available672Open in IMG/M
3300017786|Ga0181424_10001614All Organisms → cellular organisms → Bacteria → Proteobacteria10244Open in IMG/M
3300017950|Ga0181607_10122277All Organisms → Viruses → Predicted Viral1613Open in IMG/M
3300017950|Ga0181607_10669212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300017956|Ga0181580_10535198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M762Open in IMG/M
3300019200|Ga0180036_1105562All Organisms → Viruses → Predicted Viral1463Open in IMG/M
3300019261|Ga0182097_1241749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M924Open in IMG/M
3300020173|Ga0181602_10284397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M691Open in IMG/M
3300020298|Ga0211657_1077419Not Available631Open in IMG/M
3300020335|Ga0211690_1035789All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561189Open in IMG/M
3300020336|Ga0211510_1137074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes546Open in IMG/M
3300020368|Ga0211674_10120573Not Available682Open in IMG/M
3300020375|Ga0211656_10003645All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1566852Open in IMG/M
3300020377|Ga0211647_10039790All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561772Open in IMG/M
3300020377|Ga0211647_10061987All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561346Open in IMG/M
3300020379|Ga0211652_10015500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M2284Open in IMG/M
3300020383|Ga0211646_10131485Not Available906Open in IMG/M
3300020389|Ga0211680_10059515All Organisms → Viruses → Predicted Viral1706Open in IMG/M
3300020389|Ga0211680_10278857All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156623Open in IMG/M
3300020391|Ga0211675_10063013All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561759Open in IMG/M
3300020394|Ga0211497_10136588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156967Open in IMG/M
3300020407|Ga0211575_10006344All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1565315Open in IMG/M
3300020414|Ga0211523_10043606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M1940Open in IMG/M
3300020438|Ga0211576_10070303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561967Open in IMG/M
3300020463|Ga0211676_10124434All Organisms → Viruses → Predicted Viral1659Open in IMG/M
3300020463|Ga0211676_10673403All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156517Open in IMG/M
3300020469|Ga0211577_10252940All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561134Open in IMG/M
3300021065|Ga0206686_1205760All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156563Open in IMG/M
3300021068|Ga0206684_1094638All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1013Open in IMG/M
3300021068|Ga0206684_1221264All Organisms → Viruses606Open in IMG/M
3300021085|Ga0206677_10000800All Organisms → cellular organisms → Bacteria → Proteobacteria29997Open in IMG/M
3300021085|Ga0206677_10005260All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED15610249Open in IMG/M
3300021085|Ga0206677_10005398All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED15610077Open in IMG/M
3300021085|Ga0206677_10039989All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562532Open in IMG/M
3300021085|Ga0206677_10255530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156721Open in IMG/M
3300021169|Ga0206687_1832193All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562655Open in IMG/M
3300021323|Ga0210295_1063447All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561475Open in IMG/M
3300021334|Ga0206696_1298459All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156646Open in IMG/M
3300021342|Ga0206691_1001161All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156991Open in IMG/M
3300021365|Ga0206123_10175213All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156968Open in IMG/M
3300021368|Ga0213860_10169428All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156963Open in IMG/M
3300021368|Ga0213860_10171135All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156958Open in IMG/M
3300021373|Ga0213865_10445393All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156564Open in IMG/M
3300021375|Ga0213869_10000471Not Available33223Open in IMG/M
3300021375|Ga0213869_10001809All Organisms → cellular organisms → Bacteria15443Open in IMG/M
3300021378|Ga0213861_10239513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156964Open in IMG/M
3300022074|Ga0224906_1008397All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1564109Open in IMG/M
(restricted) 3300022920|Ga0233426_10000363Not Available49750Open in IMG/M
3300023566|Ga0228679_1005153All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561238Open in IMG/M
3300023567|Ga0228694_100969All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562687Open in IMG/M
3300023685|Ga0228686_1042004All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156628Open in IMG/M
3300023693|Ga0232112_1001948All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562159Open in IMG/M
3300024191|Ga0228636_1110353All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156618Open in IMG/M
3300024229|Ga0233402_1038720Not Available1021Open in IMG/M
(restricted) 3300024264|Ga0233444_10172869All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561023Open in IMG/M
3300024281|Ga0228610_1042639All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156618Open in IMG/M
3300024314|Ga0228657_1053184All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium870Open in IMG/M
3300024315|Ga0228618_1062833All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium615Open in IMG/M
3300024320|Ga0233398_1004759All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1564465Open in IMG/M
3300024322|Ga0228656_1046563All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156972Open in IMG/M
3300024346|Ga0244775_10005104All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED15613395Open in IMG/M
3300024346|Ga0244775_10138709All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562055Open in IMG/M
3300024348|Ga0244776_10043348All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1563554Open in IMG/M
3300025083|Ga0208791_1005846All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1563302Open in IMG/M
3300025084|Ga0208298_1090435All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156561Open in IMG/M
3300025098|Ga0208434_1092990Not Available599Open in IMG/M
3300025133|Ga0208299_1063068All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561362Open in IMG/M
3300025276|Ga0208814_1000201All Organisms → cellular organisms → Bacteria42230Open in IMG/M
3300025276|Ga0208814_1123918All Organisms → Viruses615Open in IMG/M
3300025701|Ga0209771_1013799All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1563616Open in IMG/M
3300026123|Ga0209955_1000267All Organisms → cellular organisms → Bacteria → Proteobacteria19650Open in IMG/M
3300026213|Ga0208131_1084618All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156774Open in IMG/M
3300026292|Ga0208277_1000001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales221643Open in IMG/M
3300026505|Ga0228647_1082678All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156779Open in IMG/M
3300026505|Ga0228647_1103321Not Available677Open in IMG/M
3300026506|Ga0228604_1073373All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156575Open in IMG/M
3300027506|Ga0208973_1022276All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561901Open in IMG/M
3300027668|Ga0209482_1004211All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1568036Open in IMG/M
3300027668|Ga0209482_1024932All Organisms → Viruses → Predicted Viral2508Open in IMG/M
3300027672|Ga0209383_1165702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobi bacterium OLB7673Open in IMG/M
3300027672|Ga0209383_1174798All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156646Open in IMG/M
3300027714|Ga0209815_1000435All Organisms → cellular organisms → Bacteria → Proteobacteria30784Open in IMG/M
3300027714|Ga0209815_1002203Not Available12051Open in IMG/M
3300027714|Ga0209815_1017043All Organisms → Viruses → Predicted Viral3115Open in IMG/M
3300027752|Ga0209192_10078271All Organisms → Viruses → Predicted Viral1410Open in IMG/M
3300027771|Ga0209279_10035955All Organisms → Viruses → Predicted Viral1437Open in IMG/M
3300027771|Ga0209279_10273334Not Available517Open in IMG/M
3300027813|Ga0209090_10030259All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1563116Open in IMG/M
3300027813|Ga0209090_10043127All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562557Open in IMG/M
3300027833|Ga0209092_10005227All Organisms → cellular organisms → Bacteria10558Open in IMG/M
3300027833|Ga0209092_10008563All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1567737Open in IMG/M
3300027833|Ga0209092_10057903All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562378Open in IMG/M
3300027833|Ga0209092_10179722All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561202Open in IMG/M
3300027833|Ga0209092_10375560All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156750Open in IMG/M
3300027833|Ga0209092_10462090Not Available654Open in IMG/M
3300027906|Ga0209404_10182266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M1293Open in IMG/M
3300028111|Ga0233397_1050337All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561198Open in IMG/M
3300028129|Ga0228634_1034439All Organisms → Viruses → Predicted Viral1391Open in IMG/M
3300028130|Ga0228619_1037408Not Available1407Open in IMG/M
3300028137|Ga0256412_1110985All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561001Open in IMG/M
3300028192|Ga0257107_1145623All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156693Open in IMG/M
3300028233|Ga0256417_1120083All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156707Open in IMG/M
3300028396|Ga0228643_1057492All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156956Open in IMG/M
3300028396|Ga0228643_1081408Not Available771Open in IMG/M
3300029318|Ga0185543_1062015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M775Open in IMG/M
3300029318|Ga0185543_1081841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M644Open in IMG/M
3300031140|Ga0308024_1009414All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1562988Open in IMG/M
3300031175|Ga0308020_1269966All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.521Open in IMG/M
3300031510|Ga0308010_1275694Not Available584Open in IMG/M
3300031589|Ga0307996_1036381All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561299Open in IMG/M
3300031599|Ga0308007_10034525All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561945Open in IMG/M
3300031599|Ga0308007_10146835All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156844Open in IMG/M
3300031608|Ga0307999_1065585All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156851Open in IMG/M
3300031608|Ga0307999_1140160All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156558Open in IMG/M
3300031628|Ga0308014_1036934Not Available1230Open in IMG/M
3300031637|Ga0302138_10141507All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156835Open in IMG/M
3300031644|Ga0308001_10104783All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561186Open in IMG/M
3300031706|Ga0307997_10140781Not Available930Open in IMG/M
3300031706|Ga0307997_10326630All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156538Open in IMG/M
3300031757|Ga0315328_10137027All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561422Open in IMG/M
3300031766|Ga0315322_10000242Not Available38964Open in IMG/M
3300034695|Ga0372840_130309All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156752Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.66%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.19%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater13.15%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.63%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.16%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.69%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.82%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.82%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.82%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.35%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.88%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.41%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.41%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton1.41%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.41%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.47%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.47%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.47%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.47%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.47%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.47%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.47%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.47%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.94%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.94%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.94%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.94%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent0.94%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.94%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.94%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000225Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120mEnvironmentalOpen in IMG/M
3300000254Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100mEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001834Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM2, ROCA_DNA019_0.2um_2gEnvironmentalOpen in IMG/M
3300001846Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25bEnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003539Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNAEnvironmentalOpen in IMG/M
3300003540Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005402Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73EnvironmentalOpen in IMG/M
3300005404Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006011Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_O2min_ad_340m_LVEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006334Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025mEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006902Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007758Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008954Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7umEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300011312Marine microbial communities from the Deep Pacific Ocean - MP2100 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013113Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020298Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX556051-ERR599128)EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020336Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860)EnvironmentalOpen in IMG/M
3300020368Marine microbial communities from Tara Oceans - TARA_B100001027 (ERX556049-ERR599093)EnvironmentalOpen in IMG/M
3300020375Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX555974-ERR599132)EnvironmentalOpen in IMG/M
3300020377Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020383Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556043-ERR598971)EnvironmentalOpen in IMG/M
3300020389Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008)EnvironmentalOpen in IMG/M
3300020391Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020407Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021065Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015EnvironmentalOpen in IMG/M
3300021068Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023567Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024229Seawater microbial communities from Monterey Bay, California, United States - 54DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024314Seawater microbial communities from Monterey Bay, California, United States - 70DEnvironmentalOpen in IMG/M
3300024315Seawater microbial communities from Monterey Bay, California, United States - 20DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026123Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026213Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 (SPAdes)EnvironmentalOpen in IMG/M
3300026292Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes)EnvironmentalOpen in IMG/M
3300026505Seawater microbial communities from Monterey Bay, California, United States - 59DEnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028111Seawater microbial communities from Monterey Bay, California, United States - 35DEnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300028130Seawater microbial communities from Monterey Bay, California, United States - 22DEnvironmentalOpen in IMG/M
3300028132Seawater microbial communities from Monterey Bay, California, United States - 61DEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028192Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500mEnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300031140Marine microbial communities from water near the shore, Antarctic Ocean - #420EnvironmentalOpen in IMG/M
3300031175Marine microbial communities from water near the shore, Antarctic Ocean - #349EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031706Marine microbial communities from David Island wharf, Antarctic Ocean - #36EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300034695Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_10001256223300000101MarineMALPATGSAISMGTVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQNPNPTGAHG*
DelMOSum2010_1007531013300000101MarineMALPATGSVITMGTVRNYFGLSGTISMSTLGNYISPSVTSNIKLSATFGGWQNPNPTGSHG*
SI34jun09_120mDRAFT_106567313300000225MarineMALPATGSVITMGTVRNYFGLSGQISMSTLGNYISPSVTSNIKLSATFGGWQNPNPTGSHG*
SI34jun09_100mDRAFT_100337243300000254MarineMALPATGAIISMGTVRNYFGLSGAISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGAHG*
OpTDRAFT_1008556023300000928Freshwater And MarineMALPATGSTVSMSTVRDYFGLSGSVSLYQLGTHISPNVTTNIKLSATFGG
OpTDRAFT_1018977213300000928Freshwater And MarineMALPATGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGSHG*
ACM2_100071223300001834Marine PlanktonMSTLPATGSTISMSTVRNYFGLSGTVSLSQLGNHISPSVTSNIRLSATFGGWQYPSPSGAHP*
ACM22_104813223300001846Marine PlanktonMALPATGAYITMGTVRNYFGLSGAICLSTLGAYISPQVTTNIKLSATFGGWQNPNSTGASP*
ACM22_112426533300001846Marine PlanktonMALPATGAYITMGGVRNYFGLSGSICMSTLGTSNIKLSATFGGWQNPNPTGAS*
JGI26079J46598_109115723300003216MarineMALPATGSTVSMSTVRNYFGLSGTVSLYQLGTFISPNVTTNIKLSATFGGWQNPNSTGSHP*
FS891DNA_1057714313300003539Diffuse Hydrothermal Flow Volcanic VentMALPATGATITMGTVRDYFGLSGSVTLHQLGTYISPQVTTNIKLSATFGGWQNPNSSGSSQ*
FS896DNA_1080717313300003540Diffuse Hydrothermal Flow Volcanic VentMALPATGATITMGTVRDYFGLSGSVTLHQLGTYISPQVTTNIKLSATFGGWQ
Ga0055584_10038792913300004097Pelagic MarineMALPATGAAITMGQVRTYFGLSGTISMSTLGNFISPSVTTNIQLSATFGGWQNPNSTGADG*
Ga0055584_10048141123300004097Pelagic MarineMALPATGSIISMGQVRNYFGLSGNIAMSTLGNTISPSVTSNIQLSATFGGWQNPNSTGADA*
Ga0066855_1006306523300005402MarineMALPATGAYITMGGVRDYFGLSGSVSLHQLGSYISPSVTTNIKLSATFGGWQNPNPTGQHG*
Ga0066856_1000047673300005404MarineMSTLPATGSNISMSTVRNYFGLSGTVSMSTLGSTISPSVTSNIKLSATFGGWQYPSPSGSHP*
Ga0078893_1174487233300005837Marine Surface WaterMALPATGNTVSMSTVRDYFGLSGTVSLYQLGTFISPQVTTNIKLSATFGGWQNPNSTGASS*
Ga0078893_1179857873300005837Marine Surface WaterMALPATGSTITMGQVRNYFGLSGTVSLYQLGTYISPQVTTNIKLSATFGGWQNPNPTGSHG*
Ga0070743_1009917423300005941EstuarineMALPATGATISMGQVRDYFSLSGTVTLYQLGTFISPSVTTNISLSATFGGWQNPNSTGASP*
Ga0070743_1020400713300005941EstuarineMALPATGATITMGQVRDYFSLSGTVTLYQLGTFISPSVTTNISLSATFGGWQNPNSTGASP*
Ga0066373_1021213123300006011MarineMALPATGAQMTMGQVRNYFSLSGTISLSTLGNYISPSVTTNIKLSSTFGGWQNPNPTGSHG*
Ga0075441_1002109313300006164MarineMALPATGAAMTMGTVRNYFGLSGTISMSTLGAYISPSVTTNIKLSATFGGWQNPNPTGAHG*
Ga0075441_1008170713300006164MarineMALPATGVTITMGTVRNYFGLSGTVSLSQLGAFISPSVTSNISLSATFGGWQNPNAGGTSP*
Ga0075441_1017350013300006164MarineMALPATGAAMTMGTVRNYFGLSGAISMSTLGAYISPSVTTNIQLSATFGGWQNPNPTGAHG*
Ga0075441_1020608113300006164MarineMALPATGAAISIGTVRTYFGLSGAATMSTLGANLSPAVTTNIQLSATFGGWQNPNPTGADG*
Ga0075441_1023156413300006164MarineTISMGVVRNYFGLSGVVSLSTLGAFISPSVTTNIKLSATFGGWQNPNSTGRS*
Ga0075443_1007479923300006165MarineMALPATGAAMTMGQVRNYFGLSGTISMSTLGAYISPSVTTNIRLSATFGGWQNPNPTGAHG*
Ga0075447_1001823923300006191MarineMALPATGAAMTMGTVRNYFGLSGTVSLSTLGAYISPSVTTNIKLSATFGGWQNPNPTGSHG*
Ga0075447_1007469323300006191MarineMALPATGASLSMGYVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGAHG*
Ga0099675_103618923300006334MarineMALPATGSTISMSTVRNYFGLSGTVSLSQLGNYISPSVTSNIRLSATFGGWQNPNPTGSHP*
Ga0070744_10000022393300006484EstuarineMALPATGATITMGTVRNYFGLSGTVTLSGLGAFISPSVTTNIKLSATFGGWQNPNALGTSP*
Ga0070744_1001375213300006484EstuarineMALPATGSIISMGQVRNYFGLSGTIAMSTLGNYISPSVTTNVSISATFGGWQNPNPTGAHG*
Ga0098038_100621733300006735MarineMALPATGATISIGTVRDYFGLSGTTSLLDLGQFISPQVTTNISLSATFGGWQNPNSTGASP*
Ga0098048_1000020833300006752MarineMALPATGSTISMGQVRNYFGLSGTVSLSQLGNYISPSVTTNISLSATFGGWQNPNPTGSHP*
Ga0098048_104193313300006752MarineMALPATGANITMGTVRNYFNLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGSHP*
Ga0098054_112852523300006789MarineMALPATGAAITMGQVRTYFGLSGTISMSPLGNYISPSVTTNIKLSATFGGWQNPNSTGADS*
Ga0098055_100513833300006793MarineMALPATGAAITMGQVRTYFGLSGTISMSTLGNYISPSVTTNIKLSATFGGWQNPNSTGADS*
Ga0098055_123591423300006793MarineMALPATGSTISMGQVRNYFGLSGTISLSTLGAYISPSVSTNIKLSATFGGWQNPNPTGAHG*
Ga0066372_1007954233300006902MarineMALPATGAIITMGTVRDYFGLSGSVTLHQLGTYISPQVTTNIKLSATFGGWQNPNSTGSS
Ga0066372_1021941823300006902MarineMALPATGATITMGQVRNYFGLSGTISMSTLGNYISPSVTTNIKLSATFGGWQNPNPTGADG*
Ga0066372_1095733423300006902MarineMALPATGANITMGQVRDYFSLSGTVSLHQLGSYISPSVTTNIKLSATFGGWQNPNSTGQDG*
Ga0098051_101008033300006924MarineMALPATGSTISMGQVRNYFGLSGTVSLSQLGNYISPSVTTNISLSATFGGWQNPNPT
Ga0075444_1000611833300006947MarineMALPATGATITLGTVRDYFGLSGSVSLHQLGTYISPQVTTNIKLSSTFGGWQNPNSTGSS
Ga0075444_1041626223300006947MarineMALPATGASITMGTVRNYFGLSGTISMSTLGAYISPSVSTNIQLSATFGGWNNPNPTGADG*
Ga0102948_100304353300007623WaterMALPATGQTITMGQVRDYFGLSGTVSLYQLGTYISPSVTTNIQLSATFGGWQNPNPTGASA*
Ga0102906_118290823300007637EstuarineMALPATGSAISMGQVRNYFGLSGTVTLSQLGAFITPSVTTNISLSATFGGWQNPNSTGQHG*
Ga0102900_100484343300007651EstuarineMALPATGATITMGQVRDYFSLSGTVTLYQLGTFISPSVTTNISLSATFGGWQIPNSTGASP*
Ga0105668_104252013300007758Background SeawaterMALPATGSQITMGTIRNYFGLSGTVSLYQLGTYINPSVTSNIRLSATFGGWQNPNANGSS
Ga0098052_111030523300008050MarineMALPATGEYITMGTVRDYFGLSGQICLSTLGAYITPQVTTNIYLSATFGGWQNPNSGGTSP*
Ga0103741_109462823300008938Ice Edge, Mcmurdo Sound, AntarcticaYLRGEQHMALPATGVTITMGTVRNYFGLAGTVSLSTLGAFISPSVTTNIKLSQTFGGWQNPNSSGAS*
Ga0115650_132993713300008954MarineMGQVRNYFGLSGTISMSTLGNYISPSVTTNIKLSATFGGWQNPNPTGADG*
Ga0102887_1002243123300008961EstuarineMALTATGATITMGQVRDYFSLSGTVTLYQLGTFISPSVTTNISLSATFGGWQNPNSTGASP*
Ga0102887_109332213300008961EstuarineMALPATGSVITMGTVRNYFGLSGQISMSTLGNYISPSVTSNIKLSATFGG
Ga0104258_102391633300008993Ocean WaterMALPATGATITMGGVRDYFGLSGTISLSTLGNTISPAVTTSISLSATFGGWQNPNSTGAS
Ga0104258_103674813300008993Ocean WaterQMALPATGSQISMSTVRDYFGLSGTVSLYQLGTYISPNVTTNIKLSATFGGWQNPNSTGAS*
Ga0102911_123026413300009049EstuarineMALPATGAVITMGGVRNYFGLSGAISMSTLGNYISPSVTTNIKLSATFGGWQNPNSTGADG*
Ga0102814_1006593723300009079EstuarineMALPATGSMISMGQVRNYFGLSGAISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGAHG*
Ga0102815_1001787923300009080EstuarineMALPATGSVITMGTVRNYFGLSGQISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGAHG*
Ga0102812_1056950023300009086EstuarineMALPATGSVITMGTVRNYFGLSGQISMSTLGNYISPSVTSNIKLSATFGGWQNPNSTGADG*
Ga0118729_104384833300009130MarineMALPATGAQITMGEVRNYFGLSGSISLSTLGNYISPSVTTNIQLSATFGGWQNPNSTGADS*
Ga0118729_109072123300009130MarineMALPATGATITMGTVRNYFGLSGTISMSTLGNYISPSVTSNIQLSATFGGWQNPNPSGSHP*
Ga0118729_110538923300009130MarineMALPATGANISMGTVRNYFGLSGSISLSTLGNYISPSVTTNIQLSATFGGWQNPNSTGASA*
Ga0114994_1002080623300009420MarineMALPATGSQISMSTVRNYFGLSGQVSLYQLGTYISPNVTTNIKLSATFGGWQNPNSTGASPT*
Ga0114994_1058188013300009420MarineNVNYSNRSHNMALPATGAAMTMGTVRNYFGLSGAISMSTLGAYISPSVTSNIKLSATFGGWQNPNPTGAHG*
Ga0114994_1058212713300009420MarineNVNYSNRSHNMALPATGAAMTMGTVRNYFGLSGAISMSTLGAYISPSVTTNIRLSATFGGWQNPNPTGAHG*
Ga0115008_1004508573300009436MarineMALPATGSAISMGQVRNYFGLSGTVSLSQLGNYISPSVTTNISLSATFGGWQNPNPTGSHP*
Ga0115008_1044694813300009436MarineMALPATGAVITMGGVRNYFGLSGSISMSTLGNYISPSVTTNIKLSATFGGWQNPNSTGADG*
Ga0115008_1082830123300009436MarineATGSTVSMSTVRDYFGLSGSVSLYQLGTFISPNVTTNIRLSATFGGWQNPNATGAS*
Ga0114932_1011850723300009481Deep SubsurfaceMSTLPATGSNISMSTVRNYFGLSGTVSLSQLGNHISPSVTTNISLSATFGGWQYESPTGNHP*
Ga0115101_112026423300009592MarineMALPATGSQISMSTVRDYFGLSGTVSLYQLGTFISPNLTTNIKLSATFGGWQNPNSTGAS
Ga0115011_1029064623300009593MarineMALPATGATISIGTVRDYFGLSGTTSLLDLGQFISPQVTTNISLSATFGGWQNPNSTGASPT*
Ga0115011_1102935013300009593MarineQTMALPATGANITMGTVRNYFNLSGTISISTLGNYISPSVTTNIQLSATFGGWQNPNPTGSHP*
Ga0115103_154617963300009599MarineLLLTLKILEENNMALPSTGSYITMGTVRNYFGLSGSICMSTLGNYISPSVTTNIKLSETFGGWQNPNPTGAS*
Ga0115102_1019264323300009606MarineMALPATGSTISMGQVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQNPNPTGAHG*
Ga0115104_1058622413300009677MarineMSTLPATGSTISMSTVRNYFGLSGTVSLSQLGNTISPSVTSNIRLSATFGGWQYP
Ga0098049_104932223300010149MarineMALPATGATITMGGVRNYFGLSGNISMSTLGAYISPSVSTNIALSATFGGWQNPNSTGADS*
Ga0098061_101394413300010151MarineMALPATGAYITMGQVRDYFGLSGQICLSTLGAYISPQVTTNIYLSATFGGWQNPNSGGTSP*
Ga0138349_104408923300011312Deep OceanLITRKKESNNMALPATGAQMTMGQVRNYFGLSGAVSLHQLGSYISPSVTTNIKLSSTFGGWQNPNPTGSHG*
Ga0138266_117345533300012412Polar MarineMALPATGAAMTMGTVRNYFGLSGAISMSTLGAYISPSVTTNIKLSATFGGWQNPNPTGAHG*
Ga0129353_195311423300012525AqueousMSSLPATGATISIGTVRDYFGLSGTTSLLDLGQYISPNVTTNISLSATFGGWQNPNSTGASP*
Ga0160423_1058139023300012920Surface SeawaterMALPATGSEISMGQVRDYFGLSGQVSLKATLGAFITPQVTTNVGLSATFGGWQNPNSTGASP*
Ga0160423_1095672123300012920Surface SeawaterMSSLPATGATISIGTVRDYFGLSGTTSLLDLGQFISPQVTTSISLSATFGGWQNPNSTGASP*
Ga0138257_111238023300012935Polar MarineMALPATGSTVSMSTVRDYFGLSGTVSLYQLGTFISPNVTTNIRLSATFGGWQS*
Ga0163111_1022404133300012954Surface SeawaterMALPATGSTISMSTVRNYFGLSGTVSLSQLGNYISPSVTSNIKLSATFGGWQNPNPSGSHP*
Ga0171647_114033313300013113MarineMALPATGAQITMGQVRNYFGLSGSISLSTLGNYISPSVTTNIQLSATFGGWQNPNPTGADS*
Ga0182062_113271223300016751Salt MarshATGSTISIGSIRTYFGLSGTQSLYSLGTYISPNVTTNIRLSATFGGWQNPNPTGAS
Ga0181377_100011093300017706MarineMALPATGNEITMGEVRNYFGLSGNISMSTLGAYISPSVSTNIALSSTFGGWQNPNSTGAD
Ga0181377_100949223300017706MarineMATLPATGSNISMSTVRNYFGLSGTVSLSQLGNHISPSVTSNISLSATFGGWQYESPTGNHP
Ga0181396_101684313300017729SeawaterMALPATGSQISMSTVRDYFGLSGTVSLYQLGTYISPNVTTNIKLSATFGGWQN
Ga0187218_110632213300017737SeawaterMAALPGTGSTLSMGTVRNYFGLSGTISMSTLGNFISPSVTTNIALSATFGG
Ga0181424_10001614133300017786SeawaterMSTLPATGSTISMSTVRNYFGLSGTVSLSQLGNTISPSVTSNIRLSATFGGWQYPSATGGHP
Ga0181607_1012227733300017950Salt MarshMALPATGSTISIGSIRTYFGLSGTQSLYSLGTYISPNVTTNIRLSATFGGWQNPNPTGAS
Ga0181607_1066921223300017950Salt MarshMPLPATGNTISIGSIRTYFGLSGTQSLYSLGTYISPNVTSNIRLSATFGGWQNPNPTGAS
Ga0181580_1053519823300017956Salt MarshMSSLPATGATISIGTIRTYFGLSGTQSLYSLGTYISPNVTTNIKLSATFGGWQNPNSTGSSP
Ga0180036_110556213300019200EstuarineMALPATGATITMGQVRDYFSLSGTVTLYQLGTFISPSVTTNISLSATFGGWQNPNSTGAS
Ga0182097_124174923300019261Salt MarshMPLPATGNTISIGSIRTYFGLSGTQSLYSLGTYISPNVTSNIRLSATFGGWQNP
Ga0181602_1028439723300020173Salt MarshMAALPATGSTISIGTIRTYFGLSGTQSLYSLGTYISPNVTTNIRLSATFGGWQNPNQWGT
Ga0211657_107741913300020298MarineMALPATGATMTMGQVRNYFSLSGTISLSTLGNYISPSVTTNIKLSSTFGGWQNPNPTGSH
Ga0211690_103578923300020335MarineMALPATGSQISMSTVRDYFGLSGTVSLYQLGTFISPNVTTNISLSATFGGWQNPNSTGAS
Ga0211510_113707413300020336MarineMATLPATGSNISMSTVRNYFGLSGTVSLSQLGNHISPSVTTNISLSATFGGWQYESPTGNHP
Ga0211674_1012057323300020368MarineMSTLPATGSTISMSTVRNYFGLSGTVSLSQLGNHISPSVTSNIRLSATFGGWQYPSPSGAHP
Ga0211656_1000364563300020375MarineMALPATGAAMTMGTVRNYFSLSGTISLSTLGNYISPSVTTNIKLSATFGGWQNPNPTGSH
Ga0211647_1003979023300020377MarineMALPATGSTISMSTVRNYFGLSGTVSLSQLGNYISPSVTSNIKLSATFGGWQNPNPSGSH
Ga0211647_1006198723300020377MarineMSSLPATGATISIGTVRDYFGLSGTTSLLDLGQFISPQVTTSISLSATFGGWQNPNSTGASP
Ga0211652_1001550043300020379MarineMALPATGSEISMGQVRDYFGLSGQVSLKATLGAFITPQVTTNVGLSATFGGWQNPNSTGASP
Ga0211646_1013148523300020383MarineMALPATGAQMTMGQVRNYFGLSGAVSLHQLGSYISPSVTTNIKLSSTFGGWQNPNPTGSH
Ga0211680_1005951523300020389MarineMALPATGATMTMGTVRNYFSLSGAISMSTLGNYISPSVTTNIKLSSTFGGWQNPNPTGQD
Ga0211680_1027885713300020389MarineMALPATGATITLGTVRDYFGLSGSVTLHQLGTYISPQVTTNIKLSATFGGWQNPNSSGSS
Ga0211675_1006301323300020391MarineMSTLPATGSNISMSTVRNYFGLSGTVSLSQLGSHISPSVTSNIRLSATFGGWQYPSPSGAHP
Ga0211497_1013658823300020394MarineMSSLPATGATISIGTVRDYFGLSGTTSLLDLGQYISPQVTTSISLSATFGGWQNPNSTGASP
Ga0211575_1000634423300020407MarineMALPATGATMTMGTVRNYFSLSGAVSLSQLGNYISPSVTTNIKLSATFGGWQNPNPTGSH
Ga0211523_1004360623300020414MarineMALPATGSEISMGQVRDYFGLSGQVSLSATLGAFITPQVTTNVGLSATFGGWQNPNSTGASS
Ga0211576_1007030323300020438MarineMSTLPATGSTISMSTVRNYFGLSGTVSLSQLGNTISPSVTSNIKLSATFGGWQYPSSTGGHP
Ga0211676_1012443443300020463MarineMALPATGATISIGTVRDYFGLSGTTSLLDLGQFISPQVTTNISLSATFGGWQNPNSTGAS
Ga0211676_1067340313300020463MarineMALPATGSTISMSTVRNYFGLSGTVSLSQLGNYISPSVTSNIKLSATFGGWQNPNPTGSH
Ga0211577_1025294023300020469MarineMSTLPATGSTISMSTVRNYFGLSGTVSLSQLGNTISPSVTSNIRLSATFGGWQYPSSTGGHP
Ga0206686_120576013300021065SeawaterMALPATGATITMGQVRNYFGLSGTISMSTLGNYISPSVTTNIKLSATFGGWQNPNPTGQD
Ga0206684_109463823300021068SeawaterMALPATGSQISMSTVRDYFGLSGTVSLYQLGTFISPNVTTNIKLSATFGGWQNPNSTGAS
Ga0206684_122126423300021068SeawaterMALPATGATITLGGIRDYFGLSGAVSLHQLGSYISPSVTTNIKLSSTFGGWENPNPTGSH
Ga0206677_1000080073300021085SeawaterMALPATGSIISMGQVRNYFGLSGNIAMSTLGNTISPSVTSNIQLSATFGGWQNPNSTGAD
Ga0206677_1000526043300021085SeawaterMALPSTGSYITMGTVRNYFGLSGSICMSTLGNYISPSVTTNIKLSETFGGWQNPNPTGAS
Ga0206677_1000539883300021085SeawaterMALPATGNTVSMSTVRDYFGLSGTVSLYQLGTFISPQVTTNIKLSATFGGWQNPNSTGAS
Ga0206677_1003998923300021085SeawaterMALPATGSVITMGTVRNYFGLSGQISMSTLGNYISPSVTSNIKLSATFGGWQNPNPTGSH
Ga0206677_1025553013300021085SeawaterMSTLPATGSTISMSTVRNYFGLSGTVSLSQLGNTISPSVTSNIKLSATFGGWQYPSATGGHP
Ga0206687_183219313300021169SeawaterMALPATGSQISMSTVRDYFGLSGTVSLYQLGTYISPNVTTNIKLSATFGGWQNPNSTGAS
Ga0210295_106344723300021323EstuarineMALPATGATISMGQVRDYFSLSGTVTLYQLGTFISPSVTTNISLSATFGGWQNPNSTGAS
Ga0206696_129845913300021334SeawaterMTMGTVRNYFSLSGAVSLSQLGNYISPSVTTNIKLSATFGGWQNPNPTGSHG
Ga0206691_100116123300021342SeawaterMQYAVHLSIIKRQESNNMALPATGATMTMGTVRNYFSLSGAVSLSQLGNYISPSVTTNIKLSATFGGWQNPNPTGSHG
Ga0206123_1017521323300021365SeawaterMALPATGNQISIGQVRDYFGLSGQTSLYDLGTFISPNVTTNISLSATFGGWQNPNSTGAS
Ga0213860_1016942833300021368SeawaterMALPATGATITMGTVRNYFGLSGTISMSTLGNYISPSVTSNIQLSATFGGWQNPNPSGSH
Ga0213860_1017113533300021368SeawaterMSSLPATGATISIGTVRDYFGLSGTTSLLDLGQYISPNVTTNISLSATFGGWQNPNSTGASP
Ga0213865_1044539323300021373SeawaterMALPATGNQISIGQVRNYFGMSGEKSLYSLGTYISPNVTSNIQLSATFGGWQNPNSTGAS
Ga0213869_1000047123300021375SeawaterMALPATGAAITMGQVRTYFGLSGTISMSTLGNFISPSVTTNIQLSATFGGWQNPNSTGAD
Ga0213869_10001809163300021375SeawaterMALPATGSTISMSTVRNYFGLSGTVSLYQLGTFISPNVTTNIKLSATFGGWQNPNSTGAS
Ga0213861_1023951323300021378SeawaterMALPATGSVITMGTVRNYFGLSGTISMSTLGNYISPSVTSNIKLSATFGGWQNPNPTGSH
Ga0224906_100839763300022074SeawaterMALPATGATISIGTVRDYFGLSGTTSLLDLGNYISPSVTTSISLSATFGGWQNPNSTGSS
(restricted) Ga0233426_10000363523300022920SeawaterMALPATGSTISMGTVRNYFGLSGTISLSTLGNYISPSVTSNIKLSATFGGWQNPNSTGSS
Ga0228679_100515323300023566SeawaterMALPATGSTISMGQVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQNPNPTGAH
Ga0228694_10096913300023567SeawaterMALPATGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGSH
Ga0228686_104200423300023685SeawaterMALPATGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTSNIKLSATFGGWQNPNPTGSH
Ga0232112_100194853300023693SeawaterQQMALPATGSTISMGQVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQNPNPTGAHG
Ga0228636_111035313300024191SeawaterMAALPSTGNTISMGQVRNYFGLSGSISLYQLGTHISPNVTSNISLSATFGGWQNPNIYGTASGV
Ga0233402_103872023300024229SeawaterMALPATGAYITMGTVRNYFGLSGSICLSTLGAYISPSVTTNIKLSATFGGWQNPNSTGAS
(restricted) Ga0233444_1017286913300024264SeawaterMALPATGSVITMGTVRNYFGLSGQISMSTLGNYISPSVTSNIKLSATFGGWQNPNPT
Ga0228610_104263913300024281SeawaterLQARSQQMALPATGSTISMGQVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQNPNPTGAHG
Ga0228657_105318423300024314SeawaterMALPATGSTISMGQVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQ
Ga0228618_106283313300024315SeawaterMALPATGSTISMGQVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQNLN
Ga0233398_100475913300024320SeawaterNTVSMSTVRDYFGLSGTVSLYQLGTFISPQVTTNIKLSATFGGWQNPNSTGAS
Ga0228656_104656333300024322SeawaterTGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGSHG
Ga0244775_1000510453300024346EstuarineMALPATGSIISMGQVRNYFGLSGTIAMSTLGNYISPSVTTNVSISATFGGWQNPNPTGAH
Ga0244775_1013870943300024346EstuarineMALPATGATITMGTVRNYFGLSGTVTLSGLGAFISPSVTTNIKLSATFGGWQNPNALGTS
Ga0244776_1004334843300024348EstuarineMALPATGSTVSMSTVRDYFGLSGSVSLYQLGTFISPNVTTNIRLSATFGGWQNPNATGAS
Ga0208791_100584623300025083MarineMALPATGSTISMGQVRNYFGLSGTVSLSQLGNYISPSVTTNISLSATFGGWQNPNPTGSH
Ga0208298_109043513300025084MarineMALPATGAAITMGQVRTYFGLSGTISMSTLGNYISPSVTTNIKLSATFGGWQNPNSTGAD
Ga0208434_109299023300025098MarineMALPATGSQISMSTVRDYFGLSGSVSLYQLGTFISPNVTTNIKLSATFGGWQNPNSTGAS
Ga0208299_106306813300025133MarineMALPATGEYITMGTVRDYFGLSGQICLSTLGAYITPQVTTNIYLSATFGGWQNPNSGGTS
Ga0208814_1000201243300025276Deep OceanMALPATGSSISMGTVRNYFGLSGTVSLSTLGAFISPSVSTNIQLSATFGGWQNPNSTGAS
Ga0208814_112391823300025276Deep OceanMALPATGSTVSMSTVRDYFGLSGTVSLYQLGTFISPNVTTNIRLSATFGGWQNPNATGAS
Ga0209136_109843513300025636MarineMALPATGSTVSMSTVRNYFGLSGTVSLYQLGTFISPNVTTNIKLSATF
Ga0209771_101379933300025701MarineMALPATGSTVSMSTVRNYFGLSGTVSLYQLGTFISPNVTTNIKLSATFGGWQNPNSTGSH
Ga0209955_100026783300026123WaterMALPATGQTITMGQVRDYFGLSGTVSLYQLGTYISPSVTTNIQLSATFGGWQNPNPTGAS
Ga0208131_108461823300026213MarineMALPATGAYITMGGVRDYFGLSGSVSLHQLGSYISPSVTTNIKLSATFGGWQNPNPTGQH
Ga0208277_1000001673300026292MarineMSTLPATGSNISMSTVRNYFGLSGTVSMSTLGSTISPSVTSNIKLSATFGGWQYPSPSGSHP
Ga0228647_108267813300026505SeawaterMTMGTVRNYFGLSGTISMSTLGNYISPSVTSNIKLSATFGGWQNPNPTGSHG
Ga0228647_110332113300026505SeawaterMALPATGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTSNIKLSATFGG
Ga0228604_107337313300026506SeawaterSHNMALPATGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGSHG
Ga0208973_102227623300027506MarineMALPATGSQISMSTVRDYFGLSGSVSLYQLGTYISPNVTTNIKLSATFGGWQNPNSTGAS
Ga0209482_100421183300027668MarineMALPATGAAMTMGTVRNYFGLSGTISMSTLGAYISPSVTTNIKLSATFGGWQNPNPTGAH
Ga0209482_102493213300027668MarineMALPATGAAMTMGTVRNYFGLSGTVSLSTLGAYISPSVTTNIKLSATFGGWQNPNPTGSH
Ga0209383_116570223300027672MarineMALPATGAAMTMGTVRNYFGLSGAISMSTLGAYISPSVTTNIQLSATFGGWQNPNPTGAH
Ga0209383_117479813300027672MarineRSHNMALPATGASLSMGYVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGAHG
Ga0209815_1000435213300027714MarineMALPATGVTITMGTVRNYFGLSGAVSLSTLGAFISPSVTTNIKLSQTFGGWQNPNSTGAS
Ga0209815_100220323300027714MarineMALPATGVTITMGTVRNYFGLSGTVSLSQLGAFISPSVTSNISLSATFGGWQNPNAGGTS
Ga0209815_101704333300027714MarineLRGEQHMALPATGVTITMGTVRNYFGLAGTVSLSTLGAFISPSVTTNIKLSQTFGGWQNPNSSGAS
Ga0209192_1007827113300027752MarineMALPATGVTITMGTVRNYFGLSGAVSLSTLGAFISPSVTTNIKLSETFGGWQNPNSTGAS
Ga0209279_1003595523300027771MarineMALPATGVTITMGTVRNYFGLAGTVSLSTLGAFISPSVTTNIKLSQTFGGWQNPNSSGAS
Ga0209279_1027333423300027771MarineMALPATGSTISMGVVRNYFGLSGVVSLSTLGAFISPSVTTNIKLSATFGGWQNPNSTGRS
Ga0209090_1003025943300027813MarineMALPATGSQISMSTVRNYFGLSGQVSLYQLGTYISPNVTTNIKLSATFGGWQNPNSTGASPT
Ga0209090_1004312743300027813MarineMALPATGAAMTMGTVRNYFGLSGAISMSTLGAYISPSVTTNIRLSATFGGWQNPNPTGAH
Ga0209092_10005227133300027833MarineMALPATGSQISMSTVRNYFGLSGSVSLYQLGTYISPNVTTNIRLSATFGGWQNPNSTGAS
Ga0209092_1000856323300027833MarineMALPATGSTISMGTVRNYFGLSGTISLSTLGNYISPSVTTNIKLSATFGGWQNPNSTGSS
Ga0209092_1005790333300027833MarineMALPATGSAISMGQVRNYFGLSGTVSLSQLGNYISPSVTTNISLSATFGGWQNPNPTGSH
Ga0209092_1017972223300027833MarineMALPATGSAISMGTVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQNPNPTGAH
Ga0209092_1037556023300027833MarineATGSTVSMSTVRDYFGLSGSVSLYQLGTFISPNVTTNIRLSATFGGWQNPNATGAS
Ga0209092_1046209013300027833MarineMALPATGAVITMGGVRNYFGLSGSISMSTLGNYISPSVTTNIKLSATFGGWQNPNSTGAD
Ga0209404_1018226623300027906MarineMALPATGATISIGTVRDYFGLSGTTSLLDLGQFISPQVTTNISLSATFGGWQNPNSTGASPT
Ga0233397_105033713300028111SeawaterALPATGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGSHG
Ga0228634_103443923300028129SeawaterMALPATGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGG
Ga0228619_103740823300028130SeawaterMALPATGAYITMGEVRNYFGLSGSICMSTLGNFISPSVTSNIKLSDTFGGWQNPNQYGTDSGVHPDN
Ga0228649_113555813300028132SeawaterMSTLPATGSTISMSTVRNYFGLSGTVSLSQLGNTISPSVTSNIKLSATFGIK
Ga0256412_111098513300028137SeawaterQARSQQMALPATGSTISMGQVRNYFGLSGTISLSTLGAYISPSVSTNIQLSATFGGWQNPNPTGAHG
Ga0257107_114562323300028192MarineMALPATGAAMTMGTVRNYFGLSGSVSLSQLGNYISPSVTTNIKLSATFGGWQNPNPTGQH
Ga0256417_112008313300028233SeawaterMALPATGSAISMGQVRNYFGLSGTVSLSTLGAYISPSVTTNIKLSATFGGWQNPNPTGAH
Ga0228643_105749213300028396SeawaterAMTMGTVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQNPNPTGSHG
Ga0228643_108140823300028396SeawaterMALPATGAAMTMGTVRNYFGLSGTISMSTLGNYISPSVTTNIQLSATFGGWQ
Ga0185543_106201523300029318MarineMALPATGSEISMGQVRDYFGLSGQVSLSATLGAFITPQVTTNVGLSATFGGWQNPNSTGASP
Ga0185543_108184113300029318MarineMSSLPATGATISIGTVRDYFGLSGTTSLLDLGQYISPQVTTSISLSATFGGWQNPNSTG
Ga0308024_100941433300031140MarineMALPATGATISLGQVRDYFGLSGTVSLYQLGTFISPSVTTNISLSSTFGGWQNPNSTGAS
Ga0308020_126996613300031175MarineMALPATGVTITMGTVRNYFGLSGTVSLSQLGAFISPSVTSNISLSATFG
Ga0308010_127569413300031510MarineMALPATGAAISIGTVRTYFGLSGAATMSTLGANLSPAVTTNIQLSATFGGWQNPNPTGAD
Ga0307996_103638123300031589MarineMALPATGSTISMGTIRTYFGLSGTVSLSQFGAYISPTVTTNIKLSATFGGWQNPNSTGAS
Ga0308007_1003452543300031599MarineAISIGTVRTYFGLSGAATMSTLGANLSPAVTTNIQLSATFGGWQNPNPTGADG
Ga0308007_1014683513300031599MarinePATGSTVSMSTVRDYFGLSGTVSLYQLGTFISPNVTTNIRLSATFGGWQNPNATGAS
Ga0307999_106558513300031608MarineALPATGSTVSMSTVRDYFGLSGTVSLYQLGTFISPNVTTNIRLSATFGGWQNPNATGAS
Ga0307999_114016013300031608MarineELFVINVNYSNRSHNMALPATGAAMTMGTVRNYFGLSGAISMSTLGAYISPSVTTNIQLSATFGGWQNPNPTGAHG
Ga0308014_103693423300031628MarineMALPATGAAISIGTVRTYFGLSGAATMSTLGANLSPAVTTNIQLSATFGGWQN
Ga0302138_1014150733300031637MarineAMTMGTVRNYFGLSGAISMSTLGAYISPSVTTNIQLSATFGGWQNPNPTGAHG
Ga0308001_1010478323300031644MarineMALPATGASITMGTVRNYFGLSGTISMSTLGAYISPSVSTNIQLSATFGGWNNPNPTGAD
Ga0307997_1014078123300031706MarineMALPATGSTISMGTIRTYFGLSGTVSLSQFGAYISPTVTTNIKLSATFG
Ga0307997_1032663023300031706MarineMALPATGSQISMSTVRNYFGLSGQVSLYQLGTYISPNVTTNINLSATFGGWQNPNSTGAS
Ga0315328_1013702723300031757SeawaterMALPATGAQITMGEVRNYFGLSGSISLSTLGNYISPSVTTNIQLSATFGGWQNPNSTGAD
Ga0315322_1000024263300031766SeawaterMALPATGNQISMSTVRDYFGLSGTVSLYQLGTFISPNVTTNIKLSATFGGWQNPNSTGAS
Ga0372840_130309_210_3953300034695SeawaterMALPATGATITMGTVRNYLGLSGTVSMSTLGNYISPSVTTNIKLSATFGGWQNPNPTGSH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.