| Basic Information | |
|---|---|
| Family ID | F022695 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 213 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MQSLKSSIERLAALGEVEHNPEARPVFLEFRDALTQGKIRA |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 213 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.49 % |
| % of genes near scaffold ends (potentially truncated) | 98.59 % |
| % of genes from short scaffolds (< 2000 bps) | 90.14 % |
| Associated GOLD sequencing projects | 166 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.305 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.432 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.352 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.930 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 213 Family Scaffolds |
|---|---|---|
| PF00701 | DHDPS | 53.05 |
| PF13620 | CarboxypepD_reg | 2.35 |
| PF05173 | DapB_C | 1.88 |
| PF01842 | ACT | 0.94 |
| PF00696 | AA_kinase | 0.94 |
| PF01878 | EVE | 0.47 |
| PF01594 | AI-2E_transport | 0.47 |
| PF00795 | CN_hydrolase | 0.47 |
| PF13442 | Cytochrome_CBB3 | 0.47 |
| PF00180 | Iso_dh | 0.47 |
| PF12158 | DUF3592 | 0.47 |
| PF02774 | Semialdhyde_dhC | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 213 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 106.10 |
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 1.88 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.47 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.47 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.47 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.47 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.31 % |
| Unclassified | root | N/A | 4.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10156015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300004152|Ga0062386_100253531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1395 | Open in IMG/M |
| 3300004152|Ga0062386_101005703 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300004633|Ga0066395_11040985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 500 | Open in IMG/M |
| 3300004635|Ga0062388_100106820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2022 | Open in IMG/M |
| 3300005093|Ga0062594_102673259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005174|Ga0066680_10360729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300005332|Ga0066388_103014152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300005333|Ga0070677_10226336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300005338|Ga0068868_100096169 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300005353|Ga0070669_100558298 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005355|Ga0070671_100771562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300005434|Ga0070709_10387013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300005439|Ga0070711_100250043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp. | 1390 | Open in IMG/M |
| 3300005518|Ga0070699_100180285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1874 | Open in IMG/M |
| 3300005518|Ga0070699_102041512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005533|Ga0070734_10112741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1591 | Open in IMG/M |
| 3300005540|Ga0066697_10045875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2466 | Open in IMG/M |
| 3300005541|Ga0070733_10803562 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005541|Ga0070733_10994783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300005542|Ga0070732_10275336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
| 3300005548|Ga0070665_101895407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300005602|Ga0070762_10054666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2211 | Open in IMG/M |
| 3300005602|Ga0070762_10310626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
| 3300005602|Ga0070762_10369173 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005610|Ga0070763_10124510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp. | 1324 | Open in IMG/M |
| 3300005618|Ga0068864_101043576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300005712|Ga0070764_10171650 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300005718|Ga0068866_10389882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300005764|Ga0066903_104146260 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005921|Ga0070766_10721139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300006028|Ga0070717_10469315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1136 | Open in IMG/M |
| 3300006046|Ga0066652_101077835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300006059|Ga0075017_100147953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1670 | Open in IMG/M |
| 3300006086|Ga0075019_10489422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300006102|Ga0075015_100228652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300006176|Ga0070765_102073890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300006796|Ga0066665_11455708 | Not Available | 532 | Open in IMG/M |
| 3300006800|Ga0066660_11654985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300006854|Ga0075425_101626786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300006871|Ga0075434_100240291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1831 | Open in IMG/M |
| 3300006871|Ga0075434_102108133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300009038|Ga0099829_10132076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1977 | Open in IMG/M |
| 3300009088|Ga0099830_11519124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300009090|Ga0099827_10008259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6523 | Open in IMG/M |
| 3300009090|Ga0099827_10603653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300009521|Ga0116222_1039498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2071 | Open in IMG/M |
| 3300009624|Ga0116105_1038957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300010159|Ga0099796_10294982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300010336|Ga0134071_10054516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1821 | Open in IMG/M |
| 3300010343|Ga0074044_11149033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 507 | Open in IMG/M |
| 3300010376|Ga0126381_104793150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300010396|Ga0134126_11838051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300010396|Ga0134126_12046300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300010400|Ga0134122_11590656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300012096|Ga0137389_10031819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3837 | Open in IMG/M |
| 3300012200|Ga0137382_11326365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 507 | Open in IMG/M |
| 3300012212|Ga0150985_111926825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 501 | Open in IMG/M |
| 3300012582|Ga0137358_10682729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300012918|Ga0137396_10604705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300012923|Ga0137359_10555380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300012923|Ga0137359_10919983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300012924|Ga0137413_11722999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012925|Ga0137419_10856625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300012929|Ga0137404_11928840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300012955|Ga0164298_10552154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300012960|Ga0164301_10843158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300012977|Ga0134087_10064447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1473 | Open in IMG/M |
| 3300013297|Ga0157378_10796440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
| 3300014154|Ga0134075_10184103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300014164|Ga0181532_10681100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300015264|Ga0137403_11463611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300016294|Ga0182041_12082893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300016357|Ga0182032_11875811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 524 | Open in IMG/M |
| 3300017659|Ga0134083_10117750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300017822|Ga0187802_10407270 | Not Available | 539 | Open in IMG/M |
| 3300017928|Ga0187806_1185572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300017930|Ga0187825_10034247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1712 | Open in IMG/M |
| 3300017936|Ga0187821_10204759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300017943|Ga0187819_10179560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1254 | Open in IMG/M |
| 3300017959|Ga0187779_10870036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300017970|Ga0187783_11258788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300017972|Ga0187781_10569004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 816 | Open in IMG/M |
| 3300017973|Ga0187780_10358332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1031 | Open in IMG/M |
| 3300017974|Ga0187777_10127534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1688 | Open in IMG/M |
| 3300018012|Ga0187810_10534725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300018017|Ga0187872_10298602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300018058|Ga0187766_10013092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4745 | Open in IMG/M |
| 3300018064|Ga0187773_10536829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300018085|Ga0187772_10030473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3202 | Open in IMG/M |
| 3300018085|Ga0187772_10160678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1492 | Open in IMG/M |
| 3300018085|Ga0187772_10804170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300018085|Ga0187772_10835906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300018085|Ga0187772_11251754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300018086|Ga0187769_10990723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300018086|Ga0187769_11296069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300018088|Ga0187771_10067373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2823 | Open in IMG/M |
| 3300018088|Ga0187771_11130695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300018431|Ga0066655_10151573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1377 | Open in IMG/M |
| 3300018468|Ga0066662_10202776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1570 | Open in IMG/M |
| 3300020580|Ga0210403_11488377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 510 | Open in IMG/M |
| 3300020581|Ga0210399_10184238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1734 | Open in IMG/M |
| 3300020581|Ga0210399_10204536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1642 | Open in IMG/M |
| 3300020581|Ga0210399_11185587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300020581|Ga0210399_11194369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300020581|Ga0210399_11335468 | Not Available | 563 | Open in IMG/M |
| 3300020582|Ga0210395_10877231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300020583|Ga0210401_10552053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300020583|Ga0210401_10682996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300021088|Ga0210404_10131960 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300021168|Ga0210406_10336861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1219 | Open in IMG/M |
| 3300021171|Ga0210405_10982944 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021180|Ga0210396_10863033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300021180|Ga0210396_11189652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300021401|Ga0210393_10314255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1273 | Open in IMG/M |
| 3300021402|Ga0210385_10488950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300021405|Ga0210387_11418274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300021406|Ga0210386_10115507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2215 | Open in IMG/M |
| 3300021406|Ga0210386_10315173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1342 | Open in IMG/M |
| 3300021407|Ga0210383_10104532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2384 | Open in IMG/M |
| 3300021407|Ga0210383_11004495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 707 | Open in IMG/M |
| 3300021420|Ga0210394_11303061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300021432|Ga0210384_10048120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3885 | Open in IMG/M |
| 3300021433|Ga0210391_10059979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3019 | Open in IMG/M |
| 3300021479|Ga0210410_11223226 | Not Available | 643 | Open in IMG/M |
| 3300021479|Ga0210410_11613731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300021559|Ga0210409_10120208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2415 | Open in IMG/M |
| 3300021559|Ga0210409_11524936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300022518|Ga0224548_1011005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300022557|Ga0212123_10320146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
| 3300022726|Ga0242654_10349868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300022733|Ga0224562_1013236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300025905|Ga0207685_10251526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300025916|Ga0207663_11669705 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025922|Ga0207646_10986960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300025924|Ga0207694_10035755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3810 | Open in IMG/M |
| 3300026532|Ga0209160_1297094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 549 | Open in IMG/M |
| 3300026548|Ga0209161_10256694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300026862|Ga0207724_1015514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300027334|Ga0209529_1024178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
| 3300027609|Ga0209221_1115817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300027641|Ga0208827_1016546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2763 | Open in IMG/M |
| 3300027667|Ga0209009_1193223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 515 | Open in IMG/M |
| 3300027676|Ga0209333_1098370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 797 | Open in IMG/M |
| 3300027676|Ga0209333_1170236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300027678|Ga0209011_1161082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 627 | Open in IMG/M |
| 3300027745|Ga0209908_10149005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300027867|Ga0209167_10624911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300027869|Ga0209579_10745285 | Not Available | 529 | Open in IMG/M |
| 3300027882|Ga0209590_10359609 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300027884|Ga0209275_10064401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1799 | Open in IMG/M |
| 3300027884|Ga0209275_10229838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300027895|Ga0209624_10018359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4440 | Open in IMG/M |
| 3300028563|Ga0265319_1146440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300028747|Ga0302219_10114583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300028747|Ga0302219_10369219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300028773|Ga0302234_10319263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300028783|Ga0302279_10397132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300028906|Ga0308309_10222724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1565 | Open in IMG/M |
| 3300028906|Ga0308309_10491405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300028906|Ga0308309_11036878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300029910|Ga0311369_10772661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300029917|Ga0311326_10448708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300029943|Ga0311340_10171406 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300029943|Ga0311340_10639910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300029992|Ga0302276_10402632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300030007|Ga0311338_11989643 | Not Available | 516 | Open in IMG/M |
| 3300030020|Ga0311344_10930919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300030045|Ga0302282_1377284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 502 | Open in IMG/M |
| 3300030494|Ga0310037_10390789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300030524|Ga0311357_10663774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
| 3300030618|Ga0311354_11140207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300030737|Ga0302310_10592025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300030991|Ga0073994_11842254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300031122|Ga0170822_10273175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300031128|Ga0170823_14003242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300031231|Ga0170824_116375942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300031231|Ga0170824_119541770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300031231|Ga0170824_127919750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300031545|Ga0318541_10830226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300031573|Ga0310915_10516865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300031708|Ga0310686_116348254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1386 | Open in IMG/M |
| 3300031715|Ga0307476_10435651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300031718|Ga0307474_10198971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1524 | Open in IMG/M |
| 3300031718|Ga0307474_10489850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300031719|Ga0306917_11375824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300031740|Ga0307468_100074302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1904 | Open in IMG/M |
| 3300031753|Ga0307477_10863958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300031754|Ga0307475_10035340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3665 | Open in IMG/M |
| 3300031754|Ga0307475_10456032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300031823|Ga0307478_10275558 | Not Available | 1372 | Open in IMG/M |
| 3300031823|Ga0307478_11063776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300031893|Ga0318536_10223050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300031910|Ga0306923_12070594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300031938|Ga0308175_101738330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300031962|Ga0307479_10220130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1871 | Open in IMG/M |
| 3300031962|Ga0307479_11499804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300031962|Ga0307479_11863109 | Not Available | 552 | Open in IMG/M |
| 3300031962|Ga0307479_11926709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 541 | Open in IMG/M |
| 3300032009|Ga0318563_10687181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300032174|Ga0307470_10089964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1724 | Open in IMG/M |
| 3300032180|Ga0307471_102768739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300032205|Ga0307472_100656915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300032205|Ga0307472_101076287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300032421|Ga0310812_10089217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1253 | Open in IMG/M |
| 3300032783|Ga0335079_11954894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300032828|Ga0335080_10814092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300032892|Ga0335081_12597032 | Not Available | 520 | Open in IMG/M |
| 3300032895|Ga0335074_10709224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300033289|Ga0310914_11582637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 559 | Open in IMG/M |
| 3300033402|Ga0326728_10903294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300033405|Ga0326727_10810970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.63% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.88% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.41% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.41% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.47% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.47% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.47% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.47% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.47% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.47% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.47% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.47% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026862 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101560152 | 3300001356 | Peatlands Soil | MPLKSSIERLAALGEIEHDPEARKVFLEFRDQLTQGKIRAAEKITVGR |
| Ga0062386_1002535312 | 3300004152 | Bog Forest Soil | MRSLKTSIERLAALGEVEHNPEARAAFLEFRDALTQGKVR |
| Ga0062386_1010057032 | 3300004152 | Bog Forest Soil | MPSLQSAIERLATLGEVERNPDARKTFLEFRDQLTQGKIRAAEKVNG |
| Ga0066395_110409851 | 3300004633 | Tropical Forest Soil | MQSLRASIERLSSLGEIERDPEARRTFLDFRDQLTTGKIRAAEKVGS |
| Ga0062388_1001068203 | 3300004635 | Bog Forest Soil | MSSLRASIERLAALGEVEHNPEARPAFLEFRDALTQGKIRA |
| Ga0062594_1026732591 | 3300005093 | Soil | MPSLQSAIERLATLGEVERNPDARKTFLEFREQLTQGRIRAAEKSSG |
| Ga0066680_103607292 | 3300005174 | Soil | MSSLKSSIERLAALGEVERNPEAREIFLKFRDELTQGKIRAAE |
| Ga0066388_1030141522 | 3300005332 | Tropical Forest Soil | MHALKTAIERLSSARSIEHAPEARQLFLELREQLTRGKIRAAEKM |
| Ga0070677_102263361 | 3300005333 | Miscanthus Rhizosphere | MPSLQSAIERLATLGEVEHNPDARKTFLEFREQLTQGMIRAAEK |
| Ga0068868_1000961691 | 3300005338 | Miscanthus Rhizosphere | MQTLKAAIERLASLGEVESDPQARTVFLEFRQALTEGKIRAAEKSGD |
| Ga0070669_1005582981 | 3300005353 | Switchgrass Rhizosphere | MQTLKAAIERLASLGEVESDPQARTVFLEFRQALTEGKIRAAEKSGDR |
| Ga0070671_1007715621 | 3300005355 | Switchgrass Rhizosphere | MPSLQSAIERLATLGEVERNPDARKTFLEFREQLTHGMIRAAKKS |
| Ga0070709_103870131 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTLQSAVERLVTLGEVERNPEARATFLEFREQLTLGKIR |
| Ga0070711_1002500432 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSLKSSIERLSAQGEVEHDPNARKTFLEFRDQLTQGKIR |
| Ga0070699_1001802853 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSLQSAIERLATLGEVERNPDARQAFLKFREQLTQGKIRAAE |
| Ga0070699_1020415121 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLKSSIERLSAQGEVEHDPQARKTFLEFRDQLTQGKIRAAEKKDS |
| Ga0070734_101127411 | 3300005533 | Surface Soil | MSTLKSAIEKLAAQGEVERDPDARTTFLEFRDQLTQGKIRAA |
| Ga0066697_100458754 | 3300005540 | Soil | MSSLKAAIQRLASLGEVESNPEARQTFLEFRAQLTQGKIRAAEKIDGQ |
| Ga0070733_108035622 | 3300005541 | Surface Soil | MSTLQSSIERLAAQGEVEHNPEARKTFLEFRDQLTQGKIRAAEK |
| Ga0070733_109947832 | 3300005541 | Surface Soil | MQSLKSLIERLAGLADVEHDPGARETFMEFRDQLTQGKIRAAE |
| Ga0070732_102753361 | 3300005542 | Surface Soil | MSSLKSAIERLAAQGEVEHDPEARKTFLEFRDQLTQGK |
| Ga0070665_1018954072 | 3300005548 | Switchgrass Rhizosphere | MPSLQSAIERLATLGEVEHNPDARKTFLEFREQLT |
| Ga0070762_100546663 | 3300005602 | Soil | MQSLRTSIERLAALGEIEHNPEARPVFLKFRDALTQGE |
| Ga0070762_103106261 | 3300005602 | Soil | MTSLQSSIERLASLGEVEQNPEAREKFLAFRDALTA |
| Ga0070762_103691732 | 3300005602 | Soil | MSSLQSSIERLASLGEVEHDPEARKTFLEFRDHLTQGKIRAAEK |
| Ga0070763_101245102 | 3300005610 | Soil | MQSLKSSIERLAALGEVEHNPEARPAFLEFRTALTQGKIRAAEKI |
| Ga0068864_1010435761 | 3300005618 | Switchgrass Rhizosphere | MPSLQSAIERLATLGEVEHNPDARKTFLEFRDQLTEG |
| Ga0070764_101716502 | 3300005712 | Soil | MPSLKSSIERLAALGEVEHNPEARPLFLEFRDALTQGTIRAAEKIDG |
| Ga0068866_103898821 | 3300005718 | Miscanthus Rhizosphere | MPSLQSAIERLATLGEVERNPDARKTFLEFREQLT |
| Ga0066903_1041462602 | 3300005764 | Tropical Forest Soil | MPPLQSLIEHLASSGEVERNPEARRIFLEFREQLTRGKIRAAEKV |
| Ga0070766_107211391 | 3300005921 | Soil | MSSLQSSIERLAALTEVERDPEARRIFLEFRDALTQGKIRAA |
| Ga0070717_104693151 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSLKTSIERLAALGDLEQNAAARQTFLEFRDALTAGKVRAAEKK |
| Ga0066652_1010778352 | 3300006046 | Soil | MPSLQSAIERLATLGEVERNPEARQTFLRFREKLTLGTIRAADKIN |
| Ga0075017_1001479533 | 3300006059 | Watersheds | MPSLRSAIERLATLGEVERNPDARKTFLEFREQLTKGKIRAAEKIN |
| Ga0075019_104894221 | 3300006086 | Watersheds | MSTLKASIERLAAQGEVEHDPEARKTFLEFRDQLTQ |
| Ga0075015_1002286521 | 3300006102 | Watersheds | MESLKAAIERLASLEVESNPDARQIFMDFRDELTQGKIRAAEKIDG |
| Ga0070765_1020738903 | 3300006176 | Soil | MSSLKSSIEKLSAQGEVERDPEARKTFLEFRDQLTQGRIRAAEKLDGPGKD |
| Ga0066665_114557081 | 3300006796 | Soil | MQSLKTAIERLASMGEVEQKPEAGQVFLEFRDGLT |
| Ga0066660_116549851 | 3300006800 | Soil | MQALKAAIERLASLSEIENDPEARKTFLEFRDALTQGKIRAA |
| Ga0075425_1016267862 | 3300006854 | Populus Rhizosphere | MSPLKASIERLFAQGEVERDPDARKTFLEFRDQLT |
| Ga0075434_1002402913 | 3300006871 | Populus Rhizosphere | MPSLQSAIERLATLGEVERNPEARQTFLKFREQLTG |
| Ga0075434_1021081332 | 3300006871 | Populus Rhizosphere | MPTLQAAIERLATLGEVERNPEARQTFLRFREQLTLGRIRAAEKING |
| Ga0099829_101320761 | 3300009038 | Vadose Zone Soil | MPSLQSPIERLASLDQVERNPDARQIFLDFRDELTQGKIRAAEKIN |
| Ga0099830_115191242 | 3300009088 | Vadose Zone Soil | MQSLKSSIERLAALGEVEHNPDARPVFLEFRDALTQGKIRAAEKIDGR* |
| Ga0099827_100082591 | 3300009090 | Vadose Zone Soil | MPSLQSAIERLATLGEVERNPDARQAFLKFREQLT |
| Ga0099827_106036531 | 3300009090 | Vadose Zone Soil | MQPLKAAIERLASLGEVERNPEARQSFLEFRDALTCGNIRAAEKHGD |
| Ga0116222_10394981 | 3300009521 | Peatlands Soil | MPSLRSSIERLASLGEVEANPEARAVFLDFREQLTQGKIRAAEKI |
| Ga0116105_10389572 | 3300009624 | Peatland | MQSLKTSIERLAALGEVEHNPEARPVFLEFRDALTQGKIRAAEKVDGH |
| Ga0099796_102949822 | 3300010159 | Vadose Zone Soil | MSSLQSAIERLATLGEVERNPDARQTFLEFREQLTQGKIRAAEKI |
| Ga0134071_100545163 | 3300010336 | Grasslands Soil | MSSLKSSIERLAALVEVERNPEAREIFLKFRDELTQ |
| Ga0074044_111490332 | 3300010343 | Bog Forest Soil | MQSLKSSIERLAALGEVEHNPEARPVFLEFRDALTQGTIRAAEKIGGR |
| Ga0126381_1047931502 | 3300010376 | Tropical Forest Soil | MSSLKSSIEKLFAQPDASRQPAAREIFLEFRDQLTQGKVRA |
| Ga0134126_118380512 | 3300010396 | Terrestrial Soil | MSLKDSIERLSTQSEVEHNPEARKTFLEFRDQLTQGQI |
| Ga0134126_120463001 | 3300010396 | Terrestrial Soil | MQTLQSSIERLVALGEIAQHPEARTTFLEFRDALT |
| Ga0134122_115906562 | 3300010400 | Terrestrial Soil | MPSLQSAIERLATLGEVERNPDARKTFLEFREQLTRGKIRAAEK |
| Ga0137389_100318191 | 3300012096 | Vadose Zone Soil | MQPLKAAIERLASLGEVERNPEARQSFLEFRDALTCGKIRAA |
| Ga0137382_113263652 | 3300012200 | Vadose Zone Soil | MQSLKTAIERLASMGEVEQKPEVREIFLEFRDALTQGKGRAAGKHG |
| Ga0150985_1119268252 | 3300012212 | Avena Fatua Rhizosphere | MSLKDSIERLSAQSEVEHDPEARKTFLEFRDQLTQGQIRAA |
| Ga0137358_106827292 | 3300012582 | Vadose Zone Soil | MPSLQSAIERLATLGEVERNPEARQTFLRFREKLTLGRIRAAEKIN |
| Ga0137396_106047051 | 3300012918 | Vadose Zone Soil | MQSLKSSIERLAALGEVEHNPDARPVFLEFRDALTQGKIRAAEK |
| Ga0137359_105553801 | 3300012923 | Vadose Zone Soil | MPSLQSAIERLATLGEVERNPDARKTFLEFREQLTQGKIRA |
| Ga0137359_109199831 | 3300012923 | Vadose Zone Soil | MQSLKTAIERLASMGEVEQKPEARLVFLELRDALTQGKVR |
| Ga0137413_117229992 | 3300012924 | Vadose Zone Soil | MSSLQSAIERLATLGEVERNPDARKTFLEFREQLTQGKIR |
| Ga0137419_108566251 | 3300012925 | Vadose Zone Soil | MQVRVTNQQSMQSLKSSIERLAALGEVEHNPEARPAFLEFRDALTQGKIRAAENIG |
| Ga0137404_119288402 | 3300012929 | Vadose Zone Soil | MPSLQSAIERLATLGEVERNPDARKTFLQFREQLTQ |
| Ga0164298_105521542 | 3300012955 | Soil | MPSLQSAIERLATLGEVEHNPDARKTFLEFREHFTLDMMRAAEKSSGEWKV |
| Ga0164301_108431582 | 3300012960 | Soil | MPSLQSAIERLATLGEVEHNPDDRKTFLEFRKQLTPGII |
| Ga0134087_100644472 | 3300012977 | Grasslands Soil | MSSLKAAIQRLASLGEVESNPEARQTFLEFRDQLTRGKIRAAEKID |
| Ga0157378_107964402 | 3300013297 | Miscanthus Rhizosphere | MSALQSAIERLATLGEVERNSDARNIFLDFREQLTLG |
| Ga0134075_101841032 | 3300014154 | Grasslands Soil | MSSLKAAIQRLASLGEVESNPEARQTFLEFRAQLTQGKIRAAEKIDG |
| Ga0181532_106811001 | 3300014164 | Bog | MQSLKSSIERLASLGEVEHDPDARKTFLEFRDQLTQGKIRAAEKIGEG |
| Ga0137403_114636111 | 3300015264 | Vadose Zone Soil | MPSLKSSIERLSAQGEVEHDPEARKTFLEFRDQLTQGKIRAA |
| Ga0182041_120828932 | 3300016294 | Soil | MPDLKASIEKLSTQPEPERDPNARAIFLELRDQLTQGKIRAAEKV |
| Ga0182032_118758111 | 3300016357 | Soil | MPSLKTAIERLASVSAVEHKPEARQVFEEFLDALTHGKVRAA |
| Ga0134083_101177501 | 3300017659 | Grasslands Soil | MHSLKSAIERLAAARAVERDAEARNVFLDFREQLTHGKIRAAEKIN |
| Ga0187802_104072701 | 3300017822 | Freshwater Sediment | MQSLKSSIERLASLGEVEHKPEAREIFLQFRDQLTRGTI |
| Ga0187806_11855722 | 3300017928 | Freshwater Sediment | MSTLKSSIERLSAQGEIEHDPEARKTFLEFRDQLT |
| Ga0187825_100342473 | 3300017930 | Freshwater Sediment | MQSLKTSIERLASMGEVEQKPEARQVFLEFRDALT |
| Ga0187821_102047592 | 3300017936 | Freshwater Sediment | MSSLKSSIERLASLGEVEHDPDARKTFLEFRDQLTEGKI |
| Ga0187819_101795602 | 3300017943 | Freshwater Sediment | MSTLKSSIERLAAQGEVERDPDARKTFLEFRDQLTQGKIRAA |
| Ga0187779_108700362 | 3300017959 | Tropical Peatland | MSSLKSSIERLAAQGEVEHDPEARQTFLEFRDQLTQGKIRAAEKIVEAGKPGR |
| Ga0187783_112587881 | 3300017970 | Tropical Peatland | MSSLKATIERLASLGDLERNPEARQIFLDFRDQLT |
| Ga0187781_105690043 | 3300017972 | Tropical Peatland | MPLQSSIERLAAPGDLSNNPEARSTFLEFRDALTRGKIRAAEKVK |
| Ga0187780_103583321 | 3300017973 | Tropical Peatland | MPPLQSLIEHLASSGEVERNPEARKIFFEFREQLTRGKIRA |
| Ga0187777_101275341 | 3300017974 | Tropical Peatland | MPPLQSLIEHLASSGEVERNPEARKIFLEFREQLTRGKIRAAEKV |
| Ga0187810_105347251 | 3300018012 | Freshwater Sediment | MSLKSSIERLASLGEVEHDPEALRTFLDFRDQLTQGKIRAAEKV |
| Ga0187872_102986022 | 3300018017 | Peatland | MQSLKTSIERLAALGEVEHNPEARPVFLEFRDALTQGKIRAAEKVD |
| Ga0187766_100130925 | 3300018058 | Tropical Peatland | MSSLKSSIERLAAQGEVEHDPAARQTFLEFREQLTQGKIR |
| Ga0187773_105368292 | 3300018064 | Tropical Peatland | MTSLQSSIERLASLGEIEHNPEARQKFLEFRDALSAGKI |
| Ga0187772_100304735 | 3300018085 | Tropical Peatland | MQSLKSSIERLAALAEPEHDSEARRAFLEFRDQLTQGKIRAAE |
| Ga0187772_101606781 | 3300018085 | Tropical Peatland | MNSLQTAIERLASLGDLDRDATARETFLEFREQLTQGKIRAAEKIDGQ |
| Ga0187772_108041701 | 3300018085 | Tropical Peatland | MSFLKASIERLSALAEVEHDPEARKTFLEFRDQLTQGKIRAAEKGAD |
| Ga0187772_108359062 | 3300018085 | Tropical Peatland | MSLQSSIERLAASGEVEHNPEARPAFFEFRDALTQGKIRAAEKI |
| Ga0187772_112517541 | 3300018085 | Tropical Peatland | MSTLKSSIERLSAQGEVERDPHARQTFLEFRDQLTQ |
| Ga0187769_109907232 | 3300018086 | Tropical Peatland | MQSLKSSIERLAALGEVEHNPEARPVFLEFRDALTQ |
| Ga0187769_112960691 | 3300018086 | Tropical Peatland | MNSLQVAIERLASLGDLESDSTARETFLEFREQLTQGEIRAAEKVAGQ |
| Ga0187771_100673734 | 3300018088 | Tropical Peatland | MSSLRSSIERLAALGEVEHDPEARKTFLEFRDQLTQGKIRAAEKGVDPGNPG |
| Ga0187771_111306951 | 3300018088 | Tropical Peatland | MNALQTAIERLASVGDLERDSTARETFLEFREQLTQGRI |
| Ga0066655_101515731 | 3300018431 | Grasslands Soil | MSLKNSIERLSAQGEVEHDPEARKLFLEFRDQLTQ |
| Ga0066662_102027761 | 3300018468 | Grasslands Soil | MPSLEASIERLSALSEIGRDPEARKIFLQFRDALTQGKIRAA |
| Ga0210403_114883771 | 3300020580 | Soil | MQSLKASIERLAALGEVERNPEARRAFLEFRDALTQGKIRAAEKIPNEKGEARWIV |
| Ga0210399_101842383 | 3300020581 | Soil | MPSLQSSIERLAAQGEVEHDPDARRIFLEFRDQLTQGKIRAAEPIGG |
| Ga0210399_102045361 | 3300020581 | Soil | MSSLKSSIERLASLGEVEHDPDARKTFLEFRDQLTQGKIRAAEKRAESKD |
| Ga0210399_111855871 | 3300020581 | Soil | MQSLRTSIERLAALGEVEHNPEARPVFLKFRDALTQGKIRAAEKID |
| Ga0210399_111943691 | 3300020581 | Soil | MQSLKSSIEHFAAQDEVEHDPDARKTFLEFRDALTQGTI |
| Ga0210399_113354681 | 3300020581 | Soil | MQSLKISIERFAALGEVEHNPEARPAFLEFREALTQGKIRAAEKI |
| Ga0210395_108772311 | 3300020582 | Soil | MESLKTSIEHFSALGEVERNPEARSAFVEFRDALTRGKIRAAE |
| Ga0210401_105520531 | 3300020583 | Soil | MQPLKSSIERLSALGEVEHNPEARQVFLEFRDALTQGKIRA |
| Ga0210401_106829961 | 3300020583 | Soil | MSSLKSAIERLAAQGEVEHDPDARKTFLEFRDQLTQGKIRA |
| Ga0210404_101319601 | 3300021088 | Soil | MQSLKTSIERLALMGEVEQKPEARRTFLEFRDALTQGKIRAAE |
| Ga0210406_103368611 | 3300021168 | Soil | MSSLKSSIERLASLGEVEHDPDARKTFLEFRDQLTQGK |
| Ga0210405_109829441 | 3300021171 | Soil | MQSLKTSIERLASMGEVEQKPEARRTFLEFRDALTQ |
| Ga0210396_108630332 | 3300021180 | Soil | MPSLQSAIKRLATLGEVERNPEARQTFLDFRQQLTQGKIRA |
| Ga0210396_111896521 | 3300021180 | Soil | MPSLKSSIERLAALGEVEHNPEARPLFLEFRDALTQGKV |
| Ga0210393_103142552 | 3300021401 | Soil | MSSLKSSIERLASLGEVEHDPEARKTFLEFRDHLTQGKIRAAEKVG |
| Ga0210385_104889501 | 3300021402 | Soil | MSSLKSSIERLASLGEVEHDPEARKTFLEFRDHLT |
| Ga0210387_114182741 | 3300021405 | Soil | MQSLKTSIERLAALGEVEHNPEARPAFLEFRDALTHGKIRAAE |
| Ga0210386_101155074 | 3300021406 | Soil | MSSLKSSIERLSSMGEVEHDPEARKTFLEFREQLTQGEI |
| Ga0210386_103151732 | 3300021406 | Soil | MSLQSYIERLAALGEVEHDPQARKTFLEFRDQLTQGKIRAAEKNH |
| Ga0210383_101045324 | 3300021407 | Soil | MSSLKSSIERLASLGEVEHDPDARKTFLEFRDQLTQGKI |
| Ga0210383_110044951 | 3300021407 | Soil | MQSLKSSIERLAALGEVERNPEARPAFLEFRDALTQGKIRAAEKID |
| Ga0210394_113030612 | 3300021420 | Soil | MQSLKSSIEHFAAQGEVEHDPDARKAFLKFRDALTRG |
| Ga0210384_100481201 | 3300021432 | Soil | MPSLQSVIERLATLGEVERNPDARKTFLEFREQLTQGKIRAAEKSRG |
| Ga0210391_100599791 | 3300021433 | Soil | MQSLKTSIERLAALGEVEHNPEARPAFFEFRDALTQGKIRAAEKI |
| Ga0210410_112232262 | 3300021479 | Soil | MQSLKTSIERLAALGEVEHNPDARSVFLEFRDALTQGKIRAAEKID |
| Ga0210410_116137312 | 3300021479 | Soil | MSSLKSSIERLSALANVERDPDARRVFLEFRDQLTQG |
| Ga0210409_101202084 | 3300021559 | Soil | MSSLKSSIERLAAQGEVEHDPDARRTFLEFRDQLTQGKIRAAEKINN |
| Ga0210409_115249362 | 3300021559 | Soil | MQSLKTSIERLAALGEVEHNPDARPVFLEFRDALTQGKIRAA |
| Ga0224548_10110051 | 3300022518 | Soil | MSSLKSSIERLASLGEVEHDPDARRIFLDFRDQLTHGKIRAAEK |
| Ga0212123_103201462 | 3300022557 | Iron-Sulfur Acid Spring | MPSLQSSIERLAAQGEVEHDPDARRIFLEFRDQLTQGKIRAAEPIGGG |
| Ga0242654_103498681 | 3300022726 | Soil | MQSLRTSIERLAALGEVEHNPEARPVFLKFRDALTQGKI |
| Ga0224562_10132362 | 3300022733 | Soil | MQSLKSSIERLAAQGEVEHNPEARPAFLEFRDALTQGKIRA |
| Ga0207685_102515262 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALQSAIERLATLGEVERNSDARNIFLDFREQLTLGKIRAAEK |
| Ga0207663_116697052 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSLQTSIERLSSLGEIEHRPDARETFLAFRDALTQGKVRAA |
| Ga0207646_109869602 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSLQSAIERLATLGEVERNPDARQAFLKFREQFIHKKTAATEKINGQ |
| Ga0207694_100357551 | 3300025924 | Corn Rhizosphere | MSSLQVAIERLATLGEVEQNPDARKTFLEFREQLTK |
| Ga0209160_12970942 | 3300026532 | Soil | MHSLKSSIERLAALGEVEHDPSARATFLEFRAALTQGQIRAAEKLKGR |
| Ga0209161_102566942 | 3300026548 | Soil | MSSLKSSIERLAALGEVERNPEARETFLKFRDELTQGKIRASE |
| Ga0207724_10155141 | 3300026862 | Tropical Forest Soil | MPTLKSAIERLAAQGEVEHDPEARKTFLEFRDQLTQGK |
| Ga0209529_10241781 | 3300027334 | Forest Soil | MASLQSSIERFAALGEVEHDPEARRVFFEFRDALTQGKIRAAQRP |
| Ga0209221_11158172 | 3300027609 | Forest Soil | MSSLQSSIECFAALGEVEHDPEARRVFVEFRDALTQGKIRAAQRRAGPSK |
| Ga0208827_10165464 | 3300027641 | Peatlands Soil | MQSLKSSIERLAALGEVEHNPEARAAFLEFRDALTQGKIRAAEK |
| Ga0209009_11932231 | 3300027667 | Forest Soil | MQSLRTSIERLAALGEVEHNPEARPAFFEFRDALTQG |
| Ga0209333_10983701 | 3300027676 | Forest Soil | VRLAALGEVEHNPEARPVFLEFRDALTQGKVRAAEKI |
| Ga0209333_11702361 | 3300027676 | Forest Soil | MQSLKTSIERLAALGEVEHNPEARPAFLEFRDALTQGKIRAAEKIRNEKGED |
| Ga0209011_11610821 | 3300027678 | Forest Soil | MHALKTSIERLAALGEVEHDPSARATFLEFRDALTQGKIRAA |
| Ga0209908_101490051 | 3300027745 | Thawing Permafrost | MQSLKSSIERLAALGEVEHNPEARPAFFAFRDALTQGKIRATEKIDGRWV |
| Ga0209167_106249111 | 3300027867 | Surface Soil | MQSLKSLIERLAGLADVEHDPGARETFMEFRDQLTQGKIRAAEKLDGRW |
| Ga0209579_107452852 | 3300027869 | Surface Soil | MSNLKSSIERLAAQGEVERDPDARKTFLEFRDQLTQG |
| Ga0209590_103596093 | 3300027882 | Vadose Zone Soil | MSSLQSAIERLATLGEVEQNPDARKTFLEFREQLTQGKVRAAE |
| Ga0209275_100644011 | 3300027884 | Soil | MQSLKSSIERLAALGEVERNPEARPTFLEFRDALTQGKIRAAEKIPNQKGEA |
| Ga0209275_102298381 | 3300027884 | Soil | MTSLQSSIERLASLGEVEQNPEAREKFLAFRDALTAGK |
| Ga0209624_100183595 | 3300027895 | Forest Soil | MQSLKTSIERLAALGEVEHNPEARPAFFEFRDALTQ |
| Ga0265319_11464401 | 3300028563 | Rhizosphere | MPSLQSAIERLAMLGEVERNPDARNTFLDFREQLTLGKIRAA |
| Ga0302219_101145832 | 3300028747 | Palsa | MSSLKTSIERLAALGEVEHNPDARRLFLEFRDQLTRGNIRSAE |
| Ga0302219_103692191 | 3300028747 | Palsa | MQSLKTSIERLAALGEVEHNPEARPAFLEFRDALTQG |
| Ga0302234_103192631 | 3300028773 | Palsa | MSSLKTSIERLAALGEVEHNPDARRLFLEFRDQLTRG |
| Ga0302279_103971321 | 3300028783 | Bog | MPSLKSSIERLAALGEVEHNPEARPTFFEFRDALTQGKI |
| Ga0308309_102227243 | 3300028906 | Soil | MQSLKSSIECLAAQGEVEHDPEARKTFLEFRDQLTGGK |
| Ga0308309_104914051 | 3300028906 | Soil | MSSLKSSIERLASLGEVEHDPDARKTFLEFRDQLTQGKIRAAEKRAESKNA |
| Ga0308309_110368782 | 3300028906 | Soil | MSLKNQIERLAAQGEVEHNPEARFTFLEFRDQLTQGKIRAAEKT |
| Ga0311369_107726611 | 3300029910 | Palsa | MPSLKLSIERLAAQGEVEHDPEVRRTFLEFRDQLTQGKIRAAEKIGEGKD |
| Ga0311326_104487082 | 3300029917 | Bog | MQSLKTSVERLAAQGEVEHNPEARPVFLEFRDALTQGKI |
| Ga0311340_101714065 | 3300029943 | Palsa | MTSLQSSIERLAALGEVGHDPEARRIFLEFRDALTQGTIRAAEKLE |
| Ga0311340_106399101 | 3300029943 | Palsa | MSLKSSIERLAASGEVESNPEARQTFLEFRAQLTAGKI |
| Ga0302276_104026321 | 3300029992 | Bog | MQSLKASIERLAALGEVEHNPEARPVFLEFRDALTQGTIRAAEQI |
| Ga0311338_119896431 | 3300030007 | Palsa | MQSLKLSIERLAALGEVEHNPEARPTFLEFRDALTRGKI |
| Ga0311344_109309191 | 3300030020 | Bog | MQSLKSSIERLAAQGEVEHNPEARPAFFEFRDALTQGKIRAAEKI |
| Ga0302282_13772841 | 3300030045 | Fen | MQSLKSSIERLAAQGEVEHNPEARPAFFEFRDALTQGKIRAAEKIVDSSDRSR |
| Ga0310037_103907891 | 3300030494 | Peatlands Soil | MSSLKSSIERLASLGEVEHDPEALRTFLDFRDQLTQ |
| Ga0311357_106637742 | 3300030524 | Palsa | MPSLKASIERLAALGEVEHNPEARPAFLEFRDALTQ |
| Ga0311354_111402072 | 3300030618 | Palsa | MSSLKPSIERLAALGEVEYNPEARLAFLEFRDALTQGKIR |
| Ga0302310_105920251 | 3300030737 | Palsa | MPSLKLSIERLAAQGEVEHDPEVRRTFLEFRDQLTQGKIRAAEKIGEGKDA |
| Ga0073994_118422541 | 3300030991 | Soil | MSSLKSSIERLAALGEVERNPEARPTFFEFRDQLTQG |
| Ga0170822_102731751 | 3300031122 | Forest Soil | MSSLKSSIERLASQGEVEHDPEARKTFLEFRDQLTQGKIRAAEKIGDKKRRPMDR |
| Ga0170823_140032423 | 3300031128 | Forest Soil | MFSLKATIERLASQGEVEHDPEARKTFLEFRDQLTAGKIRAAEN |
| Ga0170824_1163759422 | 3300031231 | Forest Soil | MSLKSSIEHLATQGEVEHDPEARKTFLEFRDQLTQGKVRA |
| Ga0170824_1195417702 | 3300031231 | Forest Soil | MSSLKSSIERLASQGEVEHDPEARKTFLEFRDQLTQGKIRAAEKV |
| Ga0170824_1279197502 | 3300031231 | Forest Soil | MQSLRTSIERLAALGEVEHNPEARPVFLEFREALTRGKI |
| Ga0318541_108302262 | 3300031545 | Soil | MPRLQSLIERLASSGEVERNPEARKIFLEFREQLTLGKIRAAEK |
| Ga0310915_105168652 | 3300031573 | Soil | MPRLQSFIERLASSVEVERNPEARKIFLEFREQLTLGKI |
| Ga0310686_1163482541 | 3300031708 | Soil | MQSLKTSIERLAAQGEVEHNPEARPAFLEFRDALTQGKIRAAEKIDG |
| Ga0307476_104356511 | 3300031715 | Hardwood Forest Soil | MQSLKSSIERLAALGEVEHNPEARPVFLEFRDALTQG |
| Ga0307474_101989711 | 3300031718 | Hardwood Forest Soil | MQSLKSSIERLAALGEVEHNPEARPVFLEFRDALTQGKIRA |
| Ga0307474_104898502 | 3300031718 | Hardwood Forest Soil | MQSLKSSIERLAALGEVEHNPEARPVFFEFRDALTQGKIRAAEKVDGR |
| Ga0306917_113758241 | 3300031719 | Soil | MPDLKASIEKLSTQPEPERDPNARAIFLELRDQLTQGKIR |
| Ga0307468_1000743023 | 3300031740 | Hardwood Forest Soil | MSALQSAIERLATLGEVERNSDARNIFLDFREQLTLGKIRAAEKIN |
| Ga0307477_108639582 | 3300031753 | Hardwood Forest Soil | MSSLKVSIERLAAQGEVEHDPEARKKFLEFRDQLTQGK |
| Ga0307475_100353404 | 3300031754 | Hardwood Forest Soil | MNSLKSSIEQLASMGEVEQKPEARQVFLEFRDALTQ |
| Ga0307475_104560322 | 3300031754 | Hardwood Forest Soil | MQSLKSSIERLAALGEVEYNPEARPAFFEFRDALTKGTIRAAEKI |
| Ga0307478_102755582 | 3300031823 | Hardwood Forest Soil | MPSLKSSIERLAALGEVERNPEARAIFLEFRDALT |
| Ga0307478_110637762 | 3300031823 | Hardwood Forest Soil | MPASLKSSIERLAAQGEVERDPDARRIFLEFRDRLTQGKIRA |
| Ga0318536_102230502 | 3300031893 | Soil | MTTLQSAIERLAALGEIERDPDARQKFFEFRDALTAGKIRAAEK |
| Ga0306923_120705942 | 3300031910 | Soil | MPRLQSFIERLASSVEVERNPEARKIFLEFREQLTLGKIRA |
| Ga0308175_1017383302 | 3300031938 | Soil | MHPLQAAIERLAALEKLENNPEARGIFLQFRDQLTQGKIRAAEKIENT |
| Ga0307479_102201301 | 3300031962 | Hardwood Forest Soil | MSSLKSSIERLASLGEVEHDPEALRTFLDFRDQLTQGKIR |
| Ga0307479_114998041 | 3300031962 | Hardwood Forest Soil | MQSLKTSIERLAALGEVEHNPEARPAFLEFREALTQGKIRA |
| Ga0307479_118631091 | 3300031962 | Hardwood Forest Soil | VSLKSSIERLAAVGEVERNPEARPTFFKFRDELTRGKIR |
| Ga0307479_119267092 | 3300031962 | Hardwood Forest Soil | MQSLKTSIERLAALGEVEHNPEARALFLEFRDGLTYGKIRA |
| Ga0318563_106871811 | 3300032009 | Soil | MTSLKASIEHLASLGEVERDPEARKTFLEFRDALTRGKVRAAE |
| Ga0307470_100899641 | 3300032174 | Hardwood Forest Soil | MKSLKASIERLASSGEVERNPEARQTFLEFRGALTQGKVRAAEKKD |
| Ga0307471_1027687391 | 3300032180 | Hardwood Forest Soil | MRSLKTSIERLAALGEVERNPEARPTFLKFRDALTQGKIRAAE |
| Ga0307472_1006569152 | 3300032205 | Hardwood Forest Soil | MSSLQSAIERLATLGEVERNPDARKTFLEFRGQLTQGKIRAAEKIN |
| Ga0307472_1010762872 | 3300032205 | Hardwood Forest Soil | MSILKASIERLSAQGEVEHDAEARKVFLEFRDQLTQGKIRAAEKIDG |
| Ga0310812_100892172 | 3300032421 | Soil | MQTLKAAIERLASLGEVESDPQARTVFLEFRQALTEGKIRAAEKYGDR |
| Ga0335085_100827931 | 3300032770 | Soil | MPSLQPEIQRLASLGSIEHNDHARRTFLEFREALTRGEIRAAEKIDG |
| Ga0335079_119548941 | 3300032783 | Soil | MSSLKSSIERLASLGEVEHDPDARKTFLEFRDQLTQGKIRAAEKVGAGKDARWT |
| Ga0335080_108140922 | 3300032828 | Soil | MSLKAAIERLSAQGEVERDPGARKTFLEFRDQLTQGK |
| Ga0335081_125970321 | 3300032892 | Soil | MSTLKAAIERLSGQSEPSPEARETFLEFRDRLTQGKIRAAEKGVDPAN |
| Ga0335074_107092242 | 3300032895 | Soil | MQSLKSSIERFAALTAIDGNPEARSTFLEFRDALTQGKIRAAEK |
| Ga0310914_115826372 | 3300033289 | Soil | MQSLKTAIERLASSSTVEPKPEARQVFEEFIDALTHGK |
| Ga0326728_109032942 | 3300033402 | Peat Soil | MPDLKSSIERLSALGKVERDPEARRTFLEFRDQLTQGKIRAAEK |
| Ga0326727_108109701 | 3300033405 | Peat Soil | MPSLQSSIERLSAQSGVEHDPEARATFLEFRDQLTQGKIRAAEKGVDPE |
| ⦗Top⦘ |