| Basic Information | |
|---|---|
| Family ID | F022677 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 213 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDAKQGAALSNLEMAVFGAA |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 213 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.50 % |
| % of genes near scaffold ends (potentially truncated) | 43.66 % |
| % of genes from short scaffolds (< 2000 bps) | 84.04 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.155 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.596 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.418 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.399 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.00% β-sheet: 6.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 213 Family Scaffolds |
|---|---|---|
| PF01068 | DNA_ligase_A_M | 12.68 |
| PF02735 | Ku | 4.69 |
| PF00884 | Sulfatase | 2.35 |
| PF10609 | ParA | 0.94 |
| PF00486 | Trans_reg_C | 0.47 |
| PF02550 | AcetylCoA_hydro | 0.47 |
| PF04226 | Transgly_assoc | 0.47 |
| PF01594 | AI-2E_transport | 0.47 |
| PF01391 | Collagen | 0.47 |
| PF09694 | Gcw_chp | 0.47 |
| PF01883 | FeS_assembly_P | 0.47 |
| PF06463 | Mob_synth_C | 0.47 |
| PF09361 | Phasin_2 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 213 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 12.68 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 12.68 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 4.69 |
| COG0427 | Propionyl CoA:succinate CoA transferase | Energy production and conversion [C] | 0.47 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.47 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.47 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.15 % |
| Unclassified | root | N/A | 40.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01BH0E7 | Not Available | 509 | Open in IMG/M |
| 2088090014|GPIPI_16602328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
| 3300000881|JGI10215J12807_1095630 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300001431|F14TB_100073362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300002070|JGI24750J21931_1066254 | Not Available | 584 | Open in IMG/M |
| 3300002459|JGI24751J29686_10051870 | Not Available | 847 | Open in IMG/M |
| 3300004633|Ga0066395_10568882 | Not Available | 661 | Open in IMG/M |
| 3300004803|Ga0058862_12669513 | Not Available | 505 | Open in IMG/M |
| 3300005329|Ga0070683_100260409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1650 | Open in IMG/M |
| 3300005332|Ga0066388_101408235 | Not Available | 1212 | Open in IMG/M |
| 3300005332|Ga0066388_103428770 | Not Available | 810 | Open in IMG/M |
| 3300005332|Ga0066388_104517800 | Not Available | 709 | Open in IMG/M |
| 3300005340|Ga0070689_100217589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1566 | Open in IMG/M |
| 3300005347|Ga0070668_100036362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3758 | Open in IMG/M |
| 3300005347|Ga0070668_100473497 | Not Available | 1080 | Open in IMG/M |
| 3300005355|Ga0070671_100351289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1258 | Open in IMG/M |
| 3300005356|Ga0070674_101183913 | Not Available | 678 | Open in IMG/M |
| 3300005366|Ga0070659_100011374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6582 | Open in IMG/M |
| 3300005367|Ga0070667_100628557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 990 | Open in IMG/M |
| 3300005434|Ga0070709_10118520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1790 | Open in IMG/M |
| 3300005434|Ga0070709_10158058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1573 | Open in IMG/M |
| 3300005434|Ga0070709_11337594 | Not Available | 579 | Open in IMG/M |
| 3300005444|Ga0070694_101411254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300005455|Ga0070663_100035840 | All Organisms → cellular organisms → Bacteria | 3444 | Open in IMG/M |
| 3300005455|Ga0070663_100207815 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300005455|Ga0070663_101809218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300005457|Ga0070662_100141073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1867 | Open in IMG/M |
| 3300005471|Ga0070698_100329068 | Not Available | 1459 | Open in IMG/M |
| 3300005530|Ga0070679_100240133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1769 | Open in IMG/M |
| 3300005530|Ga0070679_100311272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1524 | Open in IMG/M |
| 3300005530|Ga0070679_100477079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1191 | Open in IMG/M |
| 3300005539|Ga0068853_101613366 | Not Available | 629 | Open in IMG/M |
| 3300005544|Ga0070686_100329133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1141 | Open in IMG/M |
| 3300005544|Ga0070686_100415297 | Not Available | 1027 | Open in IMG/M |
| 3300005546|Ga0070696_100393539 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005548|Ga0070665_100180207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 2114 | Open in IMG/M |
| 3300005564|Ga0070664_102278821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300005577|Ga0068857_100078321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2950 | Open in IMG/M |
| 3300005577|Ga0068857_100215081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1754 | Open in IMG/M |
| 3300005577|Ga0068857_100929690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 835 | Open in IMG/M |
| 3300005718|Ga0068866_10084923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1709 | Open in IMG/M |
| 3300005764|Ga0066903_101678927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1208 | Open in IMG/M |
| 3300005841|Ga0068863_100104636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2693 | Open in IMG/M |
| 3300005843|Ga0068860_100079225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3123 | Open in IMG/M |
| 3300006049|Ga0075417_10134435 | Not Available | 1143 | Open in IMG/M |
| 3300006049|Ga0075417_10192216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Mongoliimonas → Mongoliimonas terrestris | 963 | Open in IMG/M |
| 3300006237|Ga0097621_100307647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1401 | Open in IMG/M |
| 3300006755|Ga0079222_10003913 | All Organisms → cellular organisms → Bacteria | 4769 | Open in IMG/M |
| 3300006755|Ga0079222_10420491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| 3300006806|Ga0079220_10149624 | Not Available | 1286 | Open in IMG/M |
| 3300006844|Ga0075428_101443989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
| 3300006845|Ga0075421_100632967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1253 | Open in IMG/M |
| 3300006852|Ga0075433_11301565 | Not Available | 630 | Open in IMG/M |
| 3300006852|Ga0075433_11313701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300006853|Ga0075420_100538948 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300006854|Ga0075425_100229813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2134 | Open in IMG/M |
| 3300006880|Ga0075429_100564189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300006914|Ga0075436_101413400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300006969|Ga0075419_10246303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1194 | Open in IMG/M |
| 3300007076|Ga0075435_101379598 | Not Available | 617 | Open in IMG/M |
| 3300009011|Ga0105251_10033870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2531 | Open in IMG/M |
| 3300009092|Ga0105250_10059180 | Not Available | 1538 | Open in IMG/M |
| 3300009092|Ga0105250_10604586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300009094|Ga0111539_10263007 | Not Available | 2008 | Open in IMG/M |
| 3300009094|Ga0111539_10774342 | Not Available | 1117 | Open in IMG/M |
| 3300009094|Ga0111539_12628909 | Not Available | 584 | Open in IMG/M |
| 3300009094|Ga0111539_12861403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 559 | Open in IMG/M |
| 3300009100|Ga0075418_10854195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 983 | Open in IMG/M |
| 3300009100|Ga0075418_11516547 | Not Available | 727 | Open in IMG/M |
| 3300009100|Ga0075418_11905277 | Not Available | 647 | Open in IMG/M |
| 3300009100|Ga0075418_11994114 | Not Available | 632 | Open in IMG/M |
| 3300009148|Ga0105243_10182050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1828 | Open in IMG/M |
| 3300009156|Ga0111538_10182297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2666 | Open in IMG/M |
| 3300009156|Ga0111538_10538185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1480 | Open in IMG/M |
| 3300009156|Ga0111538_10772519 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300009156|Ga0111538_13187021 | Not Available | 571 | Open in IMG/M |
| 3300009162|Ga0075423_10047754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4400 | Open in IMG/M |
| 3300009162|Ga0075423_10207459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2055 | Open in IMG/M |
| 3300009162|Ga0075423_10515770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1257 | Open in IMG/M |
| 3300009174|Ga0105241_10331714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1315 | Open in IMG/M |
| 3300009176|Ga0105242_10145378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2062 | Open in IMG/M |
| 3300009177|Ga0105248_10091694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3422 | Open in IMG/M |
| 3300009177|Ga0105248_11454705 | Not Available | 776 | Open in IMG/M |
| 3300009545|Ga0105237_10562476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1147 | Open in IMG/M |
| 3300009545|Ga0105237_10971631 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300009551|Ga0105238_10105483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2800 | Open in IMG/M |
| 3300009553|Ga0105249_11415957 | Not Available | 767 | Open in IMG/M |
| 3300009553|Ga0105249_12080881 | Not Available | 640 | Open in IMG/M |
| 3300009553|Ga0105249_12702089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300010375|Ga0105239_11696563 | Not Available | 731 | Open in IMG/M |
| 3300010396|Ga0134126_10045091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 5539 | Open in IMG/M |
| 3300010396|Ga0134126_10463036 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300010396|Ga0134126_11172455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
| 3300010397|Ga0134124_10339323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1412 | Open in IMG/M |
| 3300010399|Ga0134127_10005653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9057 | Open in IMG/M |
| 3300011119|Ga0105246_10101399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2097 | Open in IMG/M |
| 3300012022|Ga0120191_10008683 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300012882|Ga0157304_1016707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300012882|Ga0157304_1029960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
| 3300012885|Ga0157287_1059573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 623 | Open in IMG/M |
| 3300012891|Ga0157305_10202021 | Not Available | 571 | Open in IMG/M |
| 3300012892|Ga0157294_10147656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 650 | Open in IMG/M |
| 3300012893|Ga0157284_10022248 | Not Available | 1245 | Open in IMG/M |
| 3300012895|Ga0157309_10025023 | Not Available | 1338 | Open in IMG/M |
| 3300012896|Ga0157303_10009744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1425 | Open in IMG/M |
| 3300012897|Ga0157285_10003317 | All Organisms → cellular organisms → Bacteria | 2827 | Open in IMG/M |
| 3300012897|Ga0157285_10276514 | Not Available | 562 | Open in IMG/M |
| 3300012898|Ga0157293_10038074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1010 | Open in IMG/M |
| 3300012898|Ga0157293_10089761 | Not Available | 772 | Open in IMG/M |
| 3300012899|Ga0157299_10031943 | Not Available | 1079 | Open in IMG/M |
| 3300012899|Ga0157299_10090730 | Not Available | 772 | Open in IMG/M |
| 3300012900|Ga0157292_10088679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 902 | Open in IMG/M |
| 3300012902|Ga0157291_10044312 | Not Available | 1025 | Open in IMG/M |
| 3300012902|Ga0157291_10090351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300012902|Ga0157291_10131932 | Not Available | 721 | Open in IMG/M |
| 3300012902|Ga0157291_10332399 | Not Available | 539 | Open in IMG/M |
| 3300012903|Ga0157289_10135822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 743 | Open in IMG/M |
| 3300012906|Ga0157295_10060538 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300012906|Ga0157295_10080362 | Not Available | 851 | Open in IMG/M |
| 3300012910|Ga0157308_10237159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Mongoliimonas → Mongoliimonas terrestris | 636 | Open in IMG/M |
| 3300012911|Ga0157301_10057450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1025 | Open in IMG/M |
| 3300012911|Ga0157301_10118084 | Not Available | 804 | Open in IMG/M |
| 3300012911|Ga0157301_10207641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300012911|Ga0157301_10314439 | Not Available | 577 | Open in IMG/M |
| 3300012913|Ga0157298_10022751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1206 | Open in IMG/M |
| 3300012914|Ga0157297_10401349 | Not Available | 549 | Open in IMG/M |
| 3300012915|Ga0157302_10044517 | Not Available | 1231 | Open in IMG/M |
| 3300012915|Ga0157302_10068786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300012961|Ga0164302_10031769 | Not Available | 2434 | Open in IMG/M |
| 3300013096|Ga0157307_1070218 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300013102|Ga0157371_10087101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2212 | Open in IMG/M |
| 3300013296|Ga0157374_11357305 | Not Available | 733 | Open in IMG/M |
| 3300013296|Ga0157374_12815402 | Not Available | 514 | Open in IMG/M |
| 3300013306|Ga0163162_10276552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1811 | Open in IMG/M |
| 3300013306|Ga0163162_10664893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1165 | Open in IMG/M |
| 3300013306|Ga0163162_11205870 | Not Available | 859 | Open in IMG/M |
| 3300015200|Ga0173480_10056057 | Not Available | 1788 | Open in IMG/M |
| 3300015200|Ga0173480_10072370 | Not Available | 1607 | Open in IMG/M |
| 3300015201|Ga0173478_10010114 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300015201|Ga0173478_10336128 | Not Available | 699 | Open in IMG/M |
| 3300015201|Ga0173478_10591447 | Not Available | 574 | Open in IMG/M |
| 3300015371|Ga0132258_10049135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9634 | Open in IMG/M |
| 3300015373|Ga0132257_103587166 | Not Available | 565 | Open in IMG/M |
| 3300017792|Ga0163161_11532471 | Not Available | 586 | Open in IMG/M |
| 3300019356|Ga0173481_10013449 | Not Available | 2364 | Open in IMG/M |
| 3300019356|Ga0173481_10063921 | Not Available | 1309 | Open in IMG/M |
| 3300019356|Ga0173481_10162553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300019356|Ga0173481_10443388 | Not Available | 647 | Open in IMG/M |
| 3300019361|Ga0173482_10030116 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300019361|Ga0173482_10094272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Mongoliimonas → Mongoliimonas terrestris | 1074 | Open in IMG/M |
| 3300019362|Ga0173479_10047579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1391 | Open in IMG/M |
| 3300022880|Ga0247792_1022262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1064 | Open in IMG/M |
| 3300022883|Ga0247786_1069763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300022883|Ga0247786_1091987 | Not Available | 650 | Open in IMG/M |
| 3300022883|Ga0247786_1152928 | Not Available | 521 | Open in IMG/M |
| 3300022886|Ga0247746_1032993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
| 3300022899|Ga0247795_1093064 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300022901|Ga0247788_1019106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1191 | Open in IMG/M |
| 3300022915|Ga0247790_10025084 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300023062|Ga0247791_1077268 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300023069|Ga0247751_1076509 | Not Available | 585 | Open in IMG/M |
| 3300023102|Ga0247754_1021364 | Not Available | 1417 | Open in IMG/M |
| 3300023102|Ga0247754_1100508 | Not Available | 699 | Open in IMG/M |
| 3300023261|Ga0247796_1017804 | Not Available | 1080 | Open in IMG/M |
| 3300023263|Ga0247800_1007519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1642 | Open in IMG/M |
| 3300025900|Ga0207710_10103430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1346 | Open in IMG/M |
| 3300025904|Ga0207647_10268204 | Not Available | 976 | Open in IMG/M |
| 3300025905|Ga0207685_10648740 | Not Available | 571 | Open in IMG/M |
| 3300025906|Ga0207699_10052701 | Not Available | 2409 | Open in IMG/M |
| 3300025910|Ga0207684_10941834 | Not Available | 724 | Open in IMG/M |
| 3300025913|Ga0207695_10275596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1577 | Open in IMG/M |
| 3300025913|Ga0207695_10747740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 858 | Open in IMG/M |
| 3300025923|Ga0207681_10320008 | Not Available | 1233 | Open in IMG/M |
| 3300025926|Ga0207659_11863416 | Not Available | 510 | Open in IMG/M |
| 3300025927|Ga0207687_10212416 | Not Available | 1519 | Open in IMG/M |
| 3300025928|Ga0207700_11928099 | Not Available | 517 | Open in IMG/M |
| 3300025932|Ga0207690_10582372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 912 | Open in IMG/M |
| 3300025934|Ga0207686_10825296 | Not Available | 744 | Open in IMG/M |
| 3300025936|Ga0207670_10178406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1598 | Open in IMG/M |
| 3300025941|Ga0207711_10081750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2823 | Open in IMG/M |
| 3300025945|Ga0207679_10131853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2006 | Open in IMG/M |
| 3300025960|Ga0207651_10098230 | Not Available | 2164 | Open in IMG/M |
| 3300025960|Ga0207651_10155981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1783 | Open in IMG/M |
| 3300025981|Ga0207640_10156995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1678 | Open in IMG/M |
| 3300026067|Ga0207678_10067756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3063 | Open in IMG/M |
| 3300026067|Ga0207678_10502324 | Not Available | 1057 | Open in IMG/M |
| 3300026075|Ga0207708_10071859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2651 | Open in IMG/M |
| 3300026751|Ga0207594_105896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300026836|Ga0207612_1002220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
| 3300027695|Ga0209966_1115417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300027765|Ga0209073_10120698 | Not Available | 944 | Open in IMG/M |
| 3300027775|Ga0209177_10137325 | Not Available | 816 | Open in IMG/M |
| 3300027775|Ga0209177_10212160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300027787|Ga0209074_10174864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300027787|Ga0209074_10286254 | Not Available | 654 | Open in IMG/M |
| 3300027873|Ga0209814_10200637 | Not Available | 862 | Open in IMG/M |
| 3300027909|Ga0209382_10548009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1267 | Open in IMG/M |
| 3300027909|Ga0209382_10604691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300027909|Ga0209382_11192333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 779 | Open in IMG/M |
| 3300027909|Ga0209382_11880543 | Not Available | 579 | Open in IMG/M |
| 3300027992|Ga0247750_1041702 | Not Available | 518 | Open in IMG/M |
| 3300028379|Ga0268266_10077871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 2884 | Open in IMG/M |
| 3300028381|Ga0268264_10860478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 908 | Open in IMG/M |
| 3300031847|Ga0310907_10016588 | Not Available | 2419 | Open in IMG/M |
| 3300031944|Ga0310884_11068943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 504 | Open in IMG/M |
| 3300032075|Ga0310890_10103393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1791 | Open in IMG/M |
| 3300033475|Ga0310811_11147742 | Not Available | 650 | Open in IMG/M |
| 3300034663|Ga0314784_056903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300034664|Ga0314786_053246 | Not Available | 770 | Open in IMG/M |
| 3300034664|Ga0314786_089498 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300034669|Ga0314794_100065 | Not Available | 620 | Open in IMG/M |
| 3300034670|Ga0314795_118973 | Not Available | 547 | Open in IMG/M |
| 3300034671|Ga0314796_068773 | Not Available | 713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.35% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.88% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.47% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026751 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026836 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A2-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027992 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_2272180 | 2040502001 | Soil | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDALEIAVFWRCLG |
| GPIPI_03600390 | 2088090014 | Soil | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| JGI10215J12807_10956302 | 3300000881 | Soil | MYALANINFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA* |
| F14TB_1000733622 | 3300001431 | Soil | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDAKRGTALSDLEMAVFGAA* |
| JGI24750J21931_10662541 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | MXALANIDFSNRFGVVVSELPDEIDDQXQTPDAKQQTVLSLEMAVFGAA* |
| JGI24751J29686_100518702 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALANIXFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA* |
| Ga0066395_105688821 | 3300004633 | Tropical Forest Soil | MYALANIDFSNRFGVVVSELPDEIDDEDQALDAKQEAEPGDLEMALEMAVFGAA* |
| Ga0058862_126695131 | 3300004803 | Host-Associated | VRTSKMYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0070683_1002604093 | 3300005329 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA* |
| Ga0066388_1014082353 | 3300005332 | Tropical Forest Soil | MYALADIDFSNRFVVVSELPDEIDNQGDAKQVATDKELEMAVFGAA* |
| Ga0066388_1034287701 | 3300005332 | Tropical Forest Soil | GAIMYALANIDFSNRFGVVVSELPDEIDDEDQALDAKQEAEPGDLEIALEMAVFGAA* |
| Ga0066388_1045178002 | 3300005332 | Tropical Forest Soil | MYALANIDFSNHFGVVVSELPDEIDDQDQTLDALEIAVFGAA* |
| Ga0070689_1002175892 | 3300005340 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDATRGAALSDLEMAVFGAA* |
| Ga0070668_1000363628 | 3300005347 | Switchgrass Rhizosphere | QFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0070668_1004734971 | 3300005347 | Switchgrass Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0070671_1003512894 | 3300005355 | Switchgrass Rhizosphere | GAIMYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA* |
| Ga0070674_1011839131 | 3300005356 | Miscanthus Rhizosphere | FSNRFGVVVSELPDEIDDQNQTLDAKQGAALSNLEMAVFGAA* |
| Ga0070659_1000113741 | 3300005366 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVF |
| Ga0070667_1006285573 | 3300005367 | Switchgrass Rhizosphere | QFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0070709_101185204 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0070709_101580584 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0070709_113375942 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQNQTLDAKQGAALSNLEMAVFGAA* |
| Ga0070694_1014112541 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLANIDFSNRFGVVVSELPDEIDDKDQTLDAKRGAALSELEMAVFGAA* |
| Ga0070663_1000358401 | 3300005455 | Corn Rhizosphere | MGAIMYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA* |
| Ga0070663_1002078152 | 3300005455 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQNQTLDAKRGAALSNLEMAVFGAA* |
| Ga0070663_1018092181 | 3300005455 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDAKRGAALSDLEMAVFGAA* |
| Ga0070662_1001410731 | 3300005457 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFG |
| Ga0070698_1003290683 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALANIDFSNRFGVVVSELPDETDDQHQTPDAKQQTVLSLEMAVFGAA* |
| Ga0070679_1002401331 | 3300005530 | Corn Rhizosphere | DFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0070679_1003112724 | 3300005530 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKDQTVDATGAALIDLEMAVFDAA* |
| Ga0070679_1004770793 | 3300005530 | Corn Rhizosphere | NQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0068853_1016133661 | 3300005539 | Corn Rhizosphere | MYALANIDLSNRFGVVVSELPDEIDDKDQTLDAKRGTALSDLEMAVF |
| Ga0070686_1003291331 | 3300005544 | Switchgrass Rhizosphere | FSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0070686_1004152972 | 3300005544 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKGQTVDAKRGAALGDLEMAVFDAA* |
| Ga0070696_1003935392 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDAKQGAALSNLEMAVFGAA* |
| Ga0070665_1001802071 | 3300005548 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0070664_1022788212 | 3300005564 | Corn Rhizosphere | MYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEMAVFGAA* |
| Ga0068857_1000783218 | 3300005577 | Corn Rhizosphere | SNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0068857_1002150811 | 3300005577 | Corn Rhizosphere | GVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0068857_1009296901 | 3300005577 | Corn Rhizosphere | DFSNRFGVVVSELPDEIDDQNQTLDAKQGAALSNLEMAVFGAA* |
| Ga0068866_100849231 | 3300005718 | Miscanthus Rhizosphere | NQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0066903_1016789272 | 3300005764 | Tropical Forest Soil | MYALADIDFSNRFVVVSELPDEIDNQDQDAKQVATDKELEMAVFGAA* |
| Ga0068863_1001046361 | 3300005841 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQEQTLDAKQGAALSNLEMAVFGAA* |
| Ga0068860_1000792257 | 3300005843 | Switchgrass Rhizosphere | VVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0075417_101344352 | 3300006049 | Populus Rhizosphere | MYGLANIDFSNRFGVVISELPDEIDDQDQTLDAKQGAALSNLEMAVFGAA* |
| Ga0075417_101922162 | 3300006049 | Populus Rhizosphere | MGAIMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0097621_1003076471 | 3300006237 | Miscanthus Rhizosphere | VVISELPDEIDDQDQTLDAKQGAALSNLEMAVFGAA* |
| Ga0079222_100039134 | 3300006755 | Agricultural Soil | MYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEMAVFSAA* |
| Ga0079222_104204912 | 3300006755 | Agricultural Soil | MYGLANIDFSNRFGVVISELPDEIDDQEDAKQEPALSNLEMAVFGAA* |
| Ga0079220_101496243 | 3300006806 | Agricultural Soil | MYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0075428_1014439892 | 3300006844 | Populus Rhizosphere | MYALANIDFSNRFGVVISELPDEIDDQEDAKQEPALSNLEMAVFGAA* |
| Ga0075421_1006329671 | 3300006845 | Populus Rhizosphere | GAIMYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0075433_113015651 | 3300006852 | Populus Rhizosphere | MYALANIDFSNRFGVVVSELPEEIDDKDQTLDAKRGAALSDLEMAVFGAA* |
| Ga0075433_113137012 | 3300006852 | Populus Rhizosphere | MYALANIDFSNRFGVVISELPDEIDDKDQTLDAKWGTALSDLEMAVFGAA* |
| Ga0075420_1005389481 | 3300006853 | Populus Rhizosphere | MGAIMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAIFGAA* |
| Ga0075425_1002298136 | 3300006854 | Populus Rhizosphere | MYALVNIDFSNRFGVVVSELPDEIDDKDQTLDAKRGAALSDLEMAVFGAA* |
| Ga0075429_1005641891 | 3300006880 | Populus Rhizosphere | MYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEMAVFAAA* |
| Ga0075436_1014134001 | 3300006914 | Populus Rhizosphere | MYALVNIDFSNRFGVVVSELPDEIDDKDQTLDAKRGAALSDLEMAVFAAV* |
| Ga0075419_102463032 | 3300006969 | Populus Rhizosphere | MYALANIDFSNRLGVVVSELPDEIDDQHQTPDARQQTVLSLEMAVFGAA* |
| Ga0075435_1013795981 | 3300007076 | Populus Rhizosphere | MYALANIDFGVIVSELPDEIDDKDQTLDAKRGAALSDLE |
| Ga0105251_100338704 | 3300009011 | Switchgrass Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDTKQGPALSDLERAVFGAA* |
| Ga0105250_100591801 | 3300009092 | Switchgrass Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVF |
| Ga0105250_106045862 | 3300009092 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDALEIAIFGAA* |
| Ga0111539_102630074 | 3300009094 | Populus Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDALEIAVFGAA* |
| Ga0111539_107743421 | 3300009094 | Populus Rhizosphere | MYALVNIDFSNRFGVVVSELPDEIDDKDQTLDAKRGAALS |
| Ga0111539_126289091 | 3300009094 | Populus Rhizosphere | MYGLANIDFSNRFGVVISELPDEIDDQDQTLDAKRGTAVSNLEMAVFGAA* |
| Ga0111539_128614032 | 3300009094 | Populus Rhizosphere | MYALANIDFSNRLGVVVSELPYEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0075418_108541953 | 3300009100 | Populus Rhizosphere | MGAIMYALANIDFSNRLGAVVSELPDEIDDQHQTPDAKQQTVLSNLE |
| Ga0075418_115165472 | 3300009100 | Populus Rhizosphere | FGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0075418_119052772 | 3300009100 | Populus Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKGQTLDAKRGAALSDLEMAVFA |
| Ga0075418_119941142 | 3300009100 | Populus Rhizosphere | GAIMYALANIDFSNRLGVVVSELPYEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0105243_101820504 | 3300009148 | Miscanthus Rhizosphere | MYALASIDFSNRFGVVVSELPDEIDDQDQTLDAKQGAALSNLEMAVFGAA* |
| Ga0111538_101822975 | 3300009156 | Populus Rhizosphere | MYALANIDFGVIVSELPDEIDDKDQTLDAKRGAALSDLEIAVFGAA* |
| Ga0111538_105381851 | 3300009156 | Populus Rhizosphere | MYALANIDFANRFGVVVSELPDEIDDQNQTLDAKRGAALSNLEMAV |
| Ga0111538_107725193 | 3300009156 | Populus Rhizosphere | ALANIDFSNRFGVVVSELPDEIDDQNQTLDAKQGAALSNLEMAVFGAA* |
| Ga0111538_131870211 | 3300009156 | Populus Rhizosphere | MYGLANIDFSNRFGVVISELPDEIDDQDQTLDAKRGTAVSDLEMAVFGAA* |
| Ga0075423_100477541 | 3300009162 | Populus Rhizosphere | MYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEIAVFGAA* |
| Ga0075423_102074594 | 3300009162 | Populus Rhizosphere | ISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0075423_105157704 | 3300009162 | Populus Rhizosphere | MGAIMYALANIDFSNRLGAVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0105241_103317142 | 3300009174 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDAKQGAALSNLEMAVFWRCLAKQG* |
| Ga0105242_101453784 | 3300009176 | Miscanthus Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDPDQTLDALEIAVFGAA* |
| Ga0105248_100916941 | 3300009177 | Switchgrass Rhizosphere | LANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0105248_114547052 | 3300009177 | Switchgrass Rhizosphere | LANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0105237_105624762 | 3300009545 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDAKRGAALSELEMAVFGAA* |
| Ga0105237_109716312 | 3300009545 | Corn Rhizosphere | MYALANIDFSNRFGVVISELPDEIDDQDQTLDAKQGAALSNLEMAVFGAA* |
| Ga0105238_101054831 | 3300009551 | Corn Rhizosphere | NIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0105249_114159572 | 3300009553 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDAKQGAALSNLEMAVFGAAWQ |
| Ga0105249_120808811 | 3300009553 | Switchgrass Rhizosphere | MYALANIDFSNRFGVIVSELPDEIDDQDQTLDALEIAVFGAA* |
| Ga0105249_127020891 | 3300009553 | Switchgrass Rhizosphere | MGAIMYTLANIDFSNRFGVVVSELTDEIDDKDQTLDAKRGAALSDLEMAVFGAA* |
| Ga0105239_116965632 | 3300010375 | Corn Rhizosphere | MYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEM |
| Ga0134126_100450918 | 3300010396 | Terrestrial Soil | MYALANIDFSNRFGVVVSELPDEIDDQRQTPDAKQQTVLSLEMAVFGAA* |
| Ga0134126_104630361 | 3300010396 | Terrestrial Soil | IRQKGAIMYALANIDFSNRFGVVVSELPDEIDDQNQTLDAKRGAALSNLEMAVFGAA* |
| Ga0134126_111724551 | 3300010396 | Terrestrial Soil | MYALASIDFSNRFGVVVSELPDEIDDQDQTLDAKQGAALSNLEMDVFWRCLAKQG* |
| Ga0134124_103393233 | 3300010397 | Terrestrial Soil | GAIMYGLANIDFSNRFGVVISELPDEIDDQEDAKQEPALSNLEMAVFGAA* |
| Ga0134127_100056537 | 3300010399 | Terrestrial Soil | MGAIMYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVMSLEMAVFGAA* |
| Ga0105246_101013991 | 3300011119 | Miscanthus Rhizosphere | WGAIMYALANIDFSNRFGVVVSELPDEIDDQNQTLDAKQGAALSNLEMAVFGAA* |
| Ga0120191_100086832 | 3300012022 | Terrestrial | MGAIMYALANIDFSNQFGVVVSELPDEIDDQDQTLDAKQGAALSNLEMAVFGAA* |
| Ga0157304_10167072 | 3300012882 | Soil | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDAKQGPALSDLEMAVFGAA* |
| Ga0157304_10299601 | 3300012882 | Soil | IRKWGAIMYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEMAVFSAA* |
| Ga0157287_10595731 | 3300012885 | Soil | MYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEM |
| Ga0157305_102020211 | 3300012891 | Soil | MRFVKGGVIMYALANIDFSNRFGVFVSELPDEIDDQDQTPDALEMAVFSAA* |
| Ga0157294_101476562 | 3300012892 | Soil | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDALEVAVFGAP* |
| Ga0157284_100222482 | 3300012893 | Soil | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKEGPALSDLEMAVFGAA* |
| Ga0157309_100250231 | 3300012895 | Soil | MYALANIDFSNRFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA* |
| Ga0157303_100097442 | 3300012896 | Soil | MYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALIDLEMAVFAAA* |
| Ga0157285_100033173 | 3300012897 | Soil | MYALANIDFSNRFGVIVSELPEEIDDKDQTLDAKRGAALSDLEMAVFAAA* |
| Ga0157285_102765141 | 3300012897 | Soil | MYGLANIDFSNQFGVVISELPDEIDDQDQMKDAKQGPALSDLEMAVFGAA* |
| Ga0157293_100380741 | 3300012898 | Soil | MGAIMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA* |
| Ga0157293_100897611 | 3300012898 | Soil | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDALEMAVFGAA* |
| Ga0157299_100319431 | 3300012899 | Soil | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDALEIAVFGAA* |
| Ga0157299_100907301 | 3300012899 | Soil | MYALANIDFSNRFGVVISELPDEIDDQDQTLDAKRGTAVSDLEMAVF |
| Ga0157292_100886792 | 3300012900 | Soil | VSELPDEIDDKDQTLDAKRGTAVSDLEMAVFGAA* |
| Ga0157291_100443122 | 3300012902 | Soil | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDALEIAVFGA |
| Ga0157291_100903511 | 3300012902 | Soil | NIDFSNRFGVVISELPDEIDDYQMQDAKQGPALSDLEMAVFGAA* |
| Ga0157291_101319322 | 3300012902 | Soil | DSAKGAIMYALANIDFSNRFGVVVSELPDEIDDKGQTVDAKRGAALGELEMAVFDAA* |
| Ga0157291_103323992 | 3300012902 | Soil | MYALVNIDFSNRFGVVVSELPDEIDDQDQTLDALEIAVFGAA* |
| Ga0157289_101358221 | 3300012903 | Soil | MGAIMYALANIDFSNRLGFVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0157295_100605381 | 3300012906 | Soil | MYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSLDMAVFAAA* |
| Ga0157295_100803622 | 3300012906 | Soil | MYALANIDFSNRYGVVVSELPDEIDDQDQTLDALEIAVFGAA* |
| Ga0157308_102371591 | 3300012910 | Soil | MGAIMYALANIDFSNRLGVVVSELPDEIDDHHQTPDAKQQTVLSNLEMAIFGAA* |
| Ga0157301_100574501 | 3300012911 | Soil | MYALANINFSNRLGVVVSELPYEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0157301_101180841 | 3300012911 | Soil | IMYALANIDFSNRFGVVVSELPDEIDDKGQTVDAKRGAALGELEMAVFDAA* |
| Ga0157301_102076411 | 3300012911 | Soil | MYALANIDLSNRFGVVVSELPDEIDDKDQTLDAKRGAALSDLEMAVFAAA* |
| Ga0157301_103144391 | 3300012911 | Soil | GAIMYALANIDFSNRFGVVISELPDEIDDQEDAKQEPALSNLEMAVFGAA* |
| Ga0157298_100227511 | 3300012913 | Soil | IMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0157297_104013491 | 3300012914 | Soil | MYALANIDFSNRFGVIVSELPEEIYDKDQTLDAKRGAALIDLEMAVFGAA* |
| Ga0157302_100445174 | 3300012915 | Soil | MYALANINFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA* |
| Ga0157302_100687861 | 3300012915 | Soil | MYALANIDLSNRFGVIVSELPEEIDDKDQTLDAKRGAALIDLEMAVFAAA* |
| Ga0164302_100317695 | 3300012961 | Soil | MYGLANIDFSNQFGVVISELPDEIDDQHQMQDAKQGPALSDLEMAVFGAA* |
| Ga0157307_10702181 | 3300013096 | Soil | MGAIMYALAKIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA* |
| Ga0157371_100871011 | 3300013102 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDAKRGAALIDLEMAVFGAA* |
| Ga0157374_113573051 | 3300013296 | Miscanthus Rhizosphere | MYALANIDFSNRFGVVVRELPDEIDDQNQTLDAKQGAALSNLEMADFGAA* |
| Ga0157374_128154021 | 3300013296 | Miscanthus Rhizosphere | MYALASIDFSNQFGVVVSELPDEIDDKDQTLDAKRGAALIDLEMAVF |
| Ga0163162_102765524 | 3300013306 | Switchgrass Rhizosphere | YGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA* |
| Ga0163162_106648931 | 3300013306 | Switchgrass Rhizosphere | YGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDL* |
| Ga0163162_112058701 | 3300013306 | Switchgrass Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDL |
| Ga0173480_100560572 | 3300015200 | Soil | MYALANIDFSNRFGVVVRELPDEIDDQDQTLDAVEIAVFGAA* |
| Ga0173480_100723701 | 3300015200 | Soil | NIDFSNRFGVVISELPDEIDDQEDATQEPALSNLEMAVFGAA* |
| Ga0173478_100101141 | 3300015201 | Soil | MNALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALIDLEMAVFGAA* |
| Ga0173478_103361281 | 3300015201 | Soil | YGLANIDFSNRFGVVISELPDEIDDQEDAKQEPALSNLEMAVFGAA* |
| Ga0173478_105914471 | 3300015201 | Soil | MYALANIDFSNRFGVVVRELPDEIDDQDQTLDALEIAVFGAA* |
| Ga0132258_1004913511 | 3300015371 | Arabidopsis Rhizosphere | MYALANIDFSNRFGVIVSELPDEIDDKDQTMDAKRGAALSDLEMAVFAAA* |
| Ga0132257_1035871661 | 3300015373 | Arabidopsis Rhizosphere | MCALADIDFSNRFVVVSELPDEIDNQGDAKQVATDKELEMAVFGAA* |
| Ga0163161_115324711 | 3300017792 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDALEIAVFGAA |
| Ga0173481_100134491 | 3300019356 | Soil | MYGLANIDFSNQFGVVISELPDEIDDQDQTLDAKQGAALSNLEMAVGTA |
| Ga0173481_100639212 | 3300019356 | Soil | MGAIMYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0173481_101625531 | 3300019356 | Soil | MYALANIDFSNRFGVVISELPDEIDDKDQTLDALEIAVFGAA |
| Ga0173481_104433881 | 3300019356 | Soil | MYGLANIDFSNRFGVVISELPDEIDDQEDAKQEPALSNLEMAVFGAA |
| Ga0173482_100301162 | 3300019361 | Soil | MYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEMAVFAAA |
| Ga0173482_100942722 | 3300019361 | Soil | MYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAIFGAA |
| Ga0173479_100475793 | 3300019362 | Soil | MGAIMDALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA |
| Ga0247792_10222622 | 3300022880 | Soil | MYGLANIDFSNRFGVVISELPDEIDDQEDAKQEPALSDLEMAVFGAA |
| Ga0247786_10697632 | 3300022883 | Soil | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDAKQGPALSDLEMAVFGAA |
| Ga0247786_10919871 | 3300022883 | Soil | GLANIDFSNRFGVVISELPDEIDDQEDAKQEPALSNLEMAVFGAA |
| Ga0247786_11529281 | 3300022883 | Soil | MYALANIDFSNRFGVVVRELPDEIDDQDQTLDALEIAVFGAA |
| Ga0247746_10329932 | 3300022886 | Soil | MYALANIDFSNRFGVVVSELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0247795_10930641 | 3300022899 | Soil | MYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLRNLEMAVFGAA |
| Ga0247788_10191064 | 3300022901 | Soil | ALANIDFSNRFGVVVSELPDEIDDQDQTLDALEIAVFGAA |
| Ga0247790_100250842 | 3300022915 | Soil | MYGLANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0247791_10772681 | 3300023062 | Soil | MGAIMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAIFGAA |
| Ga0247751_10765092 | 3300023069 | Soil | MYGLANIDFSNQFGVVISELPDEIDDKDQTLDAKWGTALSDLEMAVFGAA |
| Ga0247754_10213641 | 3300023102 | Soil | MYGLANIDFSNRFGLVISELPDEIDDQEDAKQEPALSNLEMAVFGAA |
| Ga0247754_11005081 | 3300023102 | Soil | MGAIMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0247796_10178041 | 3300023261 | Soil | MYGLANIDFSNRFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0247800_10075191 | 3300023263 | Soil | MYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA |
| Ga0207710_101034303 | 3300025900 | Switchgrass Rhizosphere | NIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLERAVFGAA |
| Ga0207647_102682042 | 3300025904 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDAKRGAALSE |
| Ga0207685_106487402 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQNQTLDAKRGAALSNLEMAVFGAA |
| Ga0207699_100527011 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGA |
| Ga0207684_109418342 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MYGLAHIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0207695_102755961 | 3300025913 | Corn Rhizosphere | LANINFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0207695_107477403 | 3300025913 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAS |
| Ga0207681_103200082 | 3300025923 | Switchgrass Rhizosphere | MGAIMYALANIDFSNRFGVVVSELPDEIDDQRQTPDAKQQTVLSLEMAVFGAA |
| Ga0207659_118634162 | 3300025926 | Miscanthus Rhizosphere | IMYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0207687_102124161 | 3300025927 | Miscanthus Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEM |
| Ga0207700_119280992 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LMGAIMYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0207690_105823721 | 3300025932 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQNQTLDAKRGAALSNLE |
| Ga0207686_108252961 | 3300025934 | Miscanthus Rhizosphere | FGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0207670_101784065 | 3300025936 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVGELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0207711_100817501 | 3300025941 | Switchgrass Rhizosphere | NQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0207679_101318535 | 3300025945 | Corn Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQDQTLDAKQGAALSNLEMAVFGAA |
| Ga0207651_100982301 | 3300025960 | Switchgrass Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLER |
| Ga0207651_101559811 | 3300025960 | Switchgrass Rhizosphere | GVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0207640_101569951 | 3300025981 | Corn Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMA |
| Ga0207678_100677569 | 3300026067 | Corn Rhizosphere | QFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0207678_105023243 | 3300026067 | Corn Rhizosphere | MYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLE |
| Ga0207708_100718595 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALANINFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0207594_1058961 | 3300026751 | Soil | RQKGAIMYGLANIDFSNRFGVVISELPDEIDDQDQMQDAKQGPALNDLEMAVFGAA |
| Ga0207612_10022202 | 3300026836 | Soil | MYGLANIDFSNQFGVVISELPDEIDDQHQTPDAKQQTVLSLEMAVFGAA |
| Ga0209966_11154172 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDKDQTLDAKRGTALSDLEMAVFGAA |
| Ga0209073_101206981 | 3300027765 | Agricultural Soil | MGAIMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA |
| Ga0209177_101373252 | 3300027775 | Agricultural Soil | MYGLANIDFSNRFGVVISELPDEIDDQDQTLDAKRGTAVSDLEMAVFGAA |
| Ga0209177_102121601 | 3300027775 | Agricultural Soil | PAKLSIRRWGAIMYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEMAVFSAA |
| Ga0209074_101748642 | 3300027787 | Agricultural Soil | MYALANIDFSNRFGVIVSELPDEIDDKDQTLDAKRGAALSDLEMAVFSAA |
| Ga0209074_102862542 | 3300027787 | Agricultural Soil | SNRFGVVISELPDEIDDQDQTLDAKRGTAVSDLEMAVFGAA |
| Ga0209814_102006371 | 3300027873 | Populus Rhizosphere | YGLANIDFSNRFGVVISELPDEIDDQEDAKQEPALSNLEMAVFGAA |
| Ga0209382_105480091 | 3300027909 | Populus Rhizosphere | AIMYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0209382_106046912 | 3300027909 | Populus Rhizosphere | GAIMYALANIDFSNRFGVVISELPDEIDDKDQTLDAKWGTALSDLEMAVFGAA |
| Ga0209382_111923332 | 3300027909 | Populus Rhizosphere | MYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSN |
| Ga0209382_118805431 | 3300027909 | Populus Rhizosphere | RLMGATMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEMAVFGAA |
| Ga0247750_10417021 | 3300027992 | Soil | MYALANIDFSNRFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0268266_100778717 | 3300028379 | Switchgrass Rhizosphere | MYALANIDFSNRFGVVVSELPDEIDDQHQTPDAKQQTVLSLE |
| Ga0268264_108604781 | 3300028381 | Switchgrass Rhizosphere | VVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0310907_100165887 | 3300031847 | Soil | MYGLANIDFSNRFGVVISELPDEIDDQDQTLDAKQGAALSNLEMAVFGAAW |
| Ga0310884_110689431 | 3300031944 | Soil | MYALANIDFSNRLGVVVSELPYEIDDQHQTPDAKQQTVLSNLEMAVFGAA |
| Ga0310890_101033931 | 3300032075 | Soil | IDFSNQFGVVISELTDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0310811_111477422 | 3300033475 | Soil | MGAIMYALANIDFSNRLGVVVSELPDEIDDQHQTPDAKQQTVLSNLEIAVFGAA |
| Ga0314784_056903_3_140 | 3300034663 | Soil | NIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0314786_053246_33_197 | 3300034664 | Soil | MGAIMYGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0314786_089498_65_217 | 3300034664 | Soil | MYGLANIDFSNQFGVVISELPDEIDDQDQTLDAKQVAALSNLEMAVFGAA |
| Ga0314794_100065_435_587 | 3300034669 | Soil | MYGLANIDFSNQFGVVISELPDEINDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0314795_118973_1_141 | 3300034670 | Soil | ANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| Ga0314796_068773_562_711 | 3300034671 | Soil | YGLANIDFSNQFGVVISELPDEIDDQDQMQDAKQGPALSDLEMAVFGAA |
| ⦗Top⦘ |