NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022656

Metagenome / Metatranscriptome Family F022656

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022656
Family Type Metagenome / Metatranscriptome
Number of Sequences 213
Average Sequence Length 142 residues
Representative Sequence MKFAAIALVATATAIRRDAGPAYQPGQSGKLGGGAYERVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKSISGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Number of Associated Samples 135
Number of Associated Scaffolds 213

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.43 %
% of genes near scaffold ends (potentially truncated) 53.52 %
% of genes from short scaffolds (< 2000 bps) 98.59 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.75

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.244 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(27.230 % of family members)
Environment Ontology (ENVO) Unclassified
(69.014 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.812 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 42.44%    β-sheet: 12.21%    Coil/Unstructured: 45.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.75
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.80.1.1: double-SIS domaind1moqa_1moq0.53136
c.80.1.0: automated matchesd4s1wa_4s1w0.52686
c.80.1.0: automated matchesd7kqaa17kqa0.52138
a.39.1.9: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)d1ij5a_1ij50.51315
c.80.1.0: automated matchesd2e5fa_2e5f0.50927


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.24 %
UnclassifiedrootN/A3.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000947|BBAY92_10157333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300000949|BBAY94_10133209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300005838|Ga0008649_10147881Not Available938Open in IMG/M
3300006382|Ga0075494_1009160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300006382|Ga0075494_1366681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300006571|Ga0075505_1446035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300006803|Ga0075467_10322354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium818Open in IMG/M
3300006869|Ga0075477_10423040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300007715|Ga0102827_1107293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300007981|Ga0102904_1100417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300008699|Ga0103617_101642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300008929|Ga0103732_1043117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300008930|Ga0103733_1083277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300008931|Ga0103734_1060078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300008936|Ga0103739_1067006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300008938|Ga0103741_1118001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300009003|Ga0102813_1114216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium855Open in IMG/M
3300009003|Ga0102813_1179047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300009263|Ga0103872_1062362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300009432|Ga0115005_10885043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300009432|Ga0115005_11036418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300009432|Ga0115005_11050700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300009432|Ga0115005_11064947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300009432|Ga0115005_11188010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300009432|Ga0115005_11316698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300009432|Ga0115005_11519788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300009433|Ga0115545_1207226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300009434|Ga0115562_1184887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300009436|Ga0115008_10548752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium828Open in IMG/M
3300009436|Ga0115008_10571170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium812Open in IMG/M
3300009436|Ga0115008_10879640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300009436|Ga0115008_10984462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300009436|Ga0115008_11015482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300009440|Ga0115561_1269149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300009440|Ga0115561_1389344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300009441|Ga0115007_10489352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium811Open in IMG/M
3300009442|Ga0115563_1244623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300009447|Ga0115560_1414802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300009495|Ga0115571_1323935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300009505|Ga0115564_10362004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300009505|Ga0115564_10556310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300009543|Ga0115099_10623309Not Available736Open in IMG/M
3300009599|Ga0115103_1308824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300009599|Ga0115103_1383845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300009608|Ga0115100_10550253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300009608|Ga0115100_10846154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300012408|Ga0138265_1048704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300012408|Ga0138265_1081480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300012408|Ga0138265_1107191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300012408|Ga0138265_1393378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300012412|Ga0138266_1410276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300012414|Ga0138264_1469407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300012415|Ga0138263_1284175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300012415|Ga0138263_1388660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300012418|Ga0138261_1057324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300012419|Ga0138260_10519241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300012470|Ga0129329_1016572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300012767|Ga0138267_1077317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300012782|Ga0138268_1397922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300012952|Ga0163180_11462437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300013010|Ga0129327_10321890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300013010|Ga0129327_10898156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300016740|Ga0182096_1330753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300017697|Ga0180120_10353801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300018515|Ga0192960_107212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300018622|Ga0188862_1025161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300018622|Ga0188862_1030168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300018622|Ga0188862_1031528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300018787|Ga0193124_1076779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300018871|Ga0192978_1093858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300018871|Ga0192978_1106373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300018899|Ga0193090_1149410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300018980|Ga0192961_10226047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300018980|Ga0192961_10227354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300018980|Ga0192961_10231878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300018980|Ga0192961_10236638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300018980|Ga0192961_10241552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300018980|Ga0192961_10244262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300018980|Ga0192961_10249420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018982|Ga0192947_10248231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300019021|Ga0192982_10281568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300019021|Ga0192982_10292952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019021|Ga0192982_10297548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300019021|Ga0192982_10342370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300019021|Ga0192982_10374605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300019022|Ga0192951_10419497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300019025|Ga0193545_10140143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300019031|Ga0193516_10289594Not Available527Open in IMG/M
3300019031|Ga0193516_10308053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300019036|Ga0192945_10265181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300019036|Ga0192945_10287879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300019048|Ga0192981_10200288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300019048|Ga0192981_10309553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300019048|Ga0192981_10314201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300019048|Ga0192981_10318146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300019048|Ga0192981_10321257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300019050|Ga0192966_10246071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300019050|Ga0192966_10274005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300019050|Ga0192966_10275523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300019050|Ga0192966_10310010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300019050|Ga0192966_10363382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300019084|Ga0193051_114534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300019097|Ga0193153_1026600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300019097|Ga0193153_1027388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300019118|Ga0193157_1035387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300019123|Ga0192980_1078274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300019123|Ga0192980_1088694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300019123|Ga0192980_1092579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300019123|Ga0192980_1092581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300019123|Ga0192980_1092585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300019133|Ga0193089_1124037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300019133|Ga0193089_1129010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300019133|Ga0193089_1145085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300019133|Ga0193089_1145426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300019149|Ga0188870_10153308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300019150|Ga0194244_10104279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300020182|Ga0206129_10315558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300020595|Ga0206126_10345054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300020595|Ga0206126_10351706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300021169|Ga0206687_1046598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300021345|Ga0206688_10028472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300021359|Ga0206689_10128042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300021359|Ga0206689_10210042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300021359|Ga0206689_10523645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300021889|Ga0063089_1018096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300021921|Ga0063870_1017474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300021941|Ga0063102_1000349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300021960|Ga0222715_10350573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium822Open in IMG/M
3300021960|Ga0222715_10698708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300023565|Ga0228688_122896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300023566|Ga0228679_1036729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300023685|Ga0228686_1059967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300023696|Ga0228687_1047290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300023701|Ga0228685_1065420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
(restricted) 3300024261|Ga0233439_10192458Not Available940Open in IMG/M
3300025570|Ga0208660_1072513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300025620|Ga0209405_1104724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300025620|Ga0209405_1141296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300025626|Ga0209716_1129644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300025637|Ga0209197_1196498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300025640|Ga0209198_1144079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300025809|Ga0209199_1191759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium718Open in IMG/M
3300026398|Ga0247606_1035516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300026443|Ga0247559_1126148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300026465|Ga0247588_1113634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300026465|Ga0247588_1123608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300026468|Ga0247603_1097398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300026470|Ga0247599_1120266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300026503|Ga0247605_1164717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300026503|Ga0247605_1166390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300027308|Ga0208796_1086232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300027810|Ga0209302_10363895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300027833|Ga0209092_10332012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium814Open in IMG/M
3300027833|Ga0209092_10379672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300027833|Ga0209092_10487597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300027833|Ga0209092_10508749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300027849|Ga0209712_10336932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium853Open in IMG/M
3300027849|Ga0209712_10490716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300027849|Ga0209712_10507316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300027849|Ga0209712_10522683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300027849|Ga0209712_10527496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300027849|Ga0209712_10533579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300027883|Ga0209713_11051857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300028110|Ga0247584_1158738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300028128|Ga0228645_1146800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300028137|Ga0256412_1341948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300028137|Ga0256412_1387847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300028250|Ga0247560_121011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300028333|Ga0247595_1090323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300028671|Ga0257132_1132540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300030653|Ga0307402_10878964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300030671|Ga0307403_10744650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300030715|Ga0308127_1050295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300030721|Ga0308133_1055160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300030721|Ga0308133_1058120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300030723|Ga0308129_1041669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300030724|Ga0308138_1066761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300031540|Ga0308143_131246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300031556|Ga0308142_1075414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300031558|Ga0308147_1047935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300031622|Ga0302126_10226549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300031622|Ga0302126_10324152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300031638|Ga0302125_10125748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium827Open in IMG/M
3300031674|Ga0307393_1113492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300031709|Ga0307385_10408768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300031710|Ga0307386_10740904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300031710|Ga0307386_10754970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300031725|Ga0307381_10235324Not Available647Open in IMG/M
3300031725|Ga0307381_10356387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300031725|Ga0307381_10390007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300031729|Ga0307391_10817857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300031729|Ga0307391_10853057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300031729|Ga0307391_10928772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300031735|Ga0307394_10192467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300031735|Ga0307394_10407803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300031739|Ga0307383_10654977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300031742|Ga0307395_10504112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300031742|Ga0307395_10516962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300032470|Ga0314670_10718347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300032492|Ga0314679_10140121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1081Open in IMG/M
3300032650|Ga0314673_10708945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300032666|Ga0314678_10517180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300032707|Ga0314687_10812837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300032723|Ga0314703_10483017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300032724|Ga0314695_1368838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300032732|Ga0314711_10684960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300032733|Ga0314714_10747511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300032743|Ga0314707_10716655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300032746|Ga0314701_10501403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300032755|Ga0314709_10898578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine27.23%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine25.35%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.92%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.04%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.63%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine5.63%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.29%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.82%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.35%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.88%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.41%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.41%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.47%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.47%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.47%
North SeaEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea0.47%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.94%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.94%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008699Microbial communities of saline water collected from the North Sea in Germany - HE327_1EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010135Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300023565Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025637Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300026398Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028128Seawater microbial communities from Monterey Bay, California, United States - 57DEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028250Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 8R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031556Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_538_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY92_1015733313300000947Macroalgal SurfaceMKFALIALVASASAIALNGDKKPVVYQPGQSGKLGGGEYKRVTPARFDADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNITGAAQATYLDTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYVQLQ*
BBAY94_1013320913300000949Macroalgal SurfaceALNGDKKPVVYQPGQSGKLGGGEYKRVTPPRFAADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQGKYLDTYWAKAWGHFDVNRTGNIPVLYAPQLMRFLMSDQYISL*
Ga0008649_1014788123300005838MarineLPGQSGKLGGGVYARVIPSRFEADSDDIFMRSVLSSYAREVANKDGVPQGKFYLKKSDAKALAQEVLATHKNIKGAAQEKYLSTYWDKAWGHFDVNKTGQIPALYAPGLMRFLMSDQYISL*
Ga0075494_100916013300006382AqueousMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL*
Ga0075494_136668113300006382AqueousLIKIMKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVVQNYAQEGASKDGEPTGVFTLTESSAKQLAMEVLATHKSIKGAAQVAYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL*
Ga0075505_144603513300006571AqueousMKFAVAVLCGLATAVKVNDVYQPGQSGMLGGGEYVRVIPARFQADSDDIFMRSVLTNYAQEGALKDGTPTGVFTLSESSARALAQEVLATHKNIRGEAQVKYLDTYWQKAWGHFDVNRTGSIPALYAPGLMRFLMSDQYISL*
Ga0075467_1032235413300006803AqueousMKFALIALVAAATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL*
Ga0075477_1042304013300006869AqueousAVLCGLATAVKVNDVYQPGQSGMLGGGEYVRVIPARFQADSDDIFMRSVLTNYAQEGALKDGTPTGVFTLSESSARALAQEVLATHKNIRGEAQVKYLDTYWQKAWGHFDVNRTGSIPALYAPGLMRFLMSDQYISL*
Ga0102827_110729313300007715EstuarineMKFAVIALIAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLMSDQYISL*
Ga0102904_110041713300007981EstuarineAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL*
Ga0103617_10164213300008699North SeaMKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVVQNYAQEGASKDGEPTGVFTLTESSSKALAMEVLATHKDIRGAAQAEYLATYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL*
Ga0103951_1067900813300008832MarineMLGGGTYERVIPARFSADSDDIFMRSVLNNYAQEGMLKDGTPTGVFTLSNSSARALAQEVLATHKNIRGADQEKYLATYWDKAWGHFDVNKTGSIPALYAPGLMRFLMSDQYISL*
Ga0103732_104311713300008929Ice Edge, Mcmurdo Sound, AntarcticaMKFALVALVALTAAVRVEDVFQPGQSGKIGGGDYTRVTPARFAADSDDIFMRSVIQNYAQEGQNKDKGPDGVFTLTQSSAKALAQEVLCTHKSICAAALGTYLDTYWAKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL*
Ga0103733_108327713300008930Ice Edge, Mcmurdo Sound, AntarcticaLCFLIKIMKFALIAIVAAASAMQLSRDAGPAYQPGQSGKLGGGSYDRVTPARFAVDSDDIFMRSVIQNYAQEGQNKDKGPDGVFTLTQSSAKALAQEVLCTHKSICAAALGTYLDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL*
Ga0103734_106007813300008931Ice Edge, Mcmurdo Sound, AntarcticaMKFALVALVAMTAAVRVEDVFQPGQNGMIGGGSYERVTPARFSADSDDIFMRSVIQNYAQEGQNKDKGPDGVFTLTQSSAKALAQEVLCTHKSICAGALGTYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL*
Ga0103739_106700613300008936Ice Edge, Mcmurdo Sound, AntarcticaMKFALVALVALTAAVRVEDVFQPGQSGKIGGGDYTRVTPARFAADSDDIFMRSVIQNYAQEGQDKDGGANGVFTLTNSSAQALASEVLATHKSITGAALSKYLDTYWAKAWGHFDVHRTGSIP
Ga0103741_111800113300008938Ice Edge, Mcmurdo Sound, AntarcticaFLNKLFKIISLIKIMKFALVALVAMTAAVRVEDVFQPGQNGMIGGGSYERVTPARFSADSDDIFMRSVIQNYAQEGQNKDKGPDGVFTLTQSSAKALAQEVLCTHKSICAAALGTYLDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL*
Ga0102813_111421613300009003EstuarineMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLATYWAKAWGHFDVNKTGSIPILYAPQLCRFLMSDQYISL*
Ga0102813_117904713300009003EstuarineMKFALIALVAAATAINLEGVYQPGQSGKLGGGAYNRATPARFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLMSDQYISL*
Ga0103872_105297813300009263Surface Ocean WaterMLGGGTYDRVTPARFSADSDDIFMRSVIQNYAQEHATKEGVPTGVFTLSESSARALAQEVLATHKNIRGAAQVDYLNTYWAKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL*
Ga0103872_106236213300009263Surface Ocean WaterSSDSDSDDDFIQTTDYLPGQSGANGLNYERQIPARFSGDSDDIFMRSVFNNYASEKADKDTGKPLGVFYITEASARALAEEVLSTHKNIRGAALQNYLNTYWSKAWGHFDVNRTGSIPPLYAPQLMRFLMSDQYISL*
Ga0115005_1088504313300009432MarineCIALIAATSAIALEGVYQPGQSGKLGGGAYSRVTPARFAADSDDIFMRSVIQNYAQEGANKDGEPTGVFTLTESSAKALAMEVLDTHKSIKGAAQVAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLSSDQYMSL*
Ga0115005_1103641813300009432MarineMKFALVAIVAAVSAVTITGDAPPFQPGQSGKLGGGAYDRVTPARFAGDSDDIFMRSVVQNYAQEAATKDGEPTGVFTLTESSAKQLAMEVLATHKSIKGAAQVAYLGSYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL*
Ga0115005_1105070013300009432MarineMKFALIALVATTTAIALEGVYQPGQSGKLGGGSYNRATPARFSADSDDIFMRSVIQNYAQEGANKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLSSDQYMSL*
Ga0115005_1106494713300009432MarineMKFALVAIVAAVSAVTLSGSPPFQPGQSGKLGGGSYDRATPARFSSDSDDLFMRSVVQNYAQEGANDDGEPTGVFTLSESSARQLATEVLATHKSIKGAAQATYLGAYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL*
Ga0115005_1118801013300009432MarineMKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFAGDSDDIFMRSVVQNYAQEAASKDGEPTGVFTLTESSAKQLAMEVLSTHKSIKGAAQVAYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL*
Ga0115005_1131669813300009432MarineMKFALIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSSRALAMEVLETHKSIKGAAQVEYLNTYWAKAWGHFDVNKTGSIPILYAPQLMRFLMSDQYISL*
Ga0115005_1151978813300009432MarineMKFALAALFAAVSAVNISGQAPFQPGQSGKLGGGAYARVTPARFAGDADDIFMRSVIQNYAQEGANKDGEPTGVFTLSESSAKQLAMEVLDSHKSIKGAAQVAYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFL
Ga0115545_120722613300009433Pelagic MarineMKFALVALFAAVSAVNISGDPPPFQPGQSGRLGGGAYDRVTPARFSADSDDIFMRSVVQNYAQEGASKDGEPTGVFTLTESSAKQLAMEVLATHKSIKGAAQVAYLNTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL*
Ga0115562_118488713300009434Pelagic MarineMKFAVIALIATAAAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL*
Ga0115008_1054875213300009436MarineMKFACIALVAAASAIQLEGPPIIYQPGQSGKLGGGAYSRATPERFAADSDDIFMRSVIQNYAQEHSNGDGEPNGVFTLTESSARALAQEVVATHKDIKGAAADSYFATYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL*
Ga0115008_1057117013300009436MarineMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL*
Ga0115008_1087964013300009436MarineMKFALIALVATATAITLEGVYQPGQSGKLGGGAYNRETPARFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL*
Ga0115008_1098446213300009436MarineMKFALVALVATTAAISLEGVYQPGQSGKLGGGAYSRVTPDRFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL*
Ga0115008_1101548213300009436MarineMKFALIALVAAASAIQLEGPPIIYQPGQSGKLGGGAYNRATPERFAADSDDIFMRSVIQNYAQEHSNADGEPNGVFTLTESSARALAMEVLDTHKSIKGAAQVAYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL*
Ga0115561_126914923300009440Pelagic MarineMKFALIALVAAATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLASDQYMSL*
Ga0115561_138934413300009440Pelagic MarineAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL*
Ga0115007_1048935223300009441MarineMKFAVIALIASVSAIKAPFQPGQSGKLGGGSYDRVTPARFSADSDDIFMRSVIQNYAQEGANKDGEPTGVFTLSESSSRALAMEVLATHKDIKGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL*
Ga0115563_124462323300009442Pelagic MarineMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL*
Ga0115560_141480213300009447Pelagic MarineAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL*
Ga0115571_132393513300009495Pelagic MarineMKFALIALVAAATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQATYLDTYWAKAWSHFDVNRTGSIPILYAPQLMRFLASDQYMSL*
Ga0115564_1036200413300009505Pelagic MarineKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL*
Ga0115564_1055631013300009505Pelagic MarineKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL*
Ga0115099_1062330913300009543MarineLSSSLVQLESDSSSDSDSDDDFIQTADYLPGQSGKLGGGVYDRVIPSRFQADSDDIFMRSVYSNYAREVANKDGVPQGIFYLTKSDGRALAQEVLATHKNIRGGAQDKYLATYWDKAWGHFDVNKTGQIPALYAPGLMRFLMSDQYISL*
Ga0115103_130882413300009599MarineMKFALVALFAAVSAVNISGDPPPFQPGQSGRLGGGAYDRVTPARFASDSDDIFMRSVIQNYAIEGASKEGEPTGVFTLTESGAKQLATEVLATHKSIKGAAAAEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL*
Ga0115103_138384513300009599MarineISLIKIMKFALIALVATASAIALNGDKPVVYQPGQSGKLGGGAYNRVTPARFSADNDDIFMRSVIQNYAQEAGTKEGEPTGVFTLTESSARALAMEVLATHKDIKGAAQVEYLATYWAKAWGHFDVNRTGSIPILYAPGLMRFLMSDQYISL*
Ga0115100_1055025313300009608MarineLIKIMKFAVIALIATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL*
Ga0115100_1084615413300009608MarineIKIMKFACIALVAAASAIQLEGPPIIYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVVQNYAQEHSNADGEPNGVFTLTESSARALAQEVVATHKDIKGAAADSYFATYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL*
Ga0123382_116668813300010135MarineMLGGGTYERVIPARFQADSDDIFMRSVLTNYAQEGALKDGTPTGVFTLSESSARALAQEVLATHKDIRGEAQVKYLDTYWAKAWGHFDVNRTGRIPALYAPGLMRFLMSDQYISL*
Ga0138265_104870423300012408Polar MarineMQVSDYLPGQSGKLGGGVYDRVIPARFDGDSDDIFMRSVYNNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGAAQTKYLDAYWAKAWGHFDVNRTGQIPALYAPQLMRFLMSDQYISL*
Ga0138265_108148023300012408Polar MarineMQTADYMPGQSGKLGGGVYDRVIPTRFEGDSDDIFMRSVYTNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGGAQTKYLDAYWAKAWGHFDVNKTGQIPAAYAPQLMRFLMSDQYISL*
Ga0138265_110719113300012408Polar MarineKFAAIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVVQNYAQEGSWKDGEPTGVFTLTQSSANALAAEVICTHKQICGAASTKYFDTYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL*
Ga0138265_139337813300012408Polar MarineMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGVYDRATPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTNSSAKALAQEVVCTHKQICGGAATKYFDTYWAKAWGHYDVNRTGSIPVLYAPGLMRFFMSDQYISL*
Ga0138266_141027613300012412Polar MarineISLIKIMKFAVIALVAAATAIRRDAGPAYQPGQSGKLGGGAYERVTPARFAADSDDIFMRSVVQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPGLMRFLMSDQYISL*
Ga0138264_146940713300012414Polar MarineTSSLLQLESDSSDSDSSDDDLMQTADYMPGQSGKLGGGVYDRVIPARFDGDSDDIFMRSVYNNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGGAQTKYLDAYWAKAWGHFDVNKTGQIPAAYAPQLMRFLMSDQYISL*
Ga0138263_128417513300012415Polar MarineLIKIMRFALIALVATATAIRRDAGPAYQPGQSGKLGGGSYDRVTPARFAADNDDIFMRSVVQNYAQEGSWKDGEPTGVFTLSESSARALATEVIGTHKAITGAAAGTYLDTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL*
Ga0138263_138866013300012415Polar MarineKFAAIALVATATAIRRYAGPAYQPGQSGKLGGGAYDRVTPARFAADSYDIFMRSVVQNYAQEGSWKDGEPTGVFTLTQSSANALAAEVICTHKQICGAASTKYFDTYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL*
Ga0138261_105732413300012418Polar MarineISLIKIMRFALIALVATATAIRRDAGPAYQPGQSGKLGGGSYDRVTPARFAADNDDIFMRSVVQNYAQEGSWKDGEPTGVFTLSESSARALATEVIGTHKAITGAAAGTYLDTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL*
Ga0138260_1051924113300012419Polar MarineLLQLESDSSDSDSSDDDLMQTADYMPGQSGKLGGGVYDRVIPTRFEGDSDDIFMRSVYTNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGGAQTKYLDAYWAKAWGHFDVNKTGQIPAAYAPQLMRFLMSDQYISL*
Ga0129329_101657213300012470AqueousKIMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPTLYAPGLMRFLASDQYMSL*
Ga0138267_107731723300012767Polar MarineMQTADYMPGQSGKLGGGVYDRVIPTRFEGDSDDIFMRSVYTNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGAAQTKYLDAYWAKAWGHFDVNRTGQIPALYAPQLMRFLMSDQYISL*
Ga0138268_139792213300012782Polar MarineKFALIALVAAASAIKRDAGPAYQPGQSGKLGGGVYDRVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAMEVLATHKNISGGAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL*
Ga0163180_1146243713300012952SeawaterMLGGGEYVRKIPARFEADSDDIFMRSVLTSYAQEGMTKEGVPTGVFTLSEASAKALAQEVLCTHKQKCGAELTKYLDTYWAKAWGHFDVNRTGSIPYLYSAGLMRFLMSDQYISL*
Ga0129327_1032189013300013010Freshwater To Marine Saline GradientMKFAVIALIAIAAAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL*
Ga0129327_1089815623300013010Freshwater To Marine Saline GradientMKFALIALVAAATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFL
Ga0182096_133075313300016740Salt MarshLIKIMKFAVAVLCGLATAVKVNDVYQPGQSGMLGGGEYVRVIPARFQADSDDIFMRSVLTNYAQEGALKDGTPTGVFTLSESSARALAQEVLATHKNIRGEAQVKYLDTYWQKAWGHFDVNRTGSIPALYAPGLMRFLMSDQYISL
Ga0180120_1035380123300017697Freshwater To Marine Saline GradientMKFALIALVAAATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0192960_10721213300018515MarineMKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVVQNYAQEAASKDGEPTGVFTLTESSAKQLAMEVLATHKSIKGAAQVAYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL
Ga0188862_102516113300018622Freshwater LakeMKFALIALVASVSAINLNGDKKPVVYQPGQSGKLGGGVYDRVTPPRFAADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQAQYLDTYWAKAWGHFDVNRTGNIPVLYAPQLMRFLMSDQYISL
Ga0188862_103016813300018622Freshwater LakeMKFALIALVASVSAINLNGDKKPVVYQPGQSGKLGGGVYDRVTPPRFAADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQQEYLNTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0188862_103152813300018622Freshwater LakeLIKIMKFAVIALIATAAAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPVLYAPGLMRFLASDQYMSL
Ga0193124_107677913300018787MarineKIMKFALVALVAAATAIRRDPGPPYQPGQSGMLGGGTYERVTPARFAADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAQEVIGTHKGITGDAAAKYFDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFFMSDQYISL
Ga0192978_109385813300018871MarineLIKIMKFALIAIVAAASAMQLSRDAGPAYQPGQSGKLGGGVYDRVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAMEVLATHKNISGGAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0192978_110637313300018871MarineLIKIMRFALIALVATATAIRRDAGPAYQPGQSGKLGGGSYDRVTPARFAADNDDIFMRSVVQNYAQEGSWKDGEPTGVFTLSESSARALATEVIGTHKAITGAAAGTYLDTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0193090_114941013300018899MarineIISLIKIMKFALVALVAAATAVRVEDVFQPGQNGMIGGGSYERVTPARFAADSDDIFMRSVIQNYAQEGQNKDKGPDGVFTLTQSSAKALAQEVLCTHKSICAAALGTYLDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL
Ga0192961_1022604713300018980MarineMGNNIISLIKIMKFALVALVAAAAAINLNGDKKPVVYQPGQSGKLGGGVYDRVTPARFAADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLTESSARALAMEVLATHKNIVGAAQSQYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0192961_1022735413300018980MarineRGIKQISLIKIMKFALIALVATASAIALNGDKPVVYQPGQSGKLGGGAYNRVTPARFSADSDDIFMRSVIQNYAQEAGTKEGEPTGVFTLTESSARALAMEVLATHKDIKGAAQVEYLATYWAKAWGHFDVNRTGSIPILYAPGLMRFLMSDQYISL
Ga0192961_1023187813300018980MarineMGIISLIKIMKFALIALVAAASAINLNGDKPVVYQPGQSGKLGGGVYDRVTPARFNADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQQQYLDTYWGKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0192961_1023663813300018980MarineMGIISLIKIMKFALIALVATAAAINLNGDKPVVYQPGQSGKLGGGVYDRVTPARFNADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQGTYLDTYWAKAWGHFDVNRTGNIPVLYAPQLMRFLMSDQYISL
Ga0192961_1024155213300018980MarineMKFALVALFAAVSAVNISGDPPPFQPGQSGRLGGGAYDRVTPARFAADSDDIFMRSVIQNYAIEGASKDGEPTGVFTLTESGAKQLATEVLATHKSIKGAAAAEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0192961_1024426213300018980MarineMKFALIALVATVAAVRVEEGVYTSAIPARFSADSDDIFMRSVISNYAQEGKEKDGSGNGVFTLNESSAKALSQEVLATHKQISGAAQTKYLDTYWAKAWGHFDVNKTGSIPSLYAPGLMRFLMSDQYISL
Ga0192961_1024942013300018980MarineHGEKIMKFALIALVATAAAVKVEGVFQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGEAKDGNGNGVFTLTQSSAKALAQEVLCTHKQICAAAQATYLDTYWAKAWGHFDVNRTGSIPALYAPGLMRFLMSDQYISL
Ga0192947_1024823113300018982MarineMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGGAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0192982_1028156813300019021MarineMKFALVAIVAAASAMQLSRDAGPAYQPGQSGKLGGGVYDRVTPVRFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVEYLGTYWAKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL
Ga0192982_1029295213300019021MarineMKFALVALVALTAAVRVEDVFQPGQSGKIGGGDYTRVTPARFAADSDDIFMRSVIQNYAQEGQDKDGGANGVFTLTNSSAQALASEVLATHKSITGAALSKYLDTYWAKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL
Ga0192982_1029754813300019021MarineTWGKIISLIKIMKFALVALVAMTAAVRVEDVFQPGQNGMIGGGSYERVTPARFSADSDDIFMRSVIQNYAQEGQDKDGGANGVFTLTNSSAQALASEVLATHKSITGAALSKYLDTYWAKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL
Ga0192982_1034237013300019021MarineTWGKIISLIKIMKFALVALVAMTAAVRVEDVFQPGQNGMIGGGSYERVTPARFSADSDDIFMRSVIQNYAQEGQNKDKGPDGVFTLTQSSAKALAQEVLCTHKSICAAALGTYLDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL
Ga0192982_1037460513300019021MarineSDSDSSDDDLMQTADYMPGQSGKLGGGVYDRVIPTRFEGDSDDIFMRSVYTNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGGAQTKYLDAYWAKAWGHFDVNKTGQIPAAYAPQLMRFLMSDQYISL
Ga0192951_1041949713300019022MarineTWGKIISLIKIMKFALIALVATATAITLEGVYQPGQSGKLGGGAYSRVTPDRFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0193545_1014014313300019025MarineMKFAVIALVAAATAIRRDAGPPYQPGQSGMLGGGTYERVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAQEVLATHKDIRGEAQQKYLDTYWGKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL
Ga0193516_1028959413300019031MarineSALVQLESDSSSDSDSDDDFIQTADYLPGQSGKLGGGVYDRVIPARFTADSDDIFMRSVLSNYAREVANKDGVPQGVFYLKKSDAKALAQEVLATHKNIRGAAQDKYLATYWDKAWGHFDVNKTGQIPALYAPGLMRFLMSDQYISL
Ga0193516_1030805313300019031MarineMLGGGEYVRKIPARFEADSDDIFMRSVLTSYAQEGMTKEGVPTGVFTLSEASAKALAQEVLCTHKQKCGAELTKYLDTYWAKAWGHFDVNRTGSIPYLYSAGLMRFLMSDQYISL
Ga0192945_1026518113300019036MarineMGATAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAMEVLATHKNISGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0192945_1028787913300019036MarineMKFALIALVATVAAVRVEEGVYTSAIPARFSADSDDIFMRSVISNYAQEGKEKDGSGNGVFTLNESSAKALSQEVLATHKQISGAAQTKYLDTYWAKAWGHFDVNKTGSIPSLYAPGLMRFLASDQYMSL
Ga0192981_1020028813300019048MarineMQVSDYLPGQSGKLGGGVYDRVIPARFDGDSDDIFMRSVYNNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGAAQTKYLDAYWAKAWGHFDVNRTGQIPALYAPQLMRFLMSDQYISL
Ga0192981_1030955313300019048MarineMKFALIAIVATATAVSLEGAPDYQPGQSGKLGGGAYSRVTPARFAADSDDIFMRSVIQNYAQEGSLKNGEPTGVFTLTESSARALATEVIGTHQKVTGAAATKYFDAYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL
Ga0192981_1031420113300019048MarineMKFALVALVALTAAVRVEDVFQPGQSGKIGGGDYTRVTPARFAADSDDIFMRSVIQNYAQEGQDKDGGANGVFTLTNSSAQALASEVLATHKSITGAALSKYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLMSDQYISL
Ga0192981_1031814613300019048MarineMKFALVALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGAYWAKAWGHFDVNKTGSIPILYAPQLMRFLSSDQYMSL
Ga0192981_1032125713300019048MarineMPDQAYQPGQSGKLGGGSYDRVTPARFAADNDDIFMRSVVQNYAQEGSWKDGEPTGVFTLSESSARALATEVIGTHKAITGAAAGTYLDTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0192966_1024607113300019050MarineMKFALIALVATATAVTLEGVYQPGQSGKLGGGAYARATPARFSADSDDIFMRSVIQNYAQEGEAKDGNGNGVFTLTQSSAKALAQEVLATHKQISGAASTKYLDTYWAKAWGHFDVNRTGSIPSLYAPGLMRFLASDQYMSL
Ga0192966_1027400513300019050MarineMKFALVALVAMTAAVRVEDVFQPGQNGMIGGGSYERVTPARFAADSDDIFMRSVIQNYAQEGQDKDGGANGVFTLTNSSAQALASEVLATHKSITGAALSKYLDTYWAKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL
Ga0192966_1027552313300019050MarineMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGEAQVGYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0192966_1031001013300019050MarineMKFALVALVAMTAAVRVEDVFQPGQNGMIGGGSYERVTPARFAADSDDIFMRSVIQNYAQEGEAKDGNGDGVFTLTQSSAKALAQEVLCTHKQICAAALGTYLDTYWAKAWGHFDVNRTGSIPALYSPGLMRFLMSDQYISL
Ga0192966_1036338213300019050MarineMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSSKALAMEVLATHKSIKGAAQVAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLMYDQYISL
Ga0193051_11453413300019084MarineKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVVQNYAQEGASKDGEPTGVFTLTESSAKQLAMEVLATHKSIKGAAQVAYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL
Ga0193153_102660013300019097MarineMKFAVIALVAAASAIRRDSGPPYQPGQSGMLGGGTYERVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAQEVLATHKDIRGAAQQKYLDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL
Ga0193153_102738813300019097MarineMGKIISLIKIMKFAVIALVAAASAIRRDAGPPYQPGQSGMLGGGTYERVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAQEVLATHKDIRGEAQVKYLDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL
Ga0193157_103538713300019118MarineMKFAVIALVAAATAIRRDPGPPYQPGQSGMLGGGTYERVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALASEVLGTHKNITGGALQSYLDTYWGKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL
Ga0192980_107827423300019123MarineMKFALVAIVAAASAMQLSRDAGPAYQPGQSGKLGGGVYDRVTPVRFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL
Ga0192980_108869413300019123MarineMKFALIALVATATAVSLEGAPDYQPGQSGKLGGGAYSRVTPARFAADSDDIFMRSVIQNYAQEGSLKNGEPTGVFTLTESSARALATEVIGTHQKVTGAAATKYFDAYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL
Ga0192980_109257913300019123MarineMRFALIALVATATAIRRDAGPAYQPGQSGKLGGGSYDRVTPARFAADNDDIFMRSVVQNYAQEGSWKDGEPTGVFTLSESSARALATEVIGTHKAITGAAAGTYLDTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0192980_109258113300019123MarineMKFAAIALVATATAIRRDAGPAYQPGQSGKLGGGAYERVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKSISGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0192980_109258513300019123MarineMKFAAIALVATATAIRRDAGPAYQPGQSGKLGGGAYERVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNIKGGAQQEYLNTYWAKAWGHFDVNRTGSIPTLYAPGLMRFLMSDQYISL
Ga0193089_112403713300019133MarineMKFALIALVATAAAVKVEGVFQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGEAKDGNGNGVFTLTEMSAKALAQEVLATHKQISGAAQTKYLDTYWAKAWGHFDVNKTGSIPSLYAPGLMRFLMSDQYISL
Ga0193089_112901013300019133MarineMKFALIALVAAASAINLEGKPVVYQPGQSGKLGGGVYDRVTPARFNADSDDIFMRSVIQNYAQEAGTEEGVPTGVFTLTESSARALAMEVLATHKNIRGAAQQQYLDTYWGKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0193089_114508513300019133MarineDSSDSDDDLVQLRGDPVVYQAGQSGKLGGGVYDRVTPPRFAADSDDIFMRSVVQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQQQYLDTYWGKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0193089_114542613300019133MarineMKFALIALVATAAAVKVEGVFQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGEAKDGNGNGVFTLTQSSAKALAQEVLCTHKQICAAAQATYLDTYWAKAWGHFDVNRTGSIPALYAPGLMRFLMSDQYISL
Ga0188870_1015330813300019149Freshwater LakeLIKIMKFALIALVASVSAINLNGDKKPVVYQPGQSGKLGGGVYDRVTPPRFAADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQQEYLNTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0194244_1010427913300019150MarineTWEIISLIKIMKFALVALVAAATAIRRDPGPPYQPGQSGMLGGGTYERVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAQEVIGTHKGITGDAAAKYFDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFFMSDQYISL
Ga0206129_1031555813300020182SeawaterMKFALIALVASATAINLNGDKKPVVYQPGQSGKLGGGVYDRVTPPRFAADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQQEYLNTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0206126_1034505413300020595SeawaterMKFALVAIVAAVSAVTITGDAPPFQPGQSGKLGGGAYDRVTPARFAGDSDDIFMRSVVQNYAQEAATKDGEPTGVFTLTESSAKQLAMEVLATHKSIKGAAQVAYLGSYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL
Ga0206126_1035170623300020595SeawaterMKFALVAIVAAVSAVTLSGSPPFQPGQSGKLGGGSYDRATPARFSSDSDDLFMRSVVQNYAQEGANDDGEPTGVFTLSESSARQLATEVLATHKSIKGAAQATYLGAYWAKAWGHFDVNRTGSIPILYAPQLMRFLCSDQYMSL
Ga0206687_104659813300021169SeawaterIKIMKFALIALVATASAIALNGDKPVVYQPGQSGKLGGGAYNRVTPARFSADNDDIFMRSVIQNYAQEAGTKEGEPTGVFTLTESSARALAMEVLATHKDIKGAAQVEYLATYWAKAWGHFDVNRTGSIPILYAPGLMRFLMSDQYISL
Ga0206688_1002847213300021345SeawaterMKFVAIALVAAVSAIRRDAGPPYQPGQSGMLGGGTYERQTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAQEVLATHKDIKGAAQQTYLDTYWGKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL
Ga0206689_1012804213300021359SeawaterMKFTFAIAVICGLTQAVQVQDVYQPGQSGKLGGGVYNRVIPVRFQADNDDIFMRSVLDNYAQEGMKKDGTPTGVFTLSESSAKALAMEVLATHKNIKGAAQSKYLDTYWAKAWGHFDVNRTGSIPYLYSAGLMRFLMSDQYISL
Ga0206689_1021004213300021359SeawaterMKFAAIALIAAVSAIRRDAGPAYQPGQSGMLGGGTYERVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALASEVLATHKDIKGAAQQTYLDTYWGKAWGHFDVNRTGSIPVLYAPQLMRFLMSDQYISL
Ga0206689_1052364513300021359SeawaterLIKIMKFAAAVLLGLATAVNIQGDFYQPGQSGKLGGGVYNRVIPARFSADNDDIFMRSVLENYAQEGALKDGTPTGVFTLSESSAKALAMEVLATHKNIKGGAQVKYLDTYWAKAWGHFDVNRTGRIPALYCPGLMRFLMSDQYISL
Ga0063089_101809613300021889MarineLIKIMKFACIALVAAASAIQLEGPPIIYQPGQSGKLGGGAYSRATPERFAADSDDIFMRSVIQNYAQEHSNGDGEPNGVFTLTESSARALAQEVVATHKDIKGAAADSYFATYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL
Ga0063870_101747413300021921MarineKFAVIALIATAAAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFAADSDDIFMRSVVQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL
Ga0063102_100034913300021941MarineLIKIMKFALIALVAAASAIALNGDKPVVYQPGQSGKLGGGAYNRVTPARFSADNDDIFMRSVIQNYAQEAGTKEGEPTGVFTLTESSARALAMEVLATHKDIKGAAQVEYLATYWAKAWGHFDVNRTGSIPIFYAPQLMRFLMSDQYISL
Ga0222715_1035057323300021960Estuarine WaterMKFALIALVASASAIALNGDKKPVVYQPGQSGKLGGGEYKRVTPARFDADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQAKYLDTYWAKAWGHFDVNRTGNIPVLYAPQLMRFLMSDQYISL
Ga0222715_1069870813300021960Estuarine WaterSAIALNGDKKPVVYQPGQSGKLGGGEYKRVTPPRFAADSDDIFMRSVIQNYAQEAGTPEGVPTGVFTLSESSARALAMEVLATHKNIRGAAQQQYLDTYWNKAWGHFDVNRTGNIPVLYAPQLMRFLMSDQYISL
Ga0228688_12289613300023565SeawaterLIKIMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0228679_103672913300023566SeawaterKIMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0228686_105996713300023685SeawaterMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0228687_104729013300023696SeawaterMKFAVIALVAATSAIALEGVYQPGQTGKLGGGAYSRVTPERSSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0228685_106542013300023701SeawaterMKFALIALVAATSAIALEGVYQPGQSGKLGGGAYNRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
(restricted) Ga0233439_1019245813300024261SeawaterLPGQSGKLGGGVYSRVIPSRFEADSDDIFMRSVLSSYAREVANKDGVPQGKFYLKKSDAKALAQEVLATHKNIKGAAQEKYLSTYWDKAWGHFDVNKTGQIPALYAPGLMRFLMSDQYIS
Ga0208660_107251313300025570AqueousMKFAVIALIATAAAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0209405_110472413300025620Pelagic MarineMKFAVIALIATAAAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0209405_114129623300025620Pelagic MarineMKFALIALVAAATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLASDQYMSL
Ga0209716_112964413300025626Pelagic MarineMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL
Ga0209197_119649813300025637Pelagic MarineAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL
Ga0209198_114407913300025640Pelagic MarineMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL
Ga0209199_119175913300025809Pelagic MarineMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0247606_103551613300026398SeawaterIKIMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0247559_112614813300026443SeawaterDSSDSDSSDDDFAMVGDYMPGQSGKLGGGVYDRAIPGRFSADSDDLFMRSVFNNYAREGATKDGTPTGVFYLKESDARALAQEVLATHKSIKGAAQDKYMASYFAKAWGHFDVNKTGSIPAMYAPQLMRFLMSDQYISL
Ga0247588_111363413300026465SeawaterIMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0247588_112360813300026465SeawaterLIKIMKFALVALVAAASAIRRDAGPPYQPGQTGMLGGGTYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAQEVLATHKDIRGAAQQSYLDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL
Ga0247603_109739813300026468SeawaterSLIKIMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0247599_112026613300026470SeawaterTSSLVQLESDSSDSDSSDDDFAMVGDYMPGQSGKLGGGVYDRAIPGRFSADSDDLFMRSVFNNYAREGATKDGTPTGVFYLKESDARALAQEVLATHKSIKGAAQDKYMASYFAKAWGHFDVNKTGSIPAMYAPQLMRFLMSDQYISL
Ga0247605_116471713300026503SeawaterLIKIMKFALIALVAATSAIALEGVYQPGQSGKLGGGAYNRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0247605_116639013300026503SeawaterSDSSDSDSSDDDFAMVGDYMPGQSGKLGGGVYDRAIPGRFSADSDDLFMRSVFNNYAREGATKDGTPTGVFYLKESDARALAQEVLATHKSIKGAAQDKYMASYFAKAWGHFDVNKTGSIPAMYAPQLMRFLMSDQYISL
Ga0208796_108623213300027308EstuarineMKFALIALVAAATAINLEGVYQPGQSGKLGGGAYNRATPARFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLMSDQYISL
Ga0209302_1036389523300027810MarineMKFALVALVATTAAISLEGVYQPGQSGKLGGGAYSRVTPDRFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0209092_1033201213300027833MarineMKFAVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0209092_1037967213300027833MarineTSSLVQLESDSSDSDSSDDDLTMVGDYMPGQSGKLGGGVYDRVIPARFNADSDDIFMRSVFNNYAREGATKDGVPTGVFYLKEADARALASEVLATHKSIKGSAADAYLGSYWAKAWGHFDVNKTGSIPAMYSPQLMRFLASDQYMSL
Ga0209092_1048759723300027833MarineMKFALIALVAAASAIQLEGPPIIYQPGQSGKLGGGAYNRATPERFAADSDDIFMRSVIQNYAQEHSNADGEPNGVFTLTESSARALAMEVLDTHKSIKGAAQVAYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0209092_1050874913300027833MarineMKFACIALVAAASAIQLEGPPIIYQPGQSGKLGGGAYSRATPERFAADSDDIFMRSVIQNYAQEHSNGDGEPNGVFTLTESSARALAQEVVATHKDIKGAAADSYFATYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL
Ga0209712_1033693223300027849MarineMKFACIALIAATSAIALEGVYQPGQSGKLGGGAYSRVTPARFAADSDDIFMRSVIQNYAQEGANKDGEPTGVFTLTESSAKALAMEVLDTHKSIKGAAQVAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLSSDQYMSL
Ga0209712_1049071613300027849MarineMKFALAALFAAVSAVNISGQAPFQPGQSGKLGGGAYARVTPARFAGDADDIFMRSVIQNYAQEGANKDGEPTGVFTLSESSAKQLAMEVLDSHKSIKGAAQVAYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0209712_1050731623300027849MarineMKFALIALVATASAIALNGDKPVVYQPGQSGKLGGGAYNRVTPARFSADNDDIFMRSVIQNYAQEAGTKEGEPTGVFTLTESSARALAMEVLATHKDIKGSAQVEYLGTYWAKAWGHFDVNRIGSIPILYAPQLMRFLMSDQYISL
Ga0209712_1052268313300027849MarineMKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFAGDSDDIFMRSVVQNYAQEAASKDGEPTGVFTLTESSAKQLAMEVLSTHKSIKGAAQVAYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL
Ga0209712_1052749623300027849MarineMKFALIALVATTTAIALEGVYQPGQSGKLGGGSYNRATPARFSADSDDIFMRSVIQNYAQEGANKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLSSDQYMSL
Ga0209712_1053357913300027849MarineMKFALVAIVAAVSAVTISGSPPFQPGQSGKLGGGSYDRATPARFSSDSDDLFMRSVVQNYAQEGANDDGEPTGVFTLSESSARQLAMEVLATHKSIKGAAQATYLGAYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0209713_1105185723300027883MarineMKFALVALVATTAAISLEGVYQPGQSGKLGGGAYSRVTPDRFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVAYLDSYWAKAWGHFDVNRTGSIPILYAPQ
Ga0247584_115873813300028110SeawaterMKFALIALVATATAITLEGVYQPGQSGKLGGGAYSRVTPDRFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQVAYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0228645_114680023300028128SeawaterMKFALIALVATATAITLEGVYQPGQSCKLGGGAYSRVTPDRFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQVAYLGTYWAKAWGHFDVNKTGSIPILYAPCLMRFLM
Ga0256412_134194813300028137SeawaterLIKIMKFVAIALVAAVSAIRRDAGPPYQPGQSGMLGGGTYERQTPARFAGDSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAQEVLATHKDIRGAAQQSYLDTYWAKAWGHFDVNRTGSIPVLYAPGLMRFLMSDQYISL
Ga0256412_138784713300028137SeawaterMKFALIALVAATSAIALEGVYQPGQSGKLGGGAYNRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSARALAMEVLETHKSIKGQAQVDYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0247560_12101113300028250SeawaterVIALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0247595_109032313300028333SeawaterKIMKFALIALVATATAITLEGVYQPGQSGKLGGGAYSRVTPDRFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGTYWAKAWGHFDVNKTGSIPILYAPGLMRFLMSDQYISL
Ga0257132_113254013300028671MarineKFACIALVAAASAIALEGVYQPGQSGKLGGGAYSRVTPARFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQGAYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLASDQYMRL
Ga0307402_1087896413300030653MarineMKFAAIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVVQNYAQEGSWKDGEPTGVFTLTQSSANALAAEVICTHKQICGAASTKYFDTYWAKAWGHFDVNRTGSIPILYAPGLMRFFMSDQYISL
Ga0307403_1074465013300030671MarineKIMKFALVALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGAYWAKAWGHFDVNKTGSIPILYAPQLMRFLSSDQYMSL
Ga0308127_105029513300030715MarineKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFAGDSDDIFMRSVVQNYAQEAASKDGEPTGVFTLTESSSKALAMEVLATHKDIKGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0308133_105516013300030721MarineQLESDSSDSDSSDDDLTMVGDYMPGQSGKLGGGVYDRAVPARFSADSDDIFMRSVISSYAREGADKDGTPTGVFYLKESDSKALAGEVLATHKSIKGAALDAYLGSYWAKAWGHFDVNKTGSIPILYAPQLMRFLASDQYMSL
Ga0308133_105812013300030721MarineMKFACIALVAAATAISLEGVYQPGQSGKLGGGAYSRVTPARFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQGSYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0308129_104166913300030723MarineMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0308138_106676113300030724MarineMKFACIALVAAATAISLEGVYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQGTYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0308143_13124613300031540MarineKIMKFAIIALVAAVSAINLNGDPLPLQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQGTYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0308142_107541413300031556MarineLIKIMKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFAGDSDDIFMRSVVQNYAQEAASKDGEPTGVFTLTESSAKQLAMEVLSTHKSIKGAAQVAYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYITL
Ga0308147_104793513300031558MarineKFALVALFAAVSAVNISGDPPPFQPGQSGKLGGGAYDRVTPARFAGDADDLFMRSVVQNYAIEGASKEGEPTGVFTLTESSSKALAMEVLATHKDIKGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0302126_1022654913300031622MarineMKFACIALVAAASAIALEGVYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQGSYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0302126_1032415213300031622MarineMKFACIALVAAATAISLEGVYQPGQSGKLGGGAYSRVTPARFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQGSYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0302125_1012574813300031638MarineMKFACIALVAAATAISLEGVYQPGQSGKLGGGAYSRVTPARFSADSDDIFMRSVIQNYAQEGATKEGEPTGVFTLTESSAKALAMEVLATHKDIKGAAQGTYLDSYWAKAWGHFDVNRTGSIPILYAPQLMRFLSSDQYMSL
Ga0307393_111349223300031674MarineMPGQSGKLGGGVYDRVIPTRFEGDSDDIFMRSVYTNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGGAQTKYLDAYWAKAWGHFDVNKTGQIPAAYAPQLMRFLMSDQYISL
Ga0307385_1040876813300031709MarineMKFALIALVATASAIALNGDKPVVYQPGQSGKLGGGAYNRVTPARFSADSDDIFMRSVIQNYAQEAGTKEGEPTGVFTLTESSARALAMEVLATHKDIKGAAQVEYLATYWAKAWGHFDVNRGGNIEVSRTPQLMRFLASDQRMSLGQ
Ga0307386_1074090413300031710MarineFALIALVATATAIRRDAGPAYQPGQSGKLGGGSYDRVTPARFAADNDDIFMRSVVQNYAQEGSWKDGEPTGVFTLSESSARALATEVIGTHKAITGAAAATYLDTYWAKAWGHFDVNRTGRIPPLYAPQLMRFLMSDQYISL
Ga0307386_1075497013300031710MarineLIKIMKFALIALVATASAIALNGDKPVVYQPGQSGKLGGGAYNRVTPARFSADSDDIFMRSVIQNYAQEAGTKEGEPTGVFTLTESSARALAMEVLATHKDIKGAAQVEYLATYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0307381_1023532423300031725MarineMAGQSGKLGGGKYERVIPTNFNGDADDLFMRSVFSNYAREESEEKTGKPLGKFYLAESDAKALAQEVLATHKNIRGAAQADYMNTYWAKSWGHFDVNRTGRIPPLYAPQLMRFLMSDQYISL
Ga0307381_1035638713300031725MarineKIMKFAVIALVAAATAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAMEVLATHKNISGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0307381_1039000713300031725MarineLIKIMKFALIALVATASAIALNGDKPVVYQPGQSGKLGGGAYNRVTPARFSADSDDIFMRSVIQNYAQEAGTKEGEPTGVFTLTESSARALAMEVLATHKDIKGAAQVEYLATYWAKAWGHFDVNRTGSIPILYAPGLMRFLMSDQYISL
Ga0307391_1081785713300031729MarineLIKIMKFALIALVATASAMQLSRDAGPAYQPGQSGKLGGGVYDRVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAMEVLATHKNISGGAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0307391_1085305713300031729MarineLIKIMKFALVALVAATSAIALEGVYQPGQSGKLGGGAYSRVTPERFAADSDDIFMRSVIQNYAQEGATKDGEPTGVFTLTESSAKALAMEVLATHKSIKGAAQVEYLGAYWAKAWGHFDVNKTGSIPILYAPQLMRFLSSDQYMSL
Ga0307391_1092877213300031729MarineIISLIKIMRFALIALVATATAIRRDAGPAYQPGQSGKLGGGSYDRVTPARFAADNDDIFMRSVVQNYAQEGSWKDGEPTGVFTLSESSARALATEVIGTHKAITGAAAGTYLDTYWAKAWGHFDVNRTGNIPILYAPQLMRFLMSDQYISL
Ga0307394_1019246713300031735MarineMQTADYMPGQSGKLGGGVYDRVIPTRFEGDSDDIFMRSVYTNYAREAAEEKTEKPLGIFYLKESDAKALSSEVLATHKNIKGAAQTKYLDAYWAKAWGHFDVNRTGQIPALYAPQLMRFLMSDQYISL
Ga0307394_1040780313300031735MarineIISLIKIMKFALIALVAAANAIKRDAGPAYQPGQSGKLGGGVYDRVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAMEVLATHKNISGGAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0307383_1065497713300031739MarineMKFAVIALVAAATAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAMEVLATHKNISGAAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0307395_1050411213300031742MarineMKFALIALVATASAMQLSRDAGPAYQPGQSGKLGGGVYDRVTPARFSADNDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSARALAMEVLATHKNISGGAQVEYLGTYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL
Ga0307395_1051696213300031742MarineLIKIMKFAVIALVAAATAIRRDAGPAYQPGQSGKLGGGSYDRVTPARFAADNDDIFMRSVVQNYAQEGSWKDGEPTGVFTLSESSARALATEVIGTHKAITGAAAGTYLDTYWAKAWGHFDVNRTGNIPILYAPQLMRFLSSDQYMSL
Ga0314670_1071834713300032470SeawaterMKFALIALVAAATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0314679_1014012123300032492SeawaterMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0314673_1070894513300032650SeawaterLIKIMKFAVIALIATAAAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0314678_1051718013300032666SeawaterKIMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0314687_1081283713300032707SeawaterMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0314703_1048301713300032723SeawaterSLIKIMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPGLMRFLSSDQYMSL
Ga0314695_136883813300032724SeawaterLIKIMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0314711_1068496013300032732SeawaterLIKIMKFALIALVAAATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPQLMRFLASDQYMSL
Ga0314714_1074751113300032733SeawaterKKFAFIAIIATDAAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0314707_1071665513300032743SeawaterMKFALIALVATATAIRRDAGPAYQPGQSGKLGGGAYDRVTPARFAADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKNISGAAQATYLDTYWAKAWGHFDVNRTGSIPILYAPQLMRFLASDQYMSLQP
Ga0314701_1050140313300032746SeawaterIMKFAVIALIATAAAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL
Ga0314709_1089857813300032755SeawaterIKIMKFAVIALIATAAAIRRDAGPAYQPGQSGKLGGGVYDRVTPARFSADSDDIFMRSVIQNYAQEGSWKDGEPTGVFTLTESSAKALAMEVLATHKQISGAAQVKYLETYWAKAWGHFDVNRTGSIPILYAPGLMRFLASDQYMSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.