| Basic Information | |
|---|---|
| Family ID | F022628 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 213 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVNWARK |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 213 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.79 % |
| % of genes near scaffold ends (potentially truncated) | 98.12 % |
| % of genes from short scaffolds (< 2000 bps) | 87.32 % |
| Associated GOLD sequencing projects | 156 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.282 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.127 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.761 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.357 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.24% β-sheet: 0.00% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 213 Family Scaffolds |
|---|---|---|
| PF00743 | FMO-like | 5.63 |
| PF00107 | ADH_zinc_N | 5.63 |
| PF13602 | ADH_zinc_N_2 | 4.69 |
| PF00903 | Glyoxalase | 3.76 |
| PF08240 | ADH_N | 3.76 |
| PF07859 | Abhydrolase_3 | 2.82 |
| PF13478 | XdhC_C | 2.35 |
| PF01844 | HNH | 2.35 |
| PF02625 | XdhC_CoxI | 1.88 |
| PF13738 | Pyr_redox_3 | 1.41 |
| PF10431 | ClpB_D2-small | 1.41 |
| PF03466 | LysR_substrate | 1.41 |
| PF01058 | Oxidored_q6 | 0.94 |
| PF01850 | PIN | 0.94 |
| PF12706 | Lactamase_B_2 | 0.94 |
| PF14279 | HNH_5 | 0.94 |
| PF13620 | CarboxypepD_reg | 0.94 |
| PF07228 | SpoIIE | 0.94 |
| PF04075 | F420H2_quin_red | 0.94 |
| PF01475 | FUR | 0.94 |
| PF01687 | Flavokinase | 0.94 |
| PF00300 | His_Phos_1 | 0.47 |
| PF00126 | HTH_1 | 0.47 |
| PF01592 | NifU_N | 0.47 |
| PF07927 | HicA_toxin | 0.47 |
| PF12681 | Glyoxalase_2 | 0.47 |
| PF14534 | DUF4440 | 0.47 |
| PF13899 | Thioredoxin_7 | 0.47 |
| PF04909 | Amidohydro_2 | 0.47 |
| PF06574 | FAD_syn | 0.47 |
| PF00144 | Beta-lactamase | 0.47 |
| PF00722 | Glyco_hydro_16 | 0.47 |
| PF14559 | TPR_19 | 0.47 |
| PF13360 | PQQ_2 | 0.47 |
| PF14067 | LssY_C | 0.47 |
| PF03544 | TonB_C | 0.47 |
| PF07394 | DUF1501 | 0.47 |
| PF01451 | LMWPc | 0.47 |
| PF15919 | HicB_lk_antitox | 0.47 |
| PF00440 | TetR_N | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 213 Family Scaffolds |
|---|---|---|---|
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 5.63 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 2.82 |
| COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 1.88 |
| COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 1.41 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.94 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.94 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.94 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.94 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.94 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.47 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.47 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.47 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.28 % |
| Unclassified | root | N/A | 19.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_102548032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_57_11 | 696 | Open in IMG/M |
| 3300002560|JGI25383J37093_10183051 | Not Available | 552 | Open in IMG/M |
| 3300002914|JGI25617J43924_10066122 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300003218|JGI26339J46600_10137871 | Not Available | 574 | Open in IMG/M |
| 3300004080|Ga0062385_10015963 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300004092|Ga0062389_102938561 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300004152|Ga0062386_101212482 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300004635|Ga0062388_101823643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 625 | Open in IMG/M |
| 3300004635|Ga0062388_102924912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300005177|Ga0066690_10461361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter tropicus | 859 | Open in IMG/M |
| 3300005180|Ga0066685_10666756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 715 | Open in IMG/M |
| 3300005187|Ga0066675_10426427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300005332|Ga0066388_100377672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum massiliense | 2064 | Open in IMG/M |
| 3300005446|Ga0066686_10000637 | All Organisms → cellular organisms → Bacteria | 12765 | Open in IMG/M |
| 3300005450|Ga0066682_10057990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2365 | Open in IMG/M |
| 3300005467|Ga0070706_100823340 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005541|Ga0070733_10480828 | Not Available | 830 | Open in IMG/M |
| 3300005553|Ga0066695_10627935 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005561|Ga0066699_10022728 | All Organisms → cellular organisms → Bacteria | 3480 | Open in IMG/M |
| 3300005575|Ga0066702_10223536 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005598|Ga0066706_10850299 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005764|Ga0066903_107596337 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005921|Ga0070766_10070319 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300005921|Ga0070766_10280263 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300006050|Ga0075028_100663357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300006086|Ga0075019_11099142 | Not Available | 516 | Open in IMG/M |
| 3300006162|Ga0075030_100474603 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300006162|Ga0075030_101074426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300006755|Ga0079222_11504475 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300006914|Ga0075436_100616368 | Not Available | 800 | Open in IMG/M |
| 3300007255|Ga0099791_10026282 | All Organisms → cellular organisms → Bacteria | 2530 | Open in IMG/M |
| 3300007258|Ga0099793_10106248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1303 | Open in IMG/M |
| 3300007258|Ga0099793_10243643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300007265|Ga0099794_10301396 | Not Available | 830 | Open in IMG/M |
| 3300009038|Ga0099829_10113766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2121 | Open in IMG/M |
| 3300009089|Ga0099828_10160222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1993 | Open in IMG/M |
| 3300009089|Ga0099828_11925926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300009090|Ga0099827_10082141 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
| 3300009098|Ga0105245_10214860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1853 | Open in IMG/M |
| 3300009162|Ga0075423_10443518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
| 3300009174|Ga0105241_11152769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300010048|Ga0126373_12088268 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010320|Ga0134109_10254073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300010326|Ga0134065_10137409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 843 | Open in IMG/M |
| 3300010335|Ga0134063_10025720 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300010336|Ga0134071_10324903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300010359|Ga0126376_11692954 | Not Available | 667 | Open in IMG/M |
| 3300010360|Ga0126372_12858169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300010364|Ga0134066_10040550 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300010376|Ga0126381_100104436 | All Organisms → cellular organisms → Bacteria | 3626 | Open in IMG/M |
| 3300010379|Ga0136449_100494143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2128 | Open in IMG/M |
| 3300010401|Ga0134121_10280955 | Not Available | 1467 | Open in IMG/M |
| 3300011119|Ga0105246_10702118 | Not Available | 887 | Open in IMG/M |
| 3300011271|Ga0137393_10013154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5816 | Open in IMG/M |
| 3300012096|Ga0137389_10156400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1870 | Open in IMG/M |
| 3300012189|Ga0137388_10552806 | Not Available | 1070 | Open in IMG/M |
| 3300012189|Ga0137388_10700607 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300012201|Ga0137365_10314092 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300012202|Ga0137363_10145298 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300012202|Ga0137363_10378574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1176 | Open in IMG/M |
| 3300012202|Ga0137363_11474525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012203|Ga0137399_10238083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1489 | Open in IMG/M |
| 3300012205|Ga0137362_10451237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300012357|Ga0137384_10192937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1705 | Open in IMG/M |
| 3300012357|Ga0137384_10988622 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012362|Ga0137361_10018082 | All Organisms → cellular organisms → Bacteria | 5288 | Open in IMG/M |
| 3300012363|Ga0137390_11133985 | Not Available | 731 | Open in IMG/M |
| 3300012582|Ga0137358_10943208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300012683|Ga0137398_10387815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300012917|Ga0137395_10303908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300012917|Ga0137395_11111725 | Not Available | 559 | Open in IMG/M |
| 3300012918|Ga0137396_10315880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1156 | Open in IMG/M |
| 3300012925|Ga0137419_10241266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300012927|Ga0137416_10217781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1542 | Open in IMG/M |
| 3300012929|Ga0137404_10411847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
| 3300012929|Ga0137404_11985257 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012931|Ga0153915_12222337 | Not Available | 642 | Open in IMG/M |
| 3300012944|Ga0137410_11783679 | Not Available | 543 | Open in IMG/M |
| 3300012964|Ga0153916_10525737 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300012975|Ga0134110_10496273 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012975|Ga0134110_10593757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300013297|Ga0157378_11260762 | Not Available | 780 | Open in IMG/M |
| 3300014153|Ga0181527_1062879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1909 | Open in IMG/M |
| 3300014165|Ga0181523_10814050 | Not Available | 509 | Open in IMG/M |
| 3300014166|Ga0134079_10454619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300014200|Ga0181526_10644385 | Not Available | 669 | Open in IMG/M |
| 3300014968|Ga0157379_10687114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300015051|Ga0137414_1150269 | All Organisms → cellular organisms → Bacteria | 4581 | Open in IMG/M |
| 3300015052|Ga0137411_1375645 | All Organisms → cellular organisms → Bacteria | 5189 | Open in IMG/M |
| 3300015241|Ga0137418_10209272 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300016341|Ga0182035_10611577 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300016357|Ga0182032_11131938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 672 | Open in IMG/M |
| 3300016404|Ga0182037_11908859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300016404|Ga0182037_11989621 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300016750|Ga0181505_10293676 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300016750|Ga0181505_10465727 | Not Available | 569 | Open in IMG/M |
| 3300017822|Ga0187802_10023898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2126 | Open in IMG/M |
| 3300017823|Ga0187818_10038051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2064 | Open in IMG/M |
| 3300017823|Ga0187818_10482976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300017936|Ga0187821_10470479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300017942|Ga0187808_10236649 | Not Available | 816 | Open in IMG/M |
| 3300017943|Ga0187819_10531375 | Not Available | 669 | Open in IMG/M |
| 3300017943|Ga0187819_10551769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300017944|Ga0187786_10114819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300017955|Ga0187817_10327692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 976 | Open in IMG/M |
| 3300017961|Ga0187778_10673843 | Not Available | 698 | Open in IMG/M |
| 3300017972|Ga0187781_11088541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300017974|Ga0187777_10143094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1592 | Open in IMG/M |
| 3300017995|Ga0187816_10003936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5053 | Open in IMG/M |
| 3300017995|Ga0187816_10463172 | Not Available | 568 | Open in IMG/M |
| 3300018012|Ga0187810_10357173 | Not Available | 610 | Open in IMG/M |
| 3300018035|Ga0187875_10682373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300018043|Ga0187887_10252603 | Not Available | 1044 | Open in IMG/M |
| 3300018058|Ga0187766_10640772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300018062|Ga0187784_10763110 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300018086|Ga0187769_10382906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300018088|Ga0187771_10049502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3269 | Open in IMG/M |
| 3300018088|Ga0187771_11617097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300018090|Ga0187770_10554701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300019788|Ga0182028_1079343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
| 3300020015|Ga0193734_1055838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300020579|Ga0210407_10071107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2612 | Open in IMG/M |
| 3300020579|Ga0210407_10975357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300020580|Ga0210403_10214251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1580 | Open in IMG/M |
| 3300020580|Ga0210403_10525376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300020580|Ga0210403_11025660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300020581|Ga0210399_10837467 | Not Available | 749 | Open in IMG/M |
| 3300020581|Ga0210399_11023480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 664 | Open in IMG/M |
| 3300020581|Ga0210399_11110676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300020581|Ga0210399_11509778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300021046|Ga0215015_10763314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300021088|Ga0210404_10253706 | Not Available | 957 | Open in IMG/M |
| 3300021168|Ga0210406_10358038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1176 | Open in IMG/M |
| 3300021168|Ga0210406_10469446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300021168|Ga0210406_10899194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300021170|Ga0210400_10326616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1261 | Open in IMG/M |
| 3300021170|Ga0210400_10664178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300021180|Ga0210396_11012576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300021181|Ga0210388_11111239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300021401|Ga0210393_10124374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum massiliense | 2064 | Open in IMG/M |
| 3300021402|Ga0210385_10103455 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300021404|Ga0210389_10538713 | Not Available | 918 | Open in IMG/M |
| 3300021404|Ga0210389_11456437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300021404|Ga0210389_11492833 | Not Available | 514 | Open in IMG/M |
| 3300021405|Ga0210387_11190505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300021407|Ga0210383_11233594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300021474|Ga0210390_11510257 | Not Available | 531 | Open in IMG/M |
| 3300021476|Ga0187846_10112368 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300021477|Ga0210398_11335677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300021478|Ga0210402_11042903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300021478|Ga0210402_11241537 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300021478|Ga0210402_11568555 | Not Available | 585 | Open in IMG/M |
| 3300021478|Ga0210402_11579962 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300021559|Ga0210409_11038285 | Not Available | 694 | Open in IMG/M |
| 3300021560|Ga0126371_10516120 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300022724|Ga0242665_10235610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300024179|Ga0247695_1026748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300024323|Ga0247666_1122175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300024330|Ga0137417_1127202 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300024330|Ga0137417_1218493 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300024330|Ga0137417_1382563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1879 | Open in IMG/M |
| 3300025498|Ga0208819_1020719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1807 | Open in IMG/M |
| 3300025929|Ga0207664_11015861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300025929|Ga0207664_11626864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300025941|Ga0207711_10107712 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
| 3300026088|Ga0207641_11242365 | Not Available | 745 | Open in IMG/M |
| 3300026551|Ga0209648_10119612 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300026557|Ga0179587_10874598 | Not Available | 592 | Open in IMG/M |
| 3300026557|Ga0179587_11114249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300026921|Ga0207860_1021596 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300027073|Ga0208366_1041264 | Not Available | 518 | Open in IMG/M |
| 3300027528|Ga0208985_1031349 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300027676|Ga0209333_1177936 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027725|Ga0209178_1266059 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027787|Ga0209074_10340429 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300027835|Ga0209515_10279295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300027846|Ga0209180_10042849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2478 | Open in IMG/M |
| 3300027867|Ga0209167_10762270 | Not Available | 527 | Open in IMG/M |
| 3300027882|Ga0209590_10459807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300027889|Ga0209380_10228927 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300027895|Ga0209624_10946924 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027903|Ga0209488_10314096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300027903|Ga0209488_10792509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300027903|Ga0209488_10883917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300027911|Ga0209698_10653452 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300030007|Ga0311338_11413194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300031090|Ga0265760_10377840 | Not Available | 509 | Open in IMG/M |
| 3300031231|Ga0170824_101669348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 961 | Open in IMG/M |
| 3300031236|Ga0302324_101409055 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031564|Ga0318573_10553238 | Not Available | 620 | Open in IMG/M |
| 3300031708|Ga0310686_100735911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300031708|Ga0310686_117262063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300031720|Ga0307469_10263537 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300031720|Ga0307469_10616711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300031720|Ga0307469_11830368 | Not Available | 587 | Open in IMG/M |
| 3300031799|Ga0318565_10228562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300031820|Ga0307473_11207823 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031910|Ga0306923_11299701 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031954|Ga0306926_10333035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1877 | Open in IMG/M |
| 3300032059|Ga0318533_10034969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3280 | Open in IMG/M |
| 3300032059|Ga0318533_11308638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300032065|Ga0318513_10634598 | Not Available | 523 | Open in IMG/M |
| 3300032094|Ga0318540_10226419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300032174|Ga0307470_10394761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300032180|Ga0307471_100453364 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300032180|Ga0307471_100819126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
| 3300032180|Ga0307471_101216865 | Not Available | 917 | Open in IMG/M |
| 3300032180|Ga0307471_101917830 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300032782|Ga0335082_11215720 | Not Available | 621 | Open in IMG/M |
| 3300032805|Ga0335078_10638195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
| 3300032828|Ga0335080_10454721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1366 | Open in IMG/M |
| 3300032892|Ga0335081_10111802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4024 | Open in IMG/M |
| 3300033480|Ga0316620_11408293 | Not Available | 687 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.88% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.47% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.47% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.47% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.47% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.47% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1025480321 | 3300000955 | Soil | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNWARKSSIWPL |
| JGI25383J37093_101830511 | 3300002560 | Grasslands Soil | MDQTRGIMSVSPGKGATLSRPDDFGKLLEGEGILFAQLDKVVNWARK |
| JGI25617J43924_100661223 | 3300002914 | Grasslands Soil | MRKWVGRHTMSTSLGKHATLTRPDDFGNLLEDQGIIFTTLDKAVNW |
| JGI26339J46600_101378711 | 3300003218 | Bog Forest Soil | MATTLGKSVSLTKPDDFGKLLQDEGIIFTQLDKAVNWARKS |
| Ga0062385_100159631 | 3300004080 | Bog Forest Soil | MKPDEGTMSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNWARKSSIWPLG |
| Ga0062389_1029385611 | 3300004092 | Bog Forest Soil | MSTSVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0062386_1012124822 | 3300004152 | Bog Forest Soil | MGSYEGHMETTLGKSVTLTKPDDFGKLLQDEGIIFTQLDK |
| Ga0062388_1018236431 | 3300004635 | Bog Forest Soil | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWPL |
| Ga0062388_1029249122 | 3300004635 | Bog Forest Soil | MTSDEGTMSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKA |
| Ga0066690_104613613 | 3300005177 | Soil | MIFGEERMSTSVGKHATLTKPEDFGSLLQDEGIIFTQLDKAVNWAR |
| Ga0066685_106667562 | 3300005180 | Soil | MSTSLGKHVTLSKPADFGSLLQDEGIIFTSLDKAVNWARKSSIWP |
| Ga0066675_104264271 | 3300005187 | Soil | VHPICLPLLPVRKYLGRNTMSTSLGKHVTLTKPDDFGNLLEDEGLIFTTLDKAVNWAR |
| Ga0066388_1003776723 | 3300005332 | Tropical Forest Soil | MSTSLGKHITLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSSIWPL |
| Ga0066686_1000063715 | 3300005446 | Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSSIW |
| Ga0066682_100579903 | 3300005450 | Soil | MSVSLGKHVTLTKPDDFGNLLQDEGIIFTTLDKAVNWARKSSIW |
| Ga0070706_1008233402 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0070733_104808282 | 3300005541 | Surface Soil | MSTSVGKNVTLQKPDDFGQLLEDEGIIFTQLDKAVNWAR |
| Ga0066695_106279351 | 3300005553 | Soil | MSTSLGKHITLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSSIW |
| Ga0066699_100227281 | 3300005561 | Soil | MSTSLGKHVTLTKPDDFGNLLEDEGLIFTTLDKAVNWAR |
| Ga0066702_102235361 | 3300005575 | Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSSIWPL |
| Ga0066706_108502992 | 3300005598 | Soil | MSISLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVNWARKSSIWP |
| Ga0066903_1075963371 | 3300005764 | Tropical Forest Soil | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNWARKSSI |
| Ga0070766_100703193 | 3300005921 | Soil | MILYEGPMSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNWARKSSIWP |
| Ga0070766_102802631 | 3300005921 | Soil | MSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNWARKSSIWP |
| Ga0075028_1006633571 | 3300006050 | Watersheds | MSTSAGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0075019_110991421 | 3300006086 | Watersheds | MSTSVGKNVTLEKPDDFGQLLQDEGIIFTQLDKAVNWA |
| Ga0075030_1004746032 | 3300006162 | Watersheds | MATTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSS |
| Ga0075030_1010744261 | 3300006162 | Watersheds | MSTELGKHVTLTKPDDFGKLLEDDGIIFTTLDKAVNWARKSSIWP |
| Ga0079222_115044751 | 3300006755 | Agricultural Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNW |
| Ga0075436_1006163681 | 3300006914 | Populus Rhizosphere | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNW |
| Ga0099791_100262824 | 3300007255 | Vadose Zone Soil | MSTSIAKNVALEKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0099793_101062481 | 3300007258 | Vadose Zone Soil | MSVSLGKHATLTKPDDFGDLLQDEGIIFTTLDKAVNWARKSS |
| Ga0099793_102436431 | 3300007258 | Vadose Zone Soil | MSTSLGKHATLTKPDDFGSLLEDEGIIFTTLDKAVNWARKSSIWPL |
| Ga0099794_103013961 | 3300007265 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAV |
| Ga0099829_101137663 | 3300009038 | Vadose Zone Soil | MSTSLGKHATLTKPDDFGNLLEDEGIIFTTLDKAVNWARK |
| Ga0099828_101602223 | 3300009089 | Vadose Zone Soil | MSTSLGKHVTLTKPGDFGDLLKDEGIIFTTLDKAVNWA |
| Ga0099828_119259261 | 3300009089 | Vadose Zone Soil | MSTSLGKHVTLTKPGDFGDLLKDEGIIFTTLDKAVNWARKSSI |
| Ga0099827_100821414 | 3300009090 | Vadose Zone Soil | MSVAPGRNVTLERPEDMGKLLAEEGIIFTVLDKAVNWARKN |
| Ga0105245_102148601 | 3300009098 | Miscanthus Rhizosphere | MSTALGKHVTLTKPDDFGKLLEDEGIIFATLDKAVNWARKSSIWPLG |
| Ga0075423_104435181 | 3300009162 | Populus Rhizosphere | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVN |
| Ga0105241_111527691 | 3300009174 | Corn Rhizosphere | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNWARK |
| Ga0126373_120882682 | 3300010048 | Tropical Forest Soil | MSTSLGKHATLTKPEDFGSLLQDEGIIFTQLDKAVNWARKSSIWPLG |
| Ga0134109_102540732 | 3300010320 | Grasslands Soil | MSVSLGKHVTLTKSDDFGNFLKDEGIIFTTLYKAVNWARK |
| Ga0134065_101374092 | 3300010326 | Grasslands Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARKS |
| Ga0134063_100257204 | 3300010335 | Grasslands Soil | MSTSLGKHVTLTKPDDFGKLLEDEGMIFTTLDKAVNWARKSSIWPLG |
| Ga0134071_103249031 | 3300010336 | Grasslands Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSSI |
| Ga0126376_116929541 | 3300010359 | Tropical Forest Soil | MSAVFGKNATLERPEDVGKFLADEGIIFTQLDKAVNWARKSS |
| Ga0126372_128581692 | 3300010360 | Tropical Forest Soil | MSTSLGKHVTLTRPDDFGKLLEDEGIIFATLDKAVNWARKS |
| Ga0134066_100405501 | 3300010364 | Grasslands Soil | MSTSLGKHVTLSKPTDFGSLLQDEGIIFTSLDKAVNWARKSSIWPLS |
| Ga0126381_1001044364 | 3300010376 | Tropical Forest Soil | MSTSLGKHATLTKPEDFGSLLQDEGIIFTQLDKAV |
| Ga0136449_1004941433 | 3300010379 | Peatlands Soil | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTQLDKAVNWARKS |
| Ga0134121_102809551 | 3300010401 | Terrestrial Soil | MSTSLGKHVTLTKPDDFGSLLEDARLIFPTLDKAVNWARKS |
| Ga0105246_107021181 | 3300011119 | Miscanthus Rhizosphere | MSVSAGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVN |
| Ga0137393_100131541 | 3300011271 | Vadose Zone Soil | MSTSLGKHATLTKPDDFGSLLEDEGIIFTTLDKAVNWARKSS |
| Ga0137389_101564003 | 3300012096 | Vadose Zone Soil | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNWARKS |
| Ga0137388_105528062 | 3300012189 | Vadose Zone Soil | MSVSLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVNWARK |
| Ga0137388_107006072 | 3300012189 | Vadose Zone Soil | MSTSLGKHVTLSKPDDFGSLLQDEGIIFTSLDKAVNWARKSS |
| Ga0137365_103140923 | 3300012201 | Vadose Zone Soil | MSTSLGKHVTLTKPGDFGKLLEDEGIIFTTLDKAVN |
| Ga0137363_101452983 | 3300012202 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVNWARK |
| Ga0137363_103785741 | 3300012202 | Vadose Zone Soil | MSVSLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVN |
| Ga0137363_114745251 | 3300012202 | Vadose Zone Soil | MSTSIAKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWPL |
| Ga0137399_102380831 | 3300012203 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGSLLQDEGIIFATLDKAVNWARKSSIWPLGF |
| Ga0137362_104512371 | 3300012205 | Vadose Zone Soil | MSTSLGKHVTLTRPDDFGNLLEDQGIIFTTLDKAVNWARKSSIWPLS |
| Ga0137384_101929372 | 3300012357 | Vadose Zone Soil | MSTSLGKHATLTKPDDFGNLLEDEGIIFTTLDKAVN |
| Ga0137384_109886223 | 3300012357 | Vadose Zone Soil | MSTSLGKHVTLTKPGDFGKLLEDEGIIFTTLDKAVNWAR |
| Ga0137361_100180821 | 3300012362 | Vadose Zone Soil | VSVSLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVNWARKS |
| Ga0137390_111339851 | 3300012363 | Vadose Zone Soil | MSTSVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWAR |
| Ga0137358_109432082 | 3300012582 | Vadose Zone Soil | MSRGYMSTSLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVNWARKSSIWP |
| Ga0137398_103878151 | 3300012683 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTTLDKAVNWARK |
| Ga0137395_103039081 | 3300012917 | Vadose Zone Soil | MSISVGKNVTLEKPDDFGKLLRDEGIIFTQLDKAVNWARK |
| Ga0137395_111117251 | 3300012917 | Vadose Zone Soil | MSISVGKNVPLEKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0137396_103158801 | 3300012918 | Vadose Zone Soil | MRKYRSRGAMSTSLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVNWARKS |
| Ga0137419_102412661 | 3300012925 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGNLLAEEGIIFTTLDKAVNWARKSS |
| Ga0137416_102177811 | 3300012927 | Vadose Zone Soil | MSISLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAVNWARKSSIW |
| Ga0137404_104118472 | 3300012929 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARR |
| Ga0137404_119852571 | 3300012929 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTTLDKAVNWARKSSI* |
| Ga0153915_122223372 | 3300012931 | Freshwater Wetlands | MSVSLGKHVTLTKPDDFGKLLQEEGILFTQLDKVVNWARKS |
| Ga0137410_117836792 | 3300012944 | Vadose Zone Soil | MSVSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARR |
| Ga0153916_105257373 | 3300012964 | Freshwater Wetlands | MSVSLGKHVTLTKPDDFGKLLQEEGILFTQLDKVVNWARK |
| Ga0134110_104962731 | 3300012975 | Grasslands Soil | MSTSLGKHATLTKPEDFGSLLQDEGIIFTKLDKAVNWARK |
| Ga0134110_105937571 | 3300012975 | Grasslands Soil | MSTSLGKHVTLTKPNDFGNLLEDEGIIFTTLDKAVNWARKSSIW |
| Ga0157378_112607622 | 3300013297 | Miscanthus Rhizosphere | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNWARKSS |
| Ga0181527_10628793 | 3300014153 | Bog | MATTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0181523_108140501 | 3300014165 | Bog | MMMILRDAEGQGRMSTSLGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVN* |
| Ga0134079_104546191 | 3300014166 | Grasslands Soil | MSTSLGKHVTLTKPDDFGNLLEDEGIIFTTLDKAVN |
| Ga0181526_106443852 | 3300014200 | Bog | METTLGKNVTLSKPEDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0157379_106871141 | 3300014968 | Switchgrass Rhizosphere | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNWARKSSIWP |
| Ga0137414_11502696 | 3300015051 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGELLEDEGIIFTTLDKAVNWRVEAPIWPLGLGSRVARSR* |
| Ga0137411_13756455 | 3300015052 | Vadose Zone Soil | MSVSIGKNVTLEKPDDFGKLLQDEGIIFTQLIRP* |
| Ga0137418_102092723 | 3300015241 | Vadose Zone Soil | MSITIGKHVTLEKPDDFGKLLQDEGIIFTQLDKAVNWA |
| Ga0182035_106115771 | 3300016341 | Soil | MKVKRGLMDTSLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNW |
| Ga0182032_111319382 | 3300016357 | Soil | METTLEKRVALNKPADFGKLLQAEGIIFTQLDKAVNWARKSS |
| Ga0182037_119088591 | 3300016404 | Soil | MEMTLGKSVTLAKPDDFGKLLQDEGIIFTQLDKAVSWARKSSIWP |
| Ga0182037_119896212 | 3300016404 | Soil | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWA |
| Ga0181505_102936762 | 3300016750 | Peatland | METSLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0181505_104657272 | 3300016750 | Peatland | STSIGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNRCS |
| Ga0187802_100238981 | 3300017822 | Freshwater Sediment | MSANANLGKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSI |
| Ga0187818_100380513 | 3300017823 | Freshwater Sediment | MATTLGKSVTLTKPGDFGKLLQDEGIIFTQLDKAVNWAR |
| Ga0187818_104829761 | 3300017823 | Freshwater Sediment | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTTLDKAVNWARKSSIWP |
| Ga0187821_104704792 | 3300017936 | Freshwater Sediment | MSASLGKHVTLTKPDDFGSLLQDEGIIFTTLDKAVNWARKSSIWP |
| Ga0187808_102366493 | 3300017942 | Freshwater Sediment | MSITAGKNVTLEKPDDFGKLLQEEGIIFTQLDKAVNWAR |
| Ga0187819_105313751 | 3300017943 | Freshwater Sediment | MSTSAGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVN |
| Ga0187819_105517692 | 3300017943 | Freshwater Sediment | METTLGKSITLTKPDDFGKLLQDEGIVFTQLDKAVNWARKS |
| Ga0187786_101148191 | 3300017944 | Tropical Peatland | MEGKRGLMDTSLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWPL |
| Ga0187817_103276921 | 3300017955 | Freshwater Sediment | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTMLDQAVN |
| Ga0187778_106738431 | 3300017961 | Tropical Peatland | METSLGKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSS |
| Ga0187781_110885413 | 3300017972 | Tropical Peatland | MSTSLGKHVTLTKPDDFGKLLEEEGIIFTTLDKAVNWARKSSIWPL |
| Ga0187777_101430941 | 3300017974 | Tropical Peatland | METNLAKHVTLSKPDDFGKLLQDEGIIFTQLDKAVNWA |
| Ga0187816_100039367 | 3300017995 | Freshwater Sediment | MSTSIGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWPLG |
| Ga0187816_104631722 | 3300017995 | Freshwater Sediment | METNLAKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIW |
| Ga0187810_103571731 | 3300018012 | Freshwater Sediment | MSTTTSLGKSVTLSKPEDFGELLKDEGIIFTQLDKAVNWARKS |
| Ga0187875_106823732 | 3300018035 | Peatland | MCIKEVPMETTLAKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWPLGFG |
| Ga0187887_102526031 | 3300018043 | Peatland | MSTSLGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0187766_106407722 | 3300018058 | Tropical Peatland | MATTETTLGKSVTLTKPDDFGKLLQDDGIIFTQLDKA |
| Ga0187784_107631101 | 3300018062 | Tropical Peatland | MSETTTLGKSITLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSS |
| Ga0187769_103829061 | 3300018086 | Tropical Peatland | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSI |
| Ga0187771_100495021 | 3300018088 | Tropical Peatland | MGTDTNLGKHVTLTKPDDFGKLLQDEDIIFTQLDKAVNW |
| Ga0187771_116170971 | 3300018088 | Tropical Peatland | MATTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0187770_105547012 | 3300018090 | Tropical Peatland | MAPPLGKSVTLTKPDDFGKLLQDEGILFTQLDKAV |
| Ga0182028_10793431 | 3300019788 | Fen | MATTLGKSVTLTKPDDFGKLLQDEGIIFAQFDKAVNWARKSSIWPL |
| Ga0193734_10558382 | 3300020015 | Soil | MSVSLGKHVTLTKPDDFGDLLEDEGIIFTTLDKAVN |
| Ga0210407_100711071 | 3300020579 | Soil | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTQLDKAVNWARK |
| Ga0210407_109753571 | 3300020579 | Soil | MSSTPTALGKGVTLTKPDDFGRLLQDEGIIFTQLDKAVNWARK |
| Ga0210403_102142511 | 3300020580 | Soil | MSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNWARK |
| Ga0210403_105253761 | 3300020580 | Soil | MSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVN |
| Ga0210403_110256602 | 3300020580 | Soil | MSVSVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVN |
| Ga0210399_108374672 | 3300020581 | Soil | MNTSVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSI |
| Ga0210399_110234802 | 3300020581 | Soil | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIW |
| Ga0210399_111106761 | 3300020581 | Soil | MSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNWARTSSIWPLG |
| Ga0210399_115097782 | 3300020581 | Soil | MSTSVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWPLG |
| Ga0215015_107633142 | 3300021046 | Soil | MSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNWSRR |
| Ga0210404_102537061 | 3300021088 | Soil | MTTSVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAV |
| Ga0210406_103580382 | 3300021168 | Soil | MSTSLGKHVTLSKPDDFGSLLEDEGIIFTTLDKAVNWAR |
| Ga0210406_104694461 | 3300021168 | Soil | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTTLDKAVNWARKSSIWPL |
| Ga0210406_108991942 | 3300021168 | Soil | MSVSLGKHVSLTKPDDFGKLLEDEGIIFTTLDKAVNWARR |
| Ga0210400_103266161 | 3300021170 | Soil | MSTTIGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKS |
| Ga0210400_106641781 | 3300021170 | Soil | MSVSLGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWA |
| Ga0210396_110125762 | 3300021180 | Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWAR |
| Ga0210388_111112391 | 3300021181 | Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWA |
| Ga0210393_101243743 | 3300021401 | Soil | MSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNWARKS |
| Ga0210385_101034551 | 3300021402 | Soil | MSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNW |
| Ga0210389_105387131 | 3300021404 | Soil | METNLAKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWA |
| Ga0210389_114564371 | 3300021404 | Soil | MSTSVGKNVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0210389_114928331 | 3300021404 | Soil | MSVSLGQGVTLTKPDDFGKLLEDEGVIFAQLDKAVNWA |
| Ga0210387_111905052 | 3300021405 | Soil | MSTTLGKNVTLDKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0210383_112335941 | 3300021407 | Soil | MSTSVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKS |
| Ga0210390_115102572 | 3300021474 | Soil | MSTSLGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0187846_101123684 | 3300021476 | Biofilm | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTSLDKAVNW |
| Ga0210398_113356772 | 3300021477 | Soil | MSTSLGKHATLTKPDDFGSLLEDEGIIFTTLDKAVNWARKSSIW |
| Ga0210402_110429031 | 3300021478 | Soil | MSTSLDKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSSIWPLG |
| Ga0210402_112415372 | 3300021478 | Soil | METTLAKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNW |
| Ga0210402_115685551 | 3300021478 | Soil | METTLAKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWA |
| Ga0210402_115799622 | 3300021478 | Soil | METTLARHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWA |
| Ga0210409_110382852 | 3300021559 | Soil | MSVSLGKHVTLSKPDDFGKLLEDEGIIFTTLDKAVNW |
| Ga0126371_105161203 | 3300021560 | Tropical Forest Soil | METSMGKHITLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0242665_102356102 | 3300022724 | Soil | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTQLDKAVNW |
| Ga0247695_10267482 | 3300024179 | Soil | MSATLGKHITLTKPEDFGKLLEDEGIIFTTLDKAVN |
| Ga0247666_11221751 | 3300024323 | Soil | MSTTLGKHITLTKPEDFGKLLEDEGIIFTTLDKAVN |
| Ga0137417_11272021 | 3300024330 | Vadose Zone Soil | MSTSIAKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIS |
| Ga0137417_12184931 | 3300024330 | Vadose Zone Soil | MSTSIAKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKP |
| Ga0137417_13825631 | 3300024330 | Vadose Zone Soil | MSTSLGKHATLTKPDDFGNLLADEGIIFTTLDKAVNWARKSSIWPLGFGAPFGRLASGWP |
| Ga0208819_10207191 | 3300025498 | Peatland | MATTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSI |
| Ga0207664_110158611 | 3300025929 | Agricultural Soil | MSISLGKNVTLEKPDDFGKLVQDEGIIFTQLDKAVNWARKSSI |
| Ga0207664_116268642 | 3300025929 | Agricultural Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSSIWPLG |
| Ga0207711_101077121 | 3300025941 | Switchgrass Rhizosphere | MSTALGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSSI |
| Ga0207641_112423651 | 3300026088 | Switchgrass Rhizosphere | MSTPLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNW |
| Ga0209648_101196123 | 3300026551 | Grasslands Soil | MSTSLGKHATLTRPDDFGNLLEDQGIIFTTLDKAVNWARKSSI |
| Ga0179587_108745982 | 3300026557 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGNLLEDEGIIFTTLDKAVNWTHKSYI |
| Ga0179587_111142492 | 3300026557 | Vadose Zone Soil | MSTSIAKNVTLEKPDDFGKLLQDEGIIFTQLDKAVN |
| Ga0207860_10215962 | 3300026921 | Tropical Forest Soil | METTLAKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWAR |
| Ga0208366_10412642 | 3300027073 | Forest Soil | METNLAKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWAR |
| Ga0208985_10313491 | 3300027528 | Forest Soil | MSTSLGKHVTLSKPDDFGKLLEDEGIIFTTLDKAVNWAR |
| Ga0209333_11779362 | 3300027676 | Forest Soil | MSTSLGKNVTLTKPDDFGKLLEDEGIIFTTLDKAVN |
| Ga0209178_12660592 | 3300027725 | Agricultural Soil | MSTSLGKHVTLTKPDDFGSLLQDEGIIFTQLDKAVNWARKSSIWPLG |
| Ga0209074_103404291 | 3300027787 | Agricultural Soil | MSTSLGKHVTLSKPDDFGSLLQDEGIIFTRLDKAVNWARKSSIWPLGF |
| Ga0209515_102792952 | 3300027835 | Groundwater | MSQVLGKNVTLTRPDDLGKLVADEGIIFTALDKAVNWARKNSIWPL |
| Ga0209180_100428494 | 3300027846 | Vadose Zone Soil | MSTSLGKHATLTKPDDFGNLLEDEGIIFTTLDKAVNWAR |
| Ga0209167_107622702 | 3300027867 | Surface Soil | MSTSVGKNVTLQKPDDFGQLLEDEGIIFTQLDKAVNWARKSSIW |
| Ga0209590_104598072 | 3300027882 | Vadose Zone Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWARKSS |
| Ga0209380_102289271 | 3300027889 | Soil | MSTSLGKHVTLTKPDDFGSLLEDEGIIFTTLDKAVNWA |
| Ga0209624_109469241 | 3300027895 | Forest Soil | MSTSLGKNVTLTKPDDFGKLLEDEGIIFTTLDKAVNWAR |
| Ga0209488_103140962 | 3300027903 | Vadose Zone Soil | MSTSLGKHVTLTRPDDFGNLLEDQGIIVTTLDKAVNWALKSSIWPLS |
| Ga0209488_107925092 | 3300027903 | Vadose Zone Soil | MSVSLGKHVTLTKPDDFGKLLEDDGIIFTQLDKAV |
| Ga0209488_108839172 | 3300027903 | Vadose Zone Soil | MSISLGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIW |
| Ga0209698_106534521 | 3300027911 | Watersheds | MSPELGKHVTLTKPDDFGKLLEDEGVIFTTLDKAVNWARKSS |
| Ga0311338_114131942 | 3300030007 | Palsa | MSTTVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWPLG |
| Ga0265760_103778401 | 3300031090 | Soil | MSTSVGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0170824_1016693481 | 3300031231 | Forest Soil | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVN |
| Ga0302324_1014090551 | 3300031236 | Palsa | MSTSIGKNVTLDKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0318573_105532381 | 3300031564 | Soil | MEKRDDEESMSTSLGKHATLTKPEDFGSLLQDEGIIFTQLDKAVNWARKSSSWP |
| Ga0310686_1007359112 | 3300031708 | Soil | MSTSIGKHVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIW |
| Ga0310686_1172620632 | 3300031708 | Soil | MSISAGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKS |
| Ga0307469_102635371 | 3300031720 | Hardwood Forest Soil | MSATLGKHITLTKPEDFGKLLEDEGIIFTTLDKAVNWARRSS |
| Ga0307469_106167112 | 3300031720 | Hardwood Forest Soil | MSTSLGKHVTLTRPDDFGTLLEDEGIIFTTLDKAVNWARKSSIWPL |
| Ga0307469_118303682 | 3300031720 | Hardwood Forest Soil | MSATLGKHITLTKPGDFGKLLEDEGIIFTTLDKAV |
| Ga0318565_102285623 | 3300031799 | Soil | MSTSLGKHVTLTRPDDFGKLLEDEGIIFTTLDKAVNWARKSSIW |
| Ga0307473_112078232 | 3300031820 | Hardwood Forest Soil | METTVAKHVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0306923_112997011 | 3300031910 | Soil | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWP |
| Ga0306926_103330351 | 3300031954 | Soil | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARK |
| Ga0318533_100349691 | 3300032059 | Soil | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWAR |
| Ga0318533_113086382 | 3300032059 | Soil | MSTSLGKSVTLAKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIW |
| Ga0318513_106345981 | 3300032065 | Soil | MDTNLGKSVTLTKPDDFGKLLEDEGILFTQLDKAVNWAR |
| Ga0318540_102264192 | 3300032094 | Soil | METTLGKSVTLTKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIWPLG |
| Ga0307470_103947611 | 3300032174 | Hardwood Forest Soil | MSVSLGKHVTLTKPDDFGKLLEDEGIIFTTLDKAVNWAR |
| Ga0307471_1004533641 | 3300032180 | Hardwood Forest Soil | MSTSLGKHATLTKPDDFGKLLEDEGIIFTSLDKAVNWARKSSSWP |
| Ga0307471_1008191261 | 3300032180 | Hardwood Forest Soil | MSVSLGKHVTLTKPDDFGDLLQDEGIIFTTLDKAVNWARTSS |
| Ga0307471_1012168652 | 3300032180 | Hardwood Forest Soil | MSTSLGKHVTLTKPDDFGKLLEDEGIIFTQLDKAV |
| Ga0307471_1019178302 | 3300032180 | Hardwood Forest Soil | MSVSLGKHVTLARPDDFGKLLEDEGIIFTTLDKAV |
| Ga0335082_112157202 | 3300032782 | Soil | METNLAKHVTLTKPDDFGKLLQDEGIIFTQLDKAVN |
| Ga0335078_106381952 | 3300032805 | Soil | MSTSLGKHVTLTKPDDFGELLEDEGVIFTTLDKAVNW |
| Ga0335080_104547211 | 3300032828 | Soil | MSTSLGRHVTLTKPDDFGSLLKDEGIIFTTLDKAVNWARKSSI |
| Ga0335081_101118025 | 3300032892 | Soil | MGTEGNLGKHVTLTKPDDFGKLLQDEGIVFTQLDKAVNWARKSSIWPLG |
| Ga0316620_114082932 | 3300033480 | Soil | MSTTLGKNVTLEKPDDFGKLLQDEGIIFTQLDKAVNWARKSSIW |
| ⦗Top⦘ |