| Basic Information | |
|---|---|
| Family ID | F022538 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 214 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LLRRNIVIDAETAQLVAAAVQAALQAGAPSRPPRRGPRVPAPDCEPLF |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 214 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.64 % |
| % of genes near scaffold ends (potentially truncated) | 64.49 % |
| % of genes from short scaffolds (< 2000 bps) | 67.76 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.075 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.486 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.570 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.187 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 22.37% β-sheet: 0.00% Coil/Unstructured: 77.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 214 Family Scaffolds |
|---|---|---|
| PF01740 | STAS | 7.01 |
| PF02796 | HTH_7 | 3.74 |
| PF00589 | Phage_integrase | 3.27 |
| PF13466 | STAS_2 | 2.34 |
| PF00196 | GerE | 1.87 |
| PF00239 | Resolvase | 1.40 |
| PF13340 | DUF4096 | 1.40 |
| PF13683 | rve_3 | 0.93 |
| PF05103 | DivIVA | 0.93 |
| PF02899 | Phage_int_SAM_1 | 0.93 |
| PF01526 | DDE_Tnp_Tn3 | 0.93 |
| PF13700 | DUF4158 | 0.93 |
| PF07228 | SpoIIE | 0.93 |
| PF08843 | AbiEii | 0.93 |
| PF13191 | AAA_16 | 0.93 |
| PF11239 | DUF3040 | 0.47 |
| PF13490 | zf-HC2 | 0.47 |
| PF00248 | Aldo_ket_red | 0.47 |
| PF01325 | Fe_dep_repress | 0.47 |
| PF13546 | DDE_5 | 0.47 |
| PF07702 | UTRA | 0.47 |
| PF09299 | Mu-transpos_C | 0.47 |
| PF13358 | DDE_3 | 0.47 |
| PF02687 | FtsX | 0.47 |
| PF13374 | TPR_10 | 0.47 |
| PF05257 | CHAP | 0.47 |
| PF12697 | Abhydrolase_6 | 0.47 |
| PF07311 | Dodecin | 0.47 |
| PF10009 | DUF2252 | 0.47 |
| PF01545 | Cation_efflux | 0.47 |
| PF12973 | Cupin_7 | 0.47 |
| PF13365 | Trypsin_2 | 0.47 |
| PF00440 | TetR_N | 0.47 |
| PF03693 | ParD_antitoxin | 0.47 |
| PF13561 | adh_short_C2 | 0.47 |
| PF03551 | PadR | 0.47 |
| PF00078 | RVT_1 | 0.47 |
| PF08281 | Sigma70_r4_2 | 0.47 |
| PF14022 | DUF4238 | 0.47 |
| PF13592 | HTH_33 | 0.47 |
| PF08751 | TrwC | 0.47 |
| PF00656 | Peptidase_C14 | 0.47 |
| PF04542 | Sigma70_r2 | 0.47 |
| PF01575 | MaoC_dehydratas | 0.47 |
| PF13549 | ATP-grasp_5 | 0.47 |
| PF00665 | rve | 0.47 |
| PF00392 | GntR | 0.47 |
| PF13518 | HTH_28 | 0.47 |
| PF13401 | AAA_22 | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 214 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.40 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.40 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.93 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.93 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.93 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.93 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.47 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.47 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.47 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.47 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.47 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.47 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.47 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.47 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.47 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.47 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.47 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.47 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.47 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.47 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.47 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.07 % |
| All Organisms | root | All Organisms | 43.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100771871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 791 | Open in IMG/M |
| 3300005339|Ga0070660_101382433 | Not Available | 598 | Open in IMG/M |
| 3300005435|Ga0070714_101075110 | Not Available | 784 | Open in IMG/M |
| 3300005436|Ga0070713_100160865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2004 | Open in IMG/M |
| 3300005436|Ga0070713_100850485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 876 | Open in IMG/M |
| 3300005440|Ga0070705_100301812 | Not Available | 1148 | Open in IMG/M |
| 3300005445|Ga0070708_101529193 | Not Available | 622 | Open in IMG/M |
| 3300005445|Ga0070708_101705116 | Not Available | 586 | Open in IMG/M |
| 3300005467|Ga0070706_101603513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300005468|Ga0070707_102314382 | Not Available | 505 | Open in IMG/M |
| 3300005471|Ga0070698_100072807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3443 | Open in IMG/M |
| 3300005576|Ga0066708_10835040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300005577|Ga0068857_101567852 | Not Available | 642 | Open in IMG/M |
| 3300005614|Ga0068856_102435194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 531 | Open in IMG/M |
| 3300005616|Ga0068852_101456593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
| 3300006028|Ga0070717_10170914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1890 | Open in IMG/M |
| 3300006028|Ga0070717_10286209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1462 | Open in IMG/M |
| 3300006028|Ga0070717_10807091 | Not Available | 854 | Open in IMG/M |
| 3300006028|Ga0070717_11811235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 552 | Open in IMG/M |
| 3300006163|Ga0070715_10592336 | Not Available | 649 | Open in IMG/M |
| 3300006176|Ga0070765_100145300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2110 | Open in IMG/M |
| 3300006574|Ga0074056_11451190 | Not Available | 505 | Open in IMG/M |
| 3300006755|Ga0079222_11326633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia oceani | 658 | Open in IMG/M |
| 3300006796|Ga0066665_11290158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix syringae | 560 | Open in IMG/M |
| 3300006797|Ga0066659_10241676 | Not Available | 1347 | Open in IMG/M |
| 3300006954|Ga0079219_10540403 | Not Available | 831 | Open in IMG/M |
| 3300007788|Ga0099795_10414150 | Not Available | 614 | Open in IMG/M |
| 3300009090|Ga0099827_10020899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4539 | Open in IMG/M |
| 3300009090|Ga0099827_11393025 | Not Available | 610 | Open in IMG/M |
| 3300009177|Ga0105248_10812370 | Not Available | 1055 | Open in IMG/M |
| 3300009522|Ga0116218_1042179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2063 | Open in IMG/M |
| 3300009523|Ga0116221_1176880 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300009525|Ga0116220_10390548 | Not Available | 621 | Open in IMG/M |
| 3300009551|Ga0105238_11147599 | Not Available | 800 | Open in IMG/M |
| 3300009551|Ga0105238_11355994 | Not Available | 738 | Open in IMG/M |
| 3300009672|Ga0116215_1311911 | Not Available | 683 | Open in IMG/M |
| 3300009683|Ga0116224_10451293 | Not Available | 612 | Open in IMG/M |
| 3300009698|Ga0116216_10329156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
| 3300009700|Ga0116217_10077138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2323 | Open in IMG/M |
| 3300009700|Ga0116217_10204890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1295 | Open in IMG/M |
| 3300010373|Ga0134128_11496280 | Not Available | 743 | Open in IMG/M |
| 3300010376|Ga0126381_101396432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1012 | Open in IMG/M |
| 3300010379|Ga0136449_100086079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6583 | Open in IMG/M |
| 3300010379|Ga0136449_100477517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2175 | Open in IMG/M |
| 3300010379|Ga0136449_100928208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1414 | Open in IMG/M |
| 3300010379|Ga0136449_101693370 | Not Available | 954 | Open in IMG/M |
| 3300010379|Ga0136449_102295177 | Not Available | 783 | Open in IMG/M |
| 3300010379|Ga0136449_103022647 | Not Available | 656 | Open in IMG/M |
| 3300010379|Ga0136449_103177052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300010379|Ga0136449_104239281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 531 | Open in IMG/M |
| 3300010396|Ga0134126_10756451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus | 1101 | Open in IMG/M |
| 3300010398|Ga0126383_11885078 | Not Available | 686 | Open in IMG/M |
| 3300010868|Ga0124844_1136377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 933 | Open in IMG/M |
| 3300010880|Ga0126350_10715973 | Not Available | 693 | Open in IMG/M |
| 3300011271|Ga0137393_10589363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Quadrisphaera → environmental samples → uncultured Quadrisphaera sp. | 953 | Open in IMG/M |
| 3300012205|Ga0137362_10183197 | Not Available | 1800 | Open in IMG/M |
| 3300012207|Ga0137381_10066733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3002 | Open in IMG/M |
| 3300012207|Ga0137381_10202771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 1719 | Open in IMG/M |
| 3300012207|Ga0137381_10721743 | Not Available | 866 | Open in IMG/M |
| 3300012350|Ga0137372_10096074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2493 | Open in IMG/M |
| 3300012351|Ga0137386_10747477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300012357|Ga0137384_10061171 | Not Available | 3122 | Open in IMG/M |
| 3300012359|Ga0137385_11316915 | Not Available | 585 | Open in IMG/M |
| 3300012363|Ga0137390_10337246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1489 | Open in IMG/M |
| 3300012363|Ga0137390_10470121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1232 | Open in IMG/M |
| 3300012363|Ga0137390_10506054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1181 | Open in IMG/M |
| 3300012683|Ga0137398_10936366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 603 | Open in IMG/M |
| 3300012917|Ga0137395_10502012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 874 | Open in IMG/M |
| 3300013104|Ga0157370_11117874 | Not Available | 712 | Open in IMG/M |
| 3300013105|Ga0157369_12532286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 519 | Open in IMG/M |
| 3300013296|Ga0157374_10992946 | Not Available | 858 | Open in IMG/M |
| 3300013296|Ga0157374_11887454 | Not Available | 623 | Open in IMG/M |
| 3300015242|Ga0137412_10227170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1483 | Open in IMG/M |
| 3300015356|Ga0134073_10435589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300015357|Ga0134072_10236833 | Not Available | 651 | Open in IMG/M |
| 3300016270|Ga0182036_11336397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. NEAU-AAG7 | 599 | Open in IMG/M |
| 3300016341|Ga0182035_10927877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura geliboluensis | 769 | Open in IMG/M |
| 3300016357|Ga0182032_11414232 | Not Available | 602 | Open in IMG/M |
| 3300016371|Ga0182034_11495518 | Not Available | 591 | Open in IMG/M |
| 3300016422|Ga0182039_10672719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 911 | Open in IMG/M |
| 3300016445|Ga0182038_11934940 | Not Available | 533 | Open in IMG/M |
| 3300017926|Ga0187807_1014786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2401 | Open in IMG/M |
| 3300017926|Ga0187807_1050382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300017926|Ga0187807_1073009 | Not Available | 1069 | Open in IMG/M |
| 3300017928|Ga0187806_1227037 | Not Available | 640 | Open in IMG/M |
| 3300017933|Ga0187801_10199125 | Not Available | 793 | Open in IMG/M |
| 3300017943|Ga0187819_10071671 | Not Available | 2062 | Open in IMG/M |
| 3300017955|Ga0187817_10020341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3935 | Open in IMG/M |
| 3300017955|Ga0187817_10459990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora takensis | 812 | Open in IMG/M |
| 3300017972|Ga0187781_10733505 | Not Available | 715 | Open in IMG/M |
| 3300017972|Ga0187781_11263738 | Not Available | 544 | Open in IMG/M |
| 3300017975|Ga0187782_10226722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1402 | Open in IMG/M |
| 3300017975|Ga0187782_11033417 | Not Available | 640 | Open in IMG/M |
| 3300017975|Ga0187782_11183986 | Not Available | 598 | Open in IMG/M |
| 3300018040|Ga0187862_10560252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300018046|Ga0187851_10730513 | Not Available | 557 | Open in IMG/M |
| 3300018058|Ga0187766_10509819 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300018085|Ga0187772_10152133 | Not Available | 1531 | Open in IMG/M |
| 3300018090|Ga0187770_11095661 | Not Available | 642 | Open in IMG/M |
| 3300018431|Ga0066655_10247361 | Not Available | 1136 | Open in IMG/M |
| 3300019877|Ga0193722_1058672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 967 | Open in IMG/M |
| 3300020579|Ga0210407_10555876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300021171|Ga0210405_11324586 | Not Available | 528 | Open in IMG/M |
| 3300021178|Ga0210408_10084699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2488 | Open in IMG/M |
| 3300021401|Ga0210393_10229261 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300021407|Ga0210383_10025817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4923 | Open in IMG/M |
| 3300024288|Ga0179589_10225389 | Not Available | 826 | Open in IMG/M |
| 3300025900|Ga0207710_10205086 | Not Available | 975 | Open in IMG/M |
| 3300025910|Ga0207684_11155046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300025914|Ga0207671_11281922 | Not Available | 571 | Open in IMG/M |
| 3300025915|Ga0207693_11008634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300025918|Ga0207662_10666574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora takensis | 727 | Open in IMG/M |
| 3300025922|Ga0207646_10927942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300025922|Ga0207646_11092281 | Not Available | 702 | Open in IMG/M |
| 3300025929|Ga0207664_10216877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1658 | Open in IMG/M |
| 3300025929|Ga0207664_10317728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1374 | Open in IMG/M |
| 3300026551|Ga0209648_10057448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3310 | Open in IMG/M |
| 3300026551|Ga0209648_10308400 | Not Available | 1126 | Open in IMG/M |
| 3300026555|Ga0179593_1180180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2244 | Open in IMG/M |
| 3300027512|Ga0209179_1089312 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027787|Ga0209074_10346538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 608 | Open in IMG/M |
| 3300027812|Ga0209656_10036848 | All Organisms → cellular organisms → Bacteria | 2850 | Open in IMG/M |
| 3300027824|Ga0209040_10029703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3469 | Open in IMG/M |
| 3300027882|Ga0209590_11059726 | Not Available | 503 | Open in IMG/M |
| 3300031546|Ga0318538_10698378 | Not Available | 550 | Open in IMG/M |
| 3300031564|Ga0318573_10248018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
| 3300031564|Ga0318573_10682565 | Not Available | 552 | Open in IMG/M |
| 3300031679|Ga0318561_10524800 | Not Available | 652 | Open in IMG/M |
| 3300031680|Ga0318574_10213288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. HBU206391 | 1111 | Open in IMG/M |
| 3300031708|Ga0310686_118441348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1966 | Open in IMG/M |
| 3300031713|Ga0318496_10025640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2949 | Open in IMG/M |
| 3300031713|Ga0318496_10488585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300031724|Ga0318500_10678216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
| 3300031768|Ga0318509_10198320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. HBU206391 | 1116 | Open in IMG/M |
| 3300031770|Ga0318521_10043397 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
| 3300031777|Ga0318543_10042085 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300031777|Ga0318543_10466616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
| 3300031778|Ga0318498_10017924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2964 | Open in IMG/M |
| 3300031782|Ga0318552_10543669 | Not Available | 593 | Open in IMG/M |
| 3300031797|Ga0318550_10579774 | Not Available | 539 | Open in IMG/M |
| 3300031798|Ga0318523_10506592 | Not Available | 597 | Open in IMG/M |
| 3300031910|Ga0306923_10659617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1169 | Open in IMG/M |
| 3300031912|Ga0306921_11196073 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031941|Ga0310912_11500564 | Not Available | 507 | Open in IMG/M |
| 3300032059|Ga0318533_10429690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. NEAU-AAG7 | 966 | Open in IMG/M |
| 3300032059|Ga0318533_10673736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 759 | Open in IMG/M |
| 3300032064|Ga0318510_10161703 | Not Available | 889 | Open in IMG/M |
| 3300032065|Ga0318513_10268851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 827 | Open in IMG/M |
| 3300032160|Ga0311301_10082768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6549 | Open in IMG/M |
| 3300032160|Ga0311301_10218870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3216 | Open in IMG/M |
| 3300032180|Ga0307471_103605622 | Not Available | 548 | Open in IMG/M |
| 3300032205|Ga0307472_101590583 | Not Available | 642 | Open in IMG/M |
| 3300032782|Ga0335082_11151507 | Not Available | 642 | Open in IMG/M |
| 3300032783|Ga0335079_10241818 | Not Available | 1988 | Open in IMG/M |
| 3300032783|Ga0335079_10380193 | Not Available | 1526 | Open in IMG/M |
| 3300032783|Ga0335079_10519273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1268 | Open in IMG/M |
| 3300032783|Ga0335079_11251974 | Not Available | 743 | Open in IMG/M |
| 3300032783|Ga0335079_12217489 | Not Available | 524 | Open in IMG/M |
| 3300032805|Ga0335078_10214556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2658 | Open in IMG/M |
| 3300032805|Ga0335078_12007371 | Not Available | 619 | Open in IMG/M |
| 3300032828|Ga0335080_10070886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3864 | Open in IMG/M |
| 3300032828|Ga0335080_10146337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2616 | Open in IMG/M |
| 3300032892|Ga0335081_10695261 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300032892|Ga0335081_10998185 | Not Available | 976 | Open in IMG/M |
| 3300032892|Ga0335081_11804236 | Not Available | 661 | Open in IMG/M |
| 3300032892|Ga0335081_12364521 | Not Available | 554 | Open in IMG/M |
| 3300032954|Ga0335083_10545991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300032954|Ga0335083_11199688 | Not Available | 588 | Open in IMG/M |
| 3300032955|Ga0335076_10510434 | Not Available | 1085 | Open in IMG/M |
| 3300033004|Ga0335084_10933906 | Not Available | 876 | Open in IMG/M |
| 3300033158|Ga0335077_10128247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2938 | Open in IMG/M |
| 3300033289|Ga0310914_10274722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1517 | Open in IMG/M |
| 3300033289|Ga0310914_11183890 | Not Available | 666 | Open in IMG/M |
| 3300034820|Ga0373959_0194235 | Not Available | 533 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.35% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.21% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.47% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.47% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1007718712 | 3300004152 | Bog Forest Soil | VLLRRNIIIDAETAQLVAAVVQAALQADAPSRPPRRRPRVPAADCEPLF* |
| Ga0062388_1015353721 | 3300004635 | Bog Forest Soil | DPETAQLVADAVQAALQADAPSQPPRRRRRIPPADYAPLF* |
| Ga0066673_100647841 | 3300005175 | Soil | NIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF* |
| Ga0070682_1005706901 | 3300005337 | Corn Rhizosphere | VVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF* |
| Ga0070660_1013824332 | 3300005339 | Corn Rhizosphere | VLLRRNIAIDPETAQLVAAAVQTALQAGAPSRPPRRGPRVPAADCEPLF* |
| Ga0070688_1017111752 | 3300005365 | Switchgrass Rhizosphere | LRRNIAIDAETAQLVADAVQAALRPAAPSRPPRRRPRGPAAGSEPLF* |
| Ga0070714_1010751101 | 3300005435 | Agricultural Soil | VLLRRNIAVDAETAQLVAAAVQAALRAGTPSRPPRRGPRVPPAGSEPLF* |
| Ga0070713_1001608651 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRNIAIDPEAAQLVADAVQAVLRPARLPGRRAGARVPAAGSEPLF* |
| Ga0070713_1008504853 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | CCSTWNIVIDAETVQLVAAAVKAPLRAGAPSRPPHRGRRGPTANSEPLF* |
| Ga0070705_1003018122 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LLRRNIVIDAETAQLVAAAVQAALQAGAPSRPPRRGPRVPAPDCEPLF* |
| Ga0070708_1015291931 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | NIAVDAETAQLVAAAVQAALQASTPSRPPRRGPRVPAAGCEPLF* |
| Ga0070708_1017051162 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRVLLRRNIAIDAETAQLVADAVQAALRAGAPSRPPRRRRRPPPADCAPLF* |
| Ga0066681_104419661 | 3300005451 | Soil | IAIDAETAQLVADAVQAVLLPAAPSRPPRRRPRGPAAGSEPLF* |
| Ga0070706_1015293031 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF* |
| Ga0070706_1016035131 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RRNIAIDAETAQLVADAVQAALRADAPTWPPRRRPRVLPAGCEPLF* |
| Ga0070707_1023143821 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GQVVRRVLLRRNIVIDAETAQLVAATVQAALQAGAPSRPPRRGPRVRAADCEPLF* |
| Ga0070698_1000728075 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLRRNIVIDAETAQLVAATVQAALQAGAPSRPPRRGPRVRAADCEPLF* |
| Ga0066708_108350402 | 3300005576 | Soil | DPETAQLVAAAVQAALQASTPSRPPRRRPRVPPIDGEPLF* |
| Ga0068857_1015678521 | 3300005577 | Corn Rhizosphere | TVQLVAAAVQAALQADAPSRLARRRPRAPATGSESLF* |
| Ga0068856_1024351942 | 3300005614 | Corn Rhizosphere | AIDPETAQLVAAAVQVALQAGASSRPPRRGPRVPPVGCEPLF* |
| Ga0068852_1014565932 | 3300005616 | Corn Rhizosphere | VLRRRNIVIDAETAQLVAAAVQAALRAGAPSWPPRRGRRGPTANTEPVF* |
| Ga0070717_101709141 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NIAVDAETAQLAAAVQAALQADAPSRLACRRPRAPATGSEPLF* |
| Ga0070717_102862092 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AGQVVRRMLLRRNIVIDAETARLVAAAVQAALHTGAPTRPPRRGRRVPAADCEPLF* |
| Ga0070717_108070911 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QVVRRVLLRRNIAIDAETAQLVAAAVQAALQADAPRLPHRRTRVPAGDCEPLF* |
| Ga0070717_118112351 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PETAQLVAAAVQAALQVDAPSRPPRPRRRAPAAGCEPLF* |
| Ga0070715_105923362 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AAARNMAVDAETAQLVADAVQAALRAGAPSRPPRRRRRVPPADCAPLF* |
| Ga0070716_1004336931 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RVLLRRNIAIDAETAQLVADAVQAALQPGTPSRPPPRRARGPAAESEPLF* |
| Ga0075014_1009208921 | 3300006174 | Watersheds | AETAQLVADAVQAALQADVPSRPPRRRPRGPAADSEPLF* |
| Ga0070765_1001453002 | 3300006176 | Soil | VLLHRNIAIDPGTARLVADAVQAALQAGTPSRPPRRRLHVSPVGWEALFLFL* |
| Ga0074056_114511902 | 3300006574 | Soil | IDAETAQLVAAAVQAALQTGTPSRWPGRGPRFSAAGCEPLS* |
| Ga0079222_113266332 | 3300006755 | Agricultural Soil | VLLRRNIAIDPETAQLVAAAVQVALQAGASSRPPRRGPRVPPVGCEPLF* |
| Ga0066665_112901582 | 3300006796 | Soil | VLLRRNIVIDAETAQLVAAAVQAALQAGAPSRPLSRGPRGPAAGSGPLS* |
| Ga0066659_102416762 | 3300006797 | Soil | VVRRVLLRRNIAIDAETAQLVAAAVQVALQAGTPSRPSRRGPRVPAADCEPLF* |
| Ga0079219_105404033 | 3300006954 | Agricultural Soil | VVRRVLLRRNIAVDAETVQLVAAAVQAALQADAPSRLARRRPRAPATGSESLF* |
| Ga0099794_104236393 | 3300007265 | Vadose Zone Soil | LLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF* |
| Ga0099795_104141501 | 3300007788 | Vadose Zone Soil | IVIDAETAHLVAAAVQAALQAGAPRLPRRRPRVPAGDCEPLF* |
| Ga0099827_100208991 | 3300009090 | Vadose Zone Soil | VLLRRNIAVDTETAQLVADAVQAALHPGPPSRPPRRRPRDPAGGSEPLF* |
| Ga0099827_113930251 | 3300009090 | Vadose Zone Soil | VVRRVLLRRNIVIDVETAQLVAAAVQAALQADKPSLPARRRPRVPSTYCEPLF* |
| Ga0105248_108123701 | 3300009177 | Switchgrass Rhizosphere | RNIAIDAETAQLVADAVQAALRAGTPSRPPRRRRRVPPADCAPLF* |
| Ga0116222_14150771 | 3300009521 | Peatlands Soil | IDAETAQLVADAVQAALQPAAPSQSPRRRPRGPAAGSEPLF* |
| Ga0116218_10421794 | 3300009522 | Peatlands Soil | RRVLLRRNIAIDAETAQLVAAAVQAALQAGTPSRPPRRGPRIPPADGEPLF* |
| Ga0116221_11768801 | 3300009523 | Peatlands Soil | MLLRRNIVIDAETAQIVAAAVQAALQAGAPSRPPGRARRVPAADCEPLF* |
| Ga0116220_101999782 | 3300009525 | Peatlands Soil | VLLRRNIAIDAETAQLVADAVQAALQPAAPSQSPRRRPRGPAAGSEPLF* |
| Ga0116220_103905482 | 3300009525 | Peatlands Soil | RVLLRRNIVIDAETAQLVAAAVQAALQAGAPSRPPLRGPRAPAAGCEPPS* |
| Ga0105238_101378721 | 3300009551 | Corn Rhizosphere | AETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF* |
| Ga0105238_111475991 | 3300009551 | Corn Rhizosphere | VLRRRNIVIDAETAQLVTAAVQAALRAGAPSWPPRRGRREPTANTEPVF* |
| Ga0105238_113559942 | 3300009551 | Corn Rhizosphere | LVAAAVQAALQADAPSRSARRRPPAPATASEPLF* |
| Ga0116215_10848563 | 3300009672 | Peatlands Soil | VLLRRNIAIDAETAQLVADAVQAALQPAAPSQPPRRRPRGPAAGSEPLF* |
| Ga0116215_13119112 | 3300009672 | Peatlands Soil | RRVLLRRNIPIDPETAQLVADAVQAALRAGAPSRPPRPRRRVPPAGCAPLF* |
| Ga0116224_104512931 | 3300009683 | Peatlands Soil | QVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAPSRPPRRHRRVPPGDLLTLF* |
| Ga0116216_103291561 | 3300009698 | Peatlands Soil | LLLRNIVIDAETAQLVAAVQAALQAGARSRPPRRGPRVPAADCEPLF* |
| Ga0116217_100771383 | 3300009700 | Peatlands Soil | VVRRVLLRRNIVIDAETAQLAAAAVQAALQADMPSRPPGRRQRLPVGCEPPS* |
| Ga0116217_102048901 | 3300009700 | Peatlands Soil | VLLRRNIAVDAETAQLVADAVQAALRAGAPARPPRRRRRVPPAGCAPLF* |
| Ga0134128_114962801 | 3300010373 | Terrestrial Soil | VLLRRNIVIDAETAQLVAAAVQAALQTGTPSRWPGRGLRVPADGCEPLS* |
| Ga0126381_1013964322 | 3300010376 | Tropical Forest Soil | DAETAQLVAAAVQAALRVGAPSRPPRRGTRAPAADGEPLF* |
| Ga0136449_1000860797 | 3300010379 | Peatlands Soil | VLLRRNIVIDAETAQLVAAAVQAALQAGEPSRRPGRGPRVPVVGCGPLS* |
| Ga0136449_1003333691 | 3300010379 | Peatlands Soil | VLLRRNIAIDAETAQLVADAGQAALQPAAPSQSPRRRPRGPAAGSEPLF* |
| Ga0136449_1004775171 | 3300010379 | Peatlands Soil | NIVIDAETAQLVAAAVQAALQTGTPPRPRRRGPRVPAADCELLF* |
| Ga0136449_1009282081 | 3300010379 | Peatlands Soil | GQVVRRVLLRRNIVIDAETAHLVVAAVQAALQAGAPSRPPRRRRRVPAADCEPLF* |
| Ga0136449_1016933701 | 3300010379 | Peatlands Soil | ETAQLVADAVQAALRAGAPSRPPRRRRRVPPADCAPLF* |
| Ga0136449_1022951771 | 3300010379 | Peatlands Soil | IVIDAETAQLVAAAVQAALQAGAPSRPPRRRSRVRAADCEPLF* |
| Ga0136449_1030226472 | 3300010379 | Peatlands Soil | VRRVLLRRNIAVDAETAQLVAAAVQAALQATAPSRRLGRRPRVPAAGSEPLF* |
| Ga0136449_1031770521 | 3300010379 | Peatlands Soil | IAIDAETAQLVAAAVQAALQAGASSRPPRRRPRVPPADCERLF* |
| Ga0136449_1042392811 | 3300010379 | Peatlands Soil | LLRRNIAIDAETAQLVADAVQAALRAGAPARPPRRGPRVSAAGCEPLF* |
| Ga0136449_1046565571 | 3300010379 | Peatlands Soil | VRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF* |
| Ga0134126_107564512 | 3300010396 | Terrestrial Soil | LLRRNIVIDAETAHLVAAAVQAALQTGASSRLPHRGSRVPAADCEPLF* |
| Ga0134126_124356241 | 3300010396 | Terrestrial Soil | LVAAAVQAALQPAAPSRPLRRRPRGPAAGSEPLF* |
| Ga0126383_118850782 | 3300010398 | Tropical Forest Soil | VRRVLLRRNIVIDTETAQLVAAAVQAALQAGEPSRRPGRGPRVPGVGYEPLS* |
| Ga0134121_127136101 | 3300010401 | Terrestrial Soil | IDAETAQLVADAVQAALQPAAPSLPPRRRPCDPADAREPLF* |
| Ga0124844_11363772 | 3300010868 | Tropical Forest Soil | VLLRRNIVIDAETAQLVAAAVQAALQSGAPSQRPRQRPRVPPASCERLF* |
| Ga0126350_107159731 | 3300010880 | Boreal Forest Soil | IDAETAQLVAAAVQAALQEGAPSRPRRRGPRVPAEYERLF* |
| Ga0137393_105893633 | 3300011271 | Vadose Zone Soil | VLLRRNIVIDAETARLVAAAVQAALQAGAPSRPPRRVRRVPAVDCEPLF* |
| Ga0137362_101831973 | 3300012205 | Vadose Zone Soil | VLLRRNIVIDAETAQLVAAAVQAALQAGAPSRPPSRGPRVPAAGCEPLF* |
| Ga0137381_100667331 | 3300012207 | Vadose Zone Soil | IDAETAQLVAAAVQAALQAGASSRPPRRGPRVPAADCEPLF* |
| Ga0137381_102027713 | 3300012207 | Vadose Zone Soil | VLLRRNIVIDAETAHLVAAAVQAALQAGAPSRLPRRRPRVPAGDCEPLF* |
| Ga0137381_107217431 | 3300012207 | Vadose Zone Soil | LRRNIVIDAETAQLVAAAVQAALRAGASSRPPRRGPRVPPTDCEPLF* |
| Ga0137377_109363342 | 3300012211 | Vadose Zone Soil | RVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRDPAAGSEPLF* |
| Ga0137372_100960743 | 3300012350 | Vadose Zone Soil | RRVLLRRNIAVGAETAQLAAAAVQAALQAGPPSRPPRRRPRAPATGSEPLS* |
| Ga0137386_107474772 | 3300012351 | Vadose Zone Soil | RRVLLRRNIAIDAETVAAAVQAALQVGASSRPPRRRPRVPPADCERLF* |
| Ga0137384_100611711 | 3300012357 | Vadose Zone Soil | RRVLLRRNIAIDAETAQLVAAAVQAALQVGASSRPPRRRPRVPPADCERLF* |
| Ga0137385_113169151 | 3300012359 | Vadose Zone Soil | RVLLRRNIAIDAETAQLVAAAVQAALQAGASSRPPRRRPRVPPADCERLF* |
| Ga0137390_103372464 | 3300012363 | Vadose Zone Soil | RVLLRRNIAIDAETAQLVAAAVQAALQVDAPSRPPRPRRRVPSADCEPLF* |
| Ga0137390_104701212 | 3300012363 | Vadose Zone Soil | VVRRVLLRRNIAIDAETAQLVAAAVQAALQAGASSRPPRRRPRVPPADCEPLF* |
| Ga0137390_105060541 | 3300012363 | Vadose Zone Soil | QVVRRVLLRRNIAIDAETAHLVAAAVQAALQAGTPSRPPRRRPRVPPIDGEPLF* |
| Ga0137358_106703542 | 3300012582 | Vadose Zone Soil | RVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRRPAAGSEPLF* |
| Ga0137398_109363662 | 3300012683 | Vadose Zone Soil | RRNIVIDAETAQVVAAAVQAALQAGGPSKPPRRRPHTPATDCEPLF* |
| Ga0137395_105020122 | 3300012917 | Vadose Zone Soil | DAETAQLVAAAVQAALQAGAPSRPPRRGPRVPADCEPLF* |
| Ga0157370_111178742 | 3300013104 | Corn Rhizosphere | RNIAVDAETAQLAAAVQAALQADAPSRLARRRPRAPATGSEPLF* |
| Ga0157369_125322861 | 3300013105 | Corn Rhizosphere | QRLYVVRRVLRRRNIVIDAETAQLVTAAVQAALRAGAPSWPPRRGRRGPTANTEPVF* |
| Ga0157374_109929462 | 3300013296 | Miscanthus Rhizosphere | VLLRRNIVIDAETAQLVAAAVQAALQAGEPSRRPGRGPRVPGVGCEPLS* |
| Ga0157374_118874542 | 3300013296 | Miscanthus Rhizosphere | VLLRRNIAIDPETAQLVAAAVQTALQAGAPSRPPRRGPRVPTADCEPLF* |
| Ga0137412_102271702 | 3300015242 | Vadose Zone Soil | VIDAETAQLVAAAVQVALQAGTPSRPSRRGPRVPAADCEPLF* |
| Ga0134073_104355891 | 3300015356 | Grasslands Soil | NIAVDAETAQLVAAAVQAALQAGAPSRPPRPRRRVPAAGCEPLF* |
| Ga0134072_102368332 | 3300015357 | Grasslands Soil | AQLVAAAVQVALQAGTPSRPSRRGPRVPAADCEPLF* |
| Ga0182036_113363972 | 3300016270 | Soil | RNIVIDAETAQVVAAAVQAALQAGAPSRPSRRGPRAPAAGCEPLF |
| Ga0182035_109278771 | 3300016341 | Soil | RRVLLRRDIVIDAETAQVVAAAVQAALQAGAPSRPPRRGPRAPAAGCEPLF |
| Ga0182032_114142322 | 3300016357 | Soil | NIVIDAETAQLVAAAVQAAFQAGTPSRPPRRGQRGPATDCDPLF |
| Ga0182034_114955182 | 3300016371 | Soil | QVVRRVLLRRNIVIDAETAQVVAAAVQAALQAGAPSRPSRRGPRAPAAGCEPLF |
| Ga0182039_106727191 | 3300016422 | Soil | ETAQLVAAAVHAALQAGAQSRSPRRGPRTPAAGCEPLF |
| Ga0182038_119349401 | 3300016445 | Soil | AGQVVRRVLLRRNIVIDAETAQVVAAAVQAALQAGAPSRPSRRGPRAPAAGCEPLF |
| Ga0187812_12433503 | 3300017821 | Freshwater Sediment | VLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF |
| Ga0187807_10147861 | 3300017926 | Freshwater Sediment | RNIVIDAETAQLVAAAVQAALHAGAPSRAPRRSPRVPAADCEPLF |
| Ga0187807_10503824 | 3300017926 | Freshwater Sediment | VRRVLLRRNIVIDAETARLVAAAVQAALQAGTPSRSPERSRRVPAADCEPLF |
| Ga0187807_10730093 | 3300017926 | Freshwater Sediment | VIDAETARLVVAAVQAALQAGAPSRPSRRGRRVPATDCEPLF |
| Ga0187806_12270371 | 3300017928 | Freshwater Sediment | QVVRRVLLRRNIVIDAETAQLVAAAVQAALQTGASSRPPRRGPRVPAADCEPLF |
| Ga0187801_101991251 | 3300017933 | Freshwater Sediment | QVVRRVLLRRNIVIDTETARLVAAAVQAALQAGAPSRQPRRGRRVPGTDCQPLF |
| Ga0187809_104183372 | 3300017937 | Freshwater Sediment | LLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGGEPLF |
| Ga0187819_100716711 | 3300017943 | Freshwater Sediment | MTGKRQVVRRVLLRRNIVIDEETARLVADAVQAALQAGAPSRPPRRGRRVPAADCEPLF |
| Ga0187819_105755501 | 3300017943 | Freshwater Sediment | VVRRVLLRRNIVIDAETAQLVAAAVQAALQPAAPSRPPRRRPRGPAAGSEPLF |
| Ga0187817_100203414 | 3300017955 | Freshwater Sediment | AETAQLVAAAVQAALQAGARSRSPRRRPRVPAADCEPLF |
| Ga0187817_104599902 | 3300017955 | Freshwater Sediment | LRRNIVIDAETAQLVAAAVQAALQARAPSRPPRRARRAPAADDCEPLF |
| Ga0187781_107335052 | 3300017972 | Tropical Peatland | LLRRNIAIDAETAQLVAAAVQTALQTGAPSQLPSRRRRVPTADCEPLF |
| Ga0187781_112637381 | 3300017972 | Tropical Peatland | VVRRVLLRRNIAVDAETAQLVADAVQAALRAGAPARPPRRRRPVPPAGCASLF |
| Ga0187780_108515961 | 3300017973 | Tropical Peatland | VLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAVGSEPLF |
| Ga0187782_102267221 | 3300017975 | Tropical Peatland | LLRRNIAVDAETAQLVAAAVQAALEAGTASWPPRRGSRVPAADCEPLF |
| Ga0187782_110334173 | 3300017975 | Tropical Peatland | QVARRVLLRRNIVIDAETAQLVAAAVQAALQAGAPSRSPRRGPRVPATGCEPLF |
| Ga0187782_111839861 | 3300017975 | Tropical Peatland | MLLRRNIVIDAETARLVAGAVQAALQDSTPSRPPRRARRAPAADCEPLF |
| Ga0187862_105602521 | 3300018040 | Peatland | RRVLLRRNIAVDAETAQLVADAVQAALCAGTPSRPPRRRQRVPPADCAPLF |
| Ga0187851_107305131 | 3300018046 | Peatland | NIVIDAGTAQLVAAAVQTALQAAAPSRPPRRRRRVPAADCEPLS |
| Ga0187766_105098192 | 3300018058 | Tropical Peatland | GQVVRRVLLRRNIAIDAETAQLVAAAVQAALQAGAPSRPPRPRRVPAVDSEPLF |
| Ga0187772_101521333 | 3300018085 | Tropical Peatland | IDAETAQLVAAAVQAAVQAALRAGPPSRPPRRGRRVPAAGCEPLF |
| Ga0187772_103358663 | 3300018085 | Tropical Peatland | MVRRVLLRRNIAVDAETARLFAAAVQAALQAGASSRPARRRPRGPAAGSEPLF |
| Ga0187772_110588981 | 3300018085 | Tropical Peatland | IAIDAETAQLVADTVQAALQPVAPSRPPCRRPRDSAAGSEPLF |
| Ga0187770_110956611 | 3300018090 | Tropical Peatland | VLLRRNIAIDAETAQLVAAAVQAALRAGAPSRPPRQDRPGPAADCEPLF |
| Ga0187770_115271441 | 3300018090 | Tropical Peatland | RRNIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF |
| Ga0066655_102473611 | 3300018431 | Grasslands Soil | RNIAIDAETAQLVAAAVQVALQAGTPSRPSRRGPRVPAADCEPLF |
| Ga0193722_10586722 | 3300019877 | Soil | VLLRRNIAIDAETAQLVAVAVQAALQAGTPSRPPRRGPRVPAADCEPLF |
| Ga0210407_105558761 | 3300020579 | Soil | IDAETAQLVATAVQAALRAGAPSRRPRRGPRLPADCEPLF |
| Ga0210399_112493171 | 3300020581 | Soil | RRNIAIDTETAQLVADAVQAALRTDAPSRPPRRRRRVPPAGCAPLF |
| Ga0210405_113245861 | 3300021171 | Soil | DAETAHLVAAAVQAALQADATRLPRRRPRVPAGDCEPLF |
| Ga0210408_100846996 | 3300021178 | Soil | QVVRRVLLRRNIIIDAETAQLVAAAVQAALQAAAPSRPPHRGPRVPDAGCEPLF |
| Ga0210393_102292613 | 3300021401 | Soil | VLLRRNIIIDAETAHLVAAAVQAALQADATRLSRRRPRVPVGDCEPLF |
| Ga0210383_100258176 | 3300021407 | Soil | VLLHRNIAIDPGTARLVADAVQAALQAGTPSRPPRRRLHVSPVGWEALFLFL |
| Ga0179589_102253892 | 3300024288 | Vadose Zone Soil | RVLLRRNIVIDAETAHLVAAAVQAALQAGAPRLPRRRPRVPAGDCEPLF |
| Ga0207710_102050862 | 3300025900 | Switchgrass Rhizosphere | AQLAAAAVQAALQADAPSRLARRRPRAPATSSEPLF |
| Ga0207684_111550461 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LLRRNIAIDAETAQLVADAVQAALRADAPTWPPRRRPRVLPAGCEPLF |
| Ga0207671_112819222 | 3300025914 | Corn Rhizosphere | RVLLRRNIAVDAETAQLAAAVQAALQADAPSRLARRRPRAPATGSEPLF |
| Ga0207693_110076621 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLSRNIAIDAETAQLVAAAVQAALQPAAPSRPPRRRPRGPAAGSEPLF |
| Ga0207693_110086342 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NIVIDAETAQLVAAAVQAALQAGAPSRWPRRRPRVPSASCGRLF |
| Ga0207662_106665742 | 3300025918 | Switchgrass Rhizosphere | LRRNIAIDAETAQLVAAAVQAALRPAAPSRPPRRRPRGPAAVSEPLF |
| Ga0207646_109279421 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | QVVRRVLLRRNIAVDAETAQLAAAAVQAALQAGPPSRRPRRRPRVPAANSEPLF |
| Ga0207646_110922812 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TGQVVRSVLLRRNIVIDAETAQLVAATVQAALQAGAPSRPPRRGPRVRAADCEPLF |
| Ga0207664_102168772 | 3300025929 | Agricultural Soil | VLLRRNIAIDPETAQLVAAAVQVALQAGASSRPPRRGPRVPPVGCEPLF |
| Ga0207664_103177283 | 3300025929 | Agricultural Soil | NIAVDSETAQLVAAAVQAVLQAGTPSQPPRRGPRVPPVECEPLF |
| Ga0209471_12742872 | 3300026318 | Soil | DAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF |
| Ga0209648_100574481 | 3300026551 | Grasslands Soil | AQLVAAAVQTALQVGTPSRPPRRGRRAPAAGCEPLF |
| Ga0209648_103084001 | 3300026551 | Grasslands Soil | PETAQFVAAAVQAALQSGPPARPPRRDPRIPPAGCEPLF |
| Ga0179593_11801801 | 3300026555 | Vadose Zone Soil | VLLRRNIVIDAETAQLVAAAVQAALQAGEPSWRPGRGSRVPGVGCGPLS |
| Ga0209179_10893122 | 3300027512 | Vadose Zone Soil | VLLRRNIAIDAETAQLVAAAVQVALQAGTPSRPSRRGPRVPADGCEPLS |
| Ga0208324_10418441 | 3300027604 | Peatlands Soil | LLRRNIAIDAETAQLVADAVQAALQPAAPSQPPRRRPRGPAAGSEPLF |
| Ga0208696_10938852 | 3300027696 | Peatlands Soil | VLLRRNIAIDAETAQLVADAVQAALQPAAPSQPPRRRPRGPAAGSEPLF |
| Ga0209448_100167831 | 3300027783 | Bog Forest Soil | IDAETAQLVADAVQAALQPAVPSQSPRRRPRGPAADSEPLF |
| Ga0209074_103465381 | 3300027787 | Agricultural Soil | PETAQLVAAAVQVALQAGASSRPPRRGPRVPPVGCEPLF |
| Ga0209656_100368483 | 3300027812 | Bog Forest Soil | VLLRRNIIIDAETAQLVAAVVQAALQADAPSRPPRRRPRVPAADCEPLF |
| Ga0209040_100297031 | 3300027824 | Bog Forest Soil | IDAETAQIVADAVQAALRAGTPARPPRQRPRVPIGDCEPLF |
| Ga0209040_100433586 | 3300027824 | Bog Forest Soil | NIAIDAETAQLVADAVQAALQPAAPSRPPRRRPRGPAAGSEPLF |
| Ga0209590_110597262 | 3300027882 | Vadose Zone Soil | NIVIDVETAQLVAAAVQAALQADKPSLPARRRPRVPSTYCEPLF |
| Ga0318538_106983781 | 3300031546 | Soil | QLVAAAVQAVLQAGAPSRPPRRSSRVPPANCEPLF |
| Ga0318573_102480182 | 3300031564 | Soil | MDAETAKLVAAAVQAALQADAPSRPPRRGRRVSAADCEPLF |
| Ga0318573_106825652 | 3300031564 | Soil | DAETAQVVAAAVQAALQAGAPSRPSRRGPRAPAAGCEPLF |
| Ga0318561_105248001 | 3300031679 | Soil | VASHAGQVVRRVLLRRDIVIDAETAQLVAAAVQAALQAGAPSRPPCRGRRVPGCR |
| Ga0318574_102132881 | 3300031680 | Soil | TAQVVAAAVQAALQAGAPSRPPRRGPRAPAAGCEPLF |
| Ga0310686_1025136742 | 3300031708 | Soil | DAETAQLVADAVQAALQPAAPSRPPRRLPRGPAAGSEPLF |
| Ga0310686_1184413481 | 3300031708 | Soil | LATGIAERASDRYIVIDAETARLVAAAVQAALEAGAPYRPPRRARRVPATDCEPLF |
| Ga0318496_100256404 | 3300031713 | Soil | LLRRNIVIDAETAQLVAVAVQAALQAGPPSLPPRRGPHGPAADCEPLFL |
| Ga0318496_104885851 | 3300031713 | Soil | ETAQLVAAAVQAALQAGAPSRPPRRSSRVPPANCEPLF |
| Ga0318500_106782162 | 3300031724 | Soil | SLACPVVRRVLLRRNTVIDAETAQLVAAAVQAALQSGAQSRSPRRGLRARAAGCEPLF |
| Ga0318509_101983203 | 3300031768 | Soil | NIVIDAETAQVVAAAVQAALQAGAPSRPSRRGPRAPAAGCEPLF |
| Ga0318521_100433971 | 3300031770 | Soil | IDAETAQLVAVAVQAALQAGPPSLPPRRGPHGPAADCEPLFL |
| Ga0318543_100420853 | 3300031777 | Soil | NIVIDAETAQLVAVAVQAALQAGPPSLPPRRGPHGPAADCEPLFL |
| Ga0318543_104666163 | 3300031777 | Soil | GQVVRRVLLRRNIVIDAETAQLVAAVQAALQAGAQSRPPHRGPRAPAAGCEPLF |
| Ga0318498_100179243 | 3300031778 | Soil | AIDAETAQLAAAAVQAALQTGASSRPPRRSPRVPAAGCEPLF |
| Ga0318552_105436691 | 3300031782 | Soil | RVLLRRDIVIDAETAQVVAAAVQAALQAGAPSRPPRRGPRAPAAGCEPLF |
| Ga0318550_105797741 | 3300031797 | Soil | IVIDAETAQLVAVAVQAALQAGPPSLPPRRGPHGPAADCEPLFL |
| Ga0318523_105065922 | 3300031798 | Soil | QVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGVPSRPPRRGPRGPGP |
| Ga0306923_106596173 | 3300031910 | Soil | RRNIAVDAETAQLVAVAVQAALQAGAPSRPARRRRAPATASEPLF |
| Ga0306921_111960732 | 3300031912 | Soil | MLLRRNIVIDAETARLVAAAVQAALQAGAPSRQPRRARRAPATGCEPLS |
| Ga0310912_115005642 | 3300031941 | Soil | RRVLLRRNIVIDAETARLAADAVQAALQDGTPSRRPRRPRRAPAADCEPLF |
| Ga0310916_111884511 | 3300031942 | Soil | VLLRRNIAIDPETAQLVADAVQAALQVGVPSRPPRRRPPGPAAGSEPLF |
| Ga0318533_104296901 | 3300032059 | Soil | LRRDIVIDAETAQVVAAAVQAALQAGAPSRPPRRGPRAPAAGCEPLF |
| Ga0318533_106737361 | 3300032059 | Soil | RNIVIDAETAQLVADAVQAALQAGAPSRPPRRGRRVPGADCEPLF |
| Ga0318510_101617031 | 3300032064 | Soil | GQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAPSRPSRRGPRAPAAGCEPLF |
| Ga0318513_102688511 | 3300032065 | Soil | NIVMDAETAKLVAAAVQAALQADAPSRPPRRGRRVSAADCEPLF |
| Ga0311301_100827685 | 3300032160 | Peatlands Soil | VLLRRNIVIDAETAQLVAAAVQAALQAGEPSRRPGRGPRVPVVGCGPLS |
| Ga0311301_102188702 | 3300032160 | Peatlands Soil | VLLRRNIVIDAETAQLVAAAVPAALQAGAPSRPPHQGPRVPAADCEPLF |
| Ga0311301_127588832 | 3300032160 | Peatlands Soil | ETAQLVADAVQAALRPAAPSQPPRRRPRDPAADSEPLF |
| Ga0311301_129839691 | 3300032160 | Peatlands Soil | VVRRVLLRRNIAIDAETAQLVAAAVQAALQPAAPSRPPRRRPRGPAADSEPLF |
| Ga0307471_1036056221 | 3300032180 | Hardwood Forest Soil | DAETAQLVAAAVQAALQAGAPSRPPRRGPRVPAANCEPLF |
| Ga0307472_1015905832 | 3300032205 | Hardwood Forest Soil | GAETAQLVAAAVQAALRRGAPSRPPSRDPCVPAGDEPLF |
| Ga0306920_1013837552 | 3300032261 | Soil | LRRNIAVDAATAQLVADAVQAALQPAAPSRPPRRRPRDPAAGSEPLS |
| Ga0335082_111515072 | 3300032782 | Soil | VLPCRNIVIDAETAQFAAAVQAALQAGAPSRPRRRGPRVPPVGCQPLF |
| Ga0335079_102418181 | 3300032783 | Soil | RNIAIDAETAQLVAAAVQAALQAGAPFQAPRRRPPVPAGDCEPLF |
| Ga0335079_103801933 | 3300032783 | Soil | IAVDAETAQLAAAVQAALQAGPPSRRPRRRPRVPGAGSEPLF |
| Ga0335079_105192732 | 3300032783 | Soil | VVRRVLLRRNIAVDAETAQLVAAAVQAALQAGEPSRSARRRPRAPAAGSEPLF |
| Ga0335079_112519741 | 3300032783 | Soil | NIVIDAETAQLVAAAVQAALQAGEPSRRPGRGPRVPGVGCEPPS |
| Ga0335079_122174891 | 3300032783 | Soil | RRMLLRRNIVIDPETAQLVAAAVQAALQTGASSRPPRRGPRVPAPDCEPLF |
| Ga0335078_102145561 | 3300032805 | Soil | AQLVAAAVQAALQTGASSRPPRRGPRVPSADSEPLF |
| Ga0335078_120073711 | 3300032805 | Soil | LRRNIAIDTETAQLVAAAVQAALQASTPSRPPRRSPRVPAAGCEPLF |
| Ga0335080_100708864 | 3300032828 | Soil | GQVVRRVLLRRNIAVDTETAQLVAAAVQAALQAGAPSRPPRRRPRAPSAGSEPLS |
| Ga0335080_101463372 | 3300032828 | Soil | VLLRRNIAIDAETAQLVAAAVQAALQPGAPSRRPRRRPRIPGAGSEPLA |
| Ga0335081_106952612 | 3300032892 | Soil | VARRVLLRRNIAIDAETAQLVAAAVQAALQPAAPLRPPRRRPRVPAADSEPLF |
| Ga0335081_109981851 | 3300032892 | Soil | TAQLAAAVQAALQAGVPSRPARRRPRAPATGSELLF |
| Ga0335081_118042361 | 3300032892 | Soil | RNIVIDAETAQLVAAAVQAALQAGEPSRRPGRGPRVPGAGCEPPS |
| Ga0335081_123645211 | 3300032892 | Soil | ETAQLVADAVQAALEASTPSRPPRRRRRVPPAGCEPLF |
| Ga0335083_105459911 | 3300032954 | Soil | AGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGEPSRRPGRGPRVPGTGCGPPS |
| Ga0335083_111996881 | 3300032954 | Soil | VRRVLLRRNIAVDPETAQLVAAAVQAVLQAGTPSRPPRRGPRVPAADCEPLF |
| Ga0335076_105104341 | 3300032955 | Soil | IVIDAETAQLVATVVQAALQAGAPSRPPRRGPRVPAAGCEPLF |
| Ga0335084_109339061 | 3300033004 | Soil | PYAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGEPSRRPGRGPRVPGAGCEPPS |
| Ga0335077_100405177 | 3300033158 | Soil | VLLRHNIAIDTEIAPLVADAVQATLQTTPPTRPVRRHPRGPAVSSEPLS |
| Ga0335077_101282472 | 3300033158 | Soil | VLLRRNIAVDAETAQLVAAAVQAALQAGEPSRSARRRPRAPAAGSEPLF |
| Ga0310914_102747223 | 3300033289 | Soil | IVIDAETAQLVAAVVQAALQAGAQSRPRRGLRAPAAGCEPPF |
| Ga0310914_110976022 | 3300033289 | Soil | LLRRNIAIDAETAQLVADAVQAALRPAAPSRPPRRRPRGPAAGSEPLF |
| Ga0310914_111838902 | 3300033289 | Soil | MLLRRNIVIDAETAQLVAAAVQAAFQAGTPSRPPRRGQRGPATDCDPLF |
| Ga0373959_0194235_3_131 | 3300034820 | Rhizosphere Soil | IAVDAETAQLAAAVQAALQADAPSRLARRRPRAPATGSEPLF |
| ⦗Top⦘ |